1V4BA

The crystal structure of azor (azo reductase) from escherichia coli: oxidized form
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
197
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of AzoR from Escherichia coli. An oxidereductase conserved in microorganisms
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords NADH-azoreductase, FMN-dependent
total genus 76
structure length 197
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v4bA00
3NHWA 3B6IA 3OWHA 1YCHA 1QRDA 3G5MA 3LCMA 1TLLA 3OX1A 4Y7CA 1QBGA 4LTNA 1YRHA 1J9ZA 4YAUA 4GQIA 1TIKA 1AKRA 2FLVA 1JA0A 2Z9DA 4QOFA 1AKVA 2HNAA 2QR2A 3F2VA 1DX9A 3FNIA 3HA2A 1RCFA 3W77A 3O73A 4QOIA 5NLLA 1X77A 2FAXA 1YOBA 1YCFA 2OYSA 1T0IA 2RG1A 4R81A 4U7FA 4ZVKA 1XYYA 3UXEA 4C76A 1ZX1A 1FUEA 3ESZA 1DXOA 4FX2A 4N9QA 5LBTA 2QX8A 5LJLA 2FZ5A 4BMPB 1OBVA 2FVXA 1XT6A 1BVYF 2M6SA 1AG9A 2FCRA 3GFQA 1B1CA 3OWXA 2XODA 4YAFA 2WC1A 5JROA 1BU5A 1QR2A 1T5BA 5F12A 5LMCA 3K1YA 1D03A 5ULLA 2BN4A 1RTTA 3R6WA 1KBOA 1KBQA 4DILA 2ARKA 4N65A 3NHFA 3NHSA 1CZLA 2W5UA 5LVAA 3HR4A 5FA6A 2OHJA 2OHIA 4ZVNA 3TEMA 3W79A 3OX3A 4ZVMA 3KAQA 3ESYA 4H6PA 4BMOB 3B6MA 4GI5A 1GG5A 3NHYA 1XI2A 2R97A 1J9GA 3FVWA 3P0RA 4QOHA 5LBUA 1AZLA 4CETA 2Z9CA 4PTZA 4FGKA 2FX2A 3UXHA 4D02A 4N82A 2AMJA 3FX2A 4DY4A 3GAMA 1RLIA 3OVMA 3NHUA 2BPOA 5F51A 4H2DA 3QE2A 2XOEA 3GFSA 4OXXA 4YAOA 1FX1A 1CZUA 3RPEA 3U7IA 4QODA 1AKQA 4ESEA 4QOGA 3O2NA 2V5UA 3FW1A 2V5VA 3NHRA 4YALA 2HNBA 3F6SA 5EA2A 4M0CA 4S24A 2Q9UA 3SVLA 2MWMA 2QX4A 1FLVA 2ZKIA 4NLLA 3S2YA 3W7AA 3FJOA 2B3DA 3NLLA 1DXQA 4NULA 1AHNA 3JSXA 5NULA 4C0XA 4C0WA 1OFVA 3EDOA 1D04A 2MT9A 1QHEA 3B6KA 3K20A 4HS4A 1SG0A 4QOEA 3U7RA 1AKUA 2QWXA 4FGLA 2QMYA 1YDGA 2FZVA 3L9XA 5LJIA 5LLDA 4F8YA 1AKTA 1FTGA 2KQUA 4ICIA 1FLNA 1SQSA 1CZOA 1F4PA 3L9WA 3OJWA 4PTYA 3ZHOA 4YAWA 1XYVA 2Z98A 4CF6A 1ZWKA 3LT5A 4XDGA 1FLAA 4XDHA 3TZBA 5B3KA 5A4KA 2Z9BA 5FX2A 3W78A 4LTMA 2V9CA 3F90A 3OX2A 1RLJA 2BZSA 2R96A 3HLYA 4J8PA 2QX9A 4U7HA 1YKGA 3KEGA 5EAIA 1NNI1 4GR9A 1CZRA 5EMNA 1CZNA 4FGJA 1AMOA 1I1OA 2BMVA 3TE7A 1FLDA 3D7NA 1C7EA 3NHPA 1OBOA 3KAPA 1C7FA 2FOXA 3EYWA 5BUCA 4YQEA 3OJXA 4Y9UA 3KLBA 4ZVLA 4LA4A 3N3BC 3NHLA 4PU0A 2Q62A 2GSWA 1YCGA 4C14A 1H66A 2X2OA 6NULA 1AKWA 1WSBA 2A5LA 4LAFA 1J9EA 3ES9A 4HEQA 2N1MA 1E5DA 2MTBA 1J8QA 2D5IA 4Y9RA 5TGZA 2FDXA 1H69A 3QFCA 4QOJA 3GFRA 1D4AA 2KLBA 2OHHA 5FUQA 1VMEA 3NHJA 4DIKA 2MOKA 2M6RA 1V4BA 2BF4A 3F6RA 3NHKA 1JA1A 1WSWA 2QX6A 1FVXA 3N39C 2QMZA 3B6JA 2X2PA 4U7GA 5B3LA 3ESXA 1CZHA 1CZKA 2F1OA 3N3AC 2HPVA 4LTDA 5F4BA 3NFRA 1ZWLA 3QFRA
chains in the Genus database with same CATH superfamily
3QY9A 4BS9A 3ZY3A 3DR5A 1VLMA 1DQYA 4QUJA 1ZNYA 3MBIA 1T2VA 2CLDX 2GZDA 3IUBA 1MX9A 4CMGA 4URVR 4AZ0B 1T1EA 3HA2A 2WP0A 1W8IA 1S2OA 3KQPA 4XIFA 2I7XA 1KQ3A 3F7NA 3B3GA 4BCDA 5BV1A 3HWWA 1DTSA 4MEJA 4GR5A 3TZHA 3V4OA 4CFYA 1P9WA 4QHTA 1P5HA 2D2IA 1Z8FA 4RA6A 4LK2A 3RTDA 1SQ5A 3UB2A 4X60A 3WK8A 4BNVA 5J3JA 2E9SA 1E59A 2QE6A 3UMFA 5LP1A 3I01A 4U2DA 3UAOA 1I01A 1TZMA 4P7JA 3RTBA 3HBFA 1TM5E 3P9IA 1XMSA 3FCOA 3I3OA 3C1OA 5E9WA 1UPXA 3SFZA 3ANXA 1ZBDA 4J76A 3W3AD 1IU9A 3CF2A 4KWTA 1OF1A 1M0WA 4BTLA 3HYRA 1RRPA 2FWPA 1YFZA 2GR9A 2Q5IA 3HQ4O 3K15A 3ZEAA 2P4QA 4HDRB 3FCXA 5F7ZA 1M0EA 2FSPA 3K0AB 3EGDB 4H6XA 5IBPA 5A5EA 2O59A 3MSXA 1IUPA 1CJKC 1KXJA 1UBTS 1EFVB 2NW6A 2IUFA 3DAGA 2IVFA 2VF5X 4YMIA 5FWXB 3TLBA 2FR0A 2B5OA 2ORVA 3IDAA 4YA6A 2P62A 3QFTA 2I3BA 1W5AA 1Y3FE 1Z6XA 1U8FO 4LJ8A 1WY5A 3ZWBA 2JJ1A 2GM5A 3OEHA 4X6YA 4NCIA 4OHOA 4BNJA 4US1R 2JVIA 3FD8A 4W5RA 1R0SA 4MRNA 3C8UA 2QPAA 3NHRA 4RTMA 1MTOA 3V8NA 2JBWA 2J9FA 5EMKA 3HSKA 1UBCA 3DFZA 1DU4A 2F9MA 4JVNA 1JEYB 2FX3A 3G8YA 3B2EA 2YN0A 3FJOA 4R2LA 1L4FA 4B9AA 4D4MA 3L1IA 2FFAA 3U5TA 1ADJA 1G6Q1 2YMPA 3QE4A 1F8UA 3AVPA 5JC8A 4RF2A 5IVHA 3SM9A 5REQA 5JAIA 1QV6A 3SHVA 4AULA 1R66A 1L3CA 3ADPA 5HYVA 5TQ2A 1D4FA 3PNSA 4E2WA 4EEZA 1TQHA 3EG5A 5IRCD 4YMHA 2EYQA 1DDIA 3I62A 1T4MA 5EJIA 1T6ZA 1GITA 1B8UA 1G21A 3KQYA 3L82B 2JD0A 4JU9A 1AGXA 1IXRC 3HYCA 3JWGA 5EZ5A 3L6EA 3RSQA 3PSHA 1V0JA 1QFZA 3F5MA 3I9KA 2HU5A 2R8PA 3ND6A 2JGMA 1Z3IX 2WYWA 3VHLB 4GKKB 2ZJAA 2OENG 1KDPA 2CD9A 2LNDA 2WP8J 3KHKA 5CH8A 4KIFA 3IDQA 2ZIZA 3R40A 3RHSA 3IPLA 4EI8A 5AK0A 3GQVA 1RAEA 2H9IA 5LP6F 3FDJA 1ESMA 2XNDA 1UEIA 3JQBA 1UMBB 1M34E 3TAUA 1R0CA 3HYTA 1U04A 4DQVA 4EJ2A 1NQAO 1W88A 4TTAA 3JD2A 2I1QA 4RZ2A 3IAS1 3GRRA 5F7OA 3BH7A 1TGVA 2PSDA 1C9YA 2ADOA 2AC4A 1LPSA 4DWVA 3RVSA 3EWIA 5AXDA 4Q1EA 3OO0A 5JFGA 4QBKA 4P1ZA 5BRNA 1TM1E 4RJKA 4BMDA 2OFXA 3ISJA 4I9NA 2OCXA 1HRDA 3AESA 4GR4A 1C1XA 1MT3A 2Z8YA 4JOBA 3A14A 3STXA 3NVMB 3RS8A 1ZLYA 3IVCA 2EP8A 4KPUB 3BSYA 5EG5A 3TD6A 4PNHA 1RMYA 4PFSA 1YRHA 1KY5A 5CFMA 2AFHB 4YUWA 5JD3A 1Y89A 3Q6MA 2O6LA 4YUXA 4WUVA 1JQJC 1E77A 2WU8A 1LFAA 2BCEA 2XLCA 2P1DA 3P5SA 2CHEA 1F3LA 1C8LA 1NJ5A 2ZRKA 4EG0A 5JHHB 4HNUA 2ZZNA 2J4DA 4R1NA 2I03A 4PAMA 1AOXA 1J0BA 1EX6A 2R6JA 1BOOA 3H1TA 2ZWPA 3KU4A 3OU2A 4QPCA 3M7IA 5HIMA 2AXEA 4OIFA 2HADA 1BMFA 2DHDA 5T4HA 3C8HA 1XZEA 3M6MD 2A58A 3PNPA 1P60A 3DSRA 3BGIA 3NHBA 5DRTA 5CDUA 1SBYA 4ZVQA 4JBLA 3BM5A 1U8CB 2BEUB 4LYHA 2OYRA 3F8WA 3C6XA 1O95C 4NFSA 2BIFA 2EBFX 4H0FA 3GVPA 3HR7A 2Q50A 2J5RA 3LPAA 3DVLA 4HXFB 2QN2A 1GWNA 2P0EA 2BSQA 1CIPA 3QPUA 4DM4A 2KW5A 2EZTA 2ZE7A 4O5OA 1NP7A 1DUIA 1M2GA 3RVNA 1QRAA 1N8SA 1CLEA 3RADC 1U3FA 3PHLA 3S4YA 3IXMA 4WAUA 4GOXA 4KOEC 1SVNA 5A4FS 3WBKA 1AGYA 2RH8A 5DWVA 3DLAA 1KQFA 2A1UB 3EOBI 3GEGA 3P5BA 3TGWA 1D4ZA 4FYVA 5EWJB 1UDRA 4R71A 5TMEA 3HS3A 2CDRA 4Z0TA 2YNMD 2CLKB 2WU1A 1W5TA 3B8EA 4MVXA 5D86A 4L0CA 3L2OB 1D04A 2DR3A 4Q3DA 3RYCB 3I1IA 3GLIA 2W48A 4QYTA 2BM9A 3QELB 2GD1O 3ZW7A 3IP9A 5LCXA 4PYOA 4EQ6B 2QEQA 1G60A 2OHVA 4HGPA 4TKUB 3TIFA 7MDHA 4V02A 1RP7A 3HTXA 3TDNA 2OBNA 3GC6A 4CF6A 1AK1A 4Y2QA 3MTAA 2W58A 5C1OA 2HQSA 4BL5A 1J5XA 1R0BA 2DVMA 3TBHA 2JFXA 4KQMA 1ZRHA 5DRYA 1SCBA 3WL6A 5ENVA 5C8YF 3KZXA 1H8EA 1BJTA 2RB4A 4YY3B 1TAQA 4DLSA 7GPBA 1BW9A 1GHTA 3AETA 2WZCA 3PWZA 2X15A 3NKLA 4RC9A 4XW2A 4BV8A 5JJCA 4DCCA 2IEZA 5LZ4A 1KPGA 3ABIA 3EISA 1DAMA 3PYLA 3AUYA 1JXOA 2B83A 3VO9A 1S89A 4DMRA 2I34A 4F56A 3BCSA 1JH8A 2E21A 2GZ3A 4HEQA 3OLYA 1UKZA 5ICEA 1IVYA 5LQNA 1SRRA 4QBFA 3BIWA 5ALHA 3SWWA 1EHYA 4TRRA 4EB6B 9ATCA 4K5QA 1GZ7A 3VU3A 2WQ6A 3NUGA 1B14A 4XJVA 4BVLA 1F9EA 1BFUA 2R44A 1CS4C 3RWMB 1F0PA 2BEVB 2MR6A 2ZUCA 1EP1B 4M76B 4UBKA 2BCGY 3RR2A 3W8FA 1J39A 2WZBA 1NIJA 2P9YA 3SDSA 2PEYA 4IYRA 2I6QA 4RTLA 2B2NA 4U7TB 5ERGB 4LYYA 1ZCZA 3VNRA 1E1RD 3A2KA 1SOVA 2JLBA 3BMOB 3AJAA 4HQOA 4NZZA 1WLSA 4XSHA 5SYAA 4BUCA 1T9HA 4CG1A 4B7AA 4YAUA 2E5FA 2OZKA 3K9HA 3O1LA 3AFGA 1TTPB 1GG2A 1YS1X 4MAAA 5KWEA 1ULBA 4J0IA 4R9UC 3AILA 3A9CA 4F9TA 2P6MA 3IP7A 3FF1A 3JR3A 2BGUA 1RHKA 2DR2A 2HSZA 1V16B 1DXOA 2IUEA 4DLUA 1F2TA 5T5QA 2JLWA 4WEOA 2WUGA 1MIOB 4V0ME 3SR3A 4R51A 5DI3A 5HM8A 2F2TA 3WKEA 3OOYA 2JIDA 4LOAA 4OCZA 3AESB 4UNSA 2ZSUA 1MRSA 4GVXA 4OBBA 2RBKA 4C7JA 1DBIA 1I4LD 4YS6A 4KAFA 2X5XA 1YRAA 1AA6A 2LTAA 4NBTA 3TM4A 1N7JA 5KVSA 1ZI8A 5FA5A 2WK1A 4CMJA 4O29A 4V0MA 3WADA 1RJ9B 1ZJ6A 5DYGA 1U2GC 1RE1A 2O14A 2AXQA 2NO0A 4UUBA 3TLGB 2LPMA 1G8JA 2PWYA 4DKJA 3OJEA 5DISB 4XYBA 4OFZA 3EXEB 4HVAA 1OLUA 1RLTA 3BCRA 2ID8A 2RSLA 3D2CA 3NXSA 5TPWA 2SKDA 5EJ4A 3C7TA 4GMKA 4Z7OB 2GILA 2Z0MA 2C4MA 5EJ7A 2RGUA 3LECA 5KSWB 2WR8A 4PV7A 3R8FA 1R18A 2ZPUA 1J0XO 1B7GO 5DYTA 5JV5A 1KP9A 2GCOB 2GPSA 3FCYA 2BDUA 1F0YA 2VUTA 3Q0TA 1RADA 4O2BB 4J43A 3M6AA 2BMDA 1CIJA 1YTLA 3G2IA 3I45A 3MMZA 3PD7A 4NEGA 4PFQA 2XUJA 3RKUA 4BB5A 3PXEA 4IKOA 4QPDA 3F73A 3DTVD 3DJYA 4KO1S 4Q39A 1D9XA 4RF3A 5EVCA 3OCUA 2AJ8A 1JKMA 2VEDA 1XQ9A 1W1IA 3ZDEA 2H7VA 4KODA 2AFIE 1HYEA 1EZZA 1UANA 3KJNA 2ZUFA 1S5PA 1UBSB 3NU1A 1HH4A 3D7MA 3BJMA 3I2YX 4YAJA 3NOXA 2WNSA 2Q2NA 1H1LA 4HQNA 3UUFA 3EARA 2Q6TA 5I5EA 5KOJA 1QJCA 1A71A 1KI6A 2PBLA 2G72A 2PBRA 5K7SA 2IPAB 3V3KA 5J2UB 1W76A 3Q3VA 3ZWAA 1HEUA 2Y1EA 3MCAA 4YRJA 3E35A 4O2LA 1AK9A 4ISCA 5TX7A 4OKNA 4BAGA 4GP7A 2P4HX 4YRZA 2AFIA 1ODFA 4X71A 1DKPA 1QIMA 2R65A 1UZMA 4WNAA 2O7NA 1LRJA 5FCDA 3SQNA 4EFNA 1DC4A 821PA 3ZDYB 1I4DD 1PZNA 3BZWA 3G1UA 4PM4A 5HBGA 4F46A 3U4MA 4K2HA 3NTXA 2JGFA 2K6GA 3MZ0A 4J0KA 1HT2E 5AVJA 4UFNA 5HFAA 4JDUA 4DZRA 3AEUA 4AU1A 1DTWB 1J24A 4D8XA 4K9OA 2ZYDA 4TPKA 3RFVA 2VO1A 1H3NA 1ZW1A 1MAUA 1KNXA 1TKRA 3K9CA 4ZAZA 4BNKA 2QX6A 1GQYA 2BISA 2FPIB 5ICSA 2V8OA 2G1UA 1U3VA 1DEAA 4TMZA 5DBGA 4G4SO 2HXYA 2J3QA 4OQPA 1BS1A 1UMDB 2WZQA 4PPQA 3W7VA 1XVVA 1PJLA 2FRVA 4NCKA 2R8ZA 3LCMA 4HGYA 3E7FA 1OLXA 4KL8S 3QVXA 5KOJB 4DLNA 1EE2A 1N5DA 2HNAA 5K0JA 2C97A 1WY7A 2ROQA 5D7NA 5SZJA 4ZICA 2I1LA 1CR6A 1Y4DE 3LFHA 5KINB 1A7UA 1N25A 3BH0A 4WZAA 3WJ1A 1ZAYA 1YS4A 2IF0A 4QL3A 1LBTA 1DWQA 4BGUA 3QF4B 2XNCA 3CJTA 4KXYA 4ZVOA 2QNBA 2AF4C 3MTGA 2F3TA 2HK6A 4OJTA 3BRQA 1Q14A 2PT9A 1E1CA 2BEVA 3ZQJA 1ZGHA 2WAOA 1KFJB 1PLKA 3A3PA 1WRBA 2FRDC 4JGGA 2FEKA 3ETJA 4C5BA 1OB5A 3WQRA 2R1TB 4WCFA 5AKYA 5CXQA 2I2XB 3X1ZA 3Q15C 5FOQA 8OHMA 2HO5A 1P0MA 4FCWA 5H0IA 4H4DA 3OPYA 4INZA 2AUTA 1Z33A 3AR3A 4BC0A 1GT6A 2KI5A 4G1CA 1F7UA 1VPEA 1EX1A 3AB7A 1HYQA 4LF6B 3B6MA 3JD0A 4GI5A 1NN3A 1GGFA 3GD7A 2PH3A 3U56A 2B35A 1FQWA 5AVOA 5JD5A 1AZLA 4JIGA 1YT5A 3L7KA 1LSJA 1IHXA 4KPUA 4RIHA 2XKBA 1IZ8A 3CLKA 3RYFA 5C5IA 5AVRA 4UAVA 1D1TA 3ZY4A 5GV7A 2PTHA 3H0CA 3MRSA 4Q9IA 3B9PA 3K4PA 2CNKA 2OB1A 2C2HA 3DBHA 3L4SO 4ND8B 3TLMA 4TQ9A 2IZ1A 4D56A 5HKOA 1DDGA 1JAZA 1EKXA 1SUCA 4MYUA 4KQ6A 4Q3BA 2CKDA 2HJSA 4JKIA 4EGFA 2BFEA 3PC4A 1BOFA 2BI7A 3D6VA 5FWNA 2IYNA 4MGYR 1DKMA 3H9BA 4GNKA 5IYZF 2O8VA 4M1MA 1FX0B 4J1QA 4LHXA 4LJLA 4ZMBA 2ABWA 4C0WA 2ZT7A 1IQRA 3P52A 4PX2A 1ISRA 4QLOA 3B89A 3FNFA 5JXGA 3GDFA 1HLPA 3I04M 1TF2A 3IFSA 1A82A 3O9MA 4MQ5A 4ICIA 4NOMA 4WGGA 3SC2B 1GPH1 2RGYA 3FI0A 4TLBA 5AW2A 2FW7A 4LSMA 3HKEB 1B74A 4HDRA 4GICA 2GHIA 4R9SA 1JFFA 1K86A 4P3OA 4NZYA 1JHZA 1NBAA 4G1BA 4YP5A 4HRXA 5DM0A 5ALPA 2IXTA 5FL7A 3WRWA 3ITDA 2XMQA 5FPSA 3HXQA 1P2UA 2XCQA 4H1UA 3JARB 4ZU6X 3L8HA 1AMOA 5IFLA 3MD9A 5IXSA 1OU4A 3O1HB 5TY0A 3OHSX 1TOAA 1Z82A 3H5RA 1PWHA 1A1VA 4BWGA 4F2HA 3WNBA 3B2QA 3QPVA 2CKMA 3G79A 2PKQP 3KLBA 4N7BA 3GMTA 4UBNA 5DW3A 3K0BA 1CJVC 1FF9A 2B7BA 1CDEA 2IYAA 3PEFA 1UOEA 4OHYA 1UBGA 1NW3A 4FR5A 5ALXA 1BMFD 2QYHA 5ECWA 3IVRA 3JR7A 3FN4A 4OHXA 1X7XB 2WB2A 3OFJA 2P2ZA 2R6R1 3N0WA 1PR6A 3H8JA 1FA9A 1RXIA 4PGGA 4IZHA 2R7LA 5FNVF 1ZIXA 1FRZA 2WIKA 1K8ZB 1Q83A 2AYYA 4JX9A 5IPFA 2JRLA 4K26A 3QP9A 1E94E 3ZHZA 1UXGA 2Z58A 5BMVA 3HK2A 3MNFA 1P2GA 1KSHA 3I12A 2CUZA 2BTEA 3DBIA 5H4HA 2XOKD 2DQ4A 4X92A 3BWBA 2R68A 5AJZA 4DR6B 3OBIA 2J32A 3NPMA 2G09A 1G55A 3KDSE 1NBME 1SR8A 1FFDA 1YS9A 4BNYA 2HREA 1THTA 1QDUA 3RVRA 3BULA 3ZXXA 1TIPA 1A8QA 4GE3A 4PLHA 1E9SA 2IY9A 4XVHA 4G81A 5DNCA 4Q9DA 1E6CA 1WCV1 3B3FA 1Y9DA 5DF1A 4KR6A 5BN3B 2AS0A 3W6NA 3WZMA 1PW5A 2VHEA 4CKEA 5H59A 5FAKA 2ISQA 2JBAB 2QW0X 3F5DA 4I5DA 3JQQA 4CHTA 4E09A 4CF3A 3IL2A 2FFHA 1CY8A 2I29A 5B58T 3TIVA 3U7FB 1Z6ZA 3B1VA 3R0QA 221PA 2DHQA 3PT5A 4MQ6A 2KE5A 1IY9A 1KGSA 2HAEA 5LKRA 4HWOA 5J2UF 1RBQA 1G5PA 3HA5A 3CNQS 3UHAA 2R7AA 2ZRPA 1RAFA 2CK3A 2IH2A 1RTKA 2Y4NA 2F62A 1R37A 1A3CA 1D2GA 4C0QC 1K3FA 1PSWA 1VFPA 4RLQA 1Y33E 1UINA 1UPFA 3AOEA 3Q88A 2HEGA 5JE8A 2Q4EA 1PLJA 3EWSA 3HNPA 1M8JA 3LX6A 3HVKA 1NVFA 3QE9Y 3VYRB 3ZIUA 4F9FA 3HB9A 3W1WA 2V3WA 2UUCB 1I30A 1NFRA 2WUFA 3LSYA 1E4EB 1DUVG 2HU8A 3AV3A 2WUWE 3MERA 1CS0A 4FDLA 2M2IA 4M0CA 1RKUA 1XJWA 2EJVA 1Z4OA 3EA0A 1T3ZA 2BONA 1MABA 1V5GA 4M55A 4NKRA 3TR5A 2JFYA 5DE3A 5GM2A 1HV8A 3TAHA 3DXXA 3UKJA 3PEWA 3KYJB 4LE1A 1AO3A 1BEEA 3DZ8A 4EW2A 1W30A 2MT9A 4NECA 5J2TB 4AICA 1U6JA 1M0TA 2QG9A 4IS2A 1B6RA 2GCIA 2YJ4A 4UXHA 5EHQA 5C2JB 3PUXA 3LGXA 4DB2A 1EFVA 3N9IA 5CJJA 2GZ1A 1T8RA 2C2MA 2JJ1D 2WJPA 2XXAA 3PI6A 1I2AA 4BWFB 2H52A 1QGED 3H86A 1H8ED 2AYXA 3QG1A 3ETHA 5JXIA 1P44A 4HYQA 3W90A 1CKEA 4LTMA 3QVGB 1Z16A 4Q5IA 4DWJA 2EF1A 2V7UA 2AK2A 1OXXK 3GUZA 3PPYA 4YV7A 1KI8A 3LPNA 3UM9A 4Q24A 3ZQKA 2Y68A 4KNWA 2BJHA 4QDKA 2VOJA 4PXYA 4YR7A 3CWCA 2Q5EA 2QE7D 5AVQA 2E4VA 1IN6A 1DSSG 3EQZA 3LIIA 3NNSA 3DLBA 3L4BA 4M7OA 1INLA 5EJFA 5E9JA 3AP2A 2QAJA 3ZDRA 4LHYA 1NXTA 1ZI9A 4WASA 4BNUA 1C9MA 2GN2A 2GPYA 2H5LA 3P32A 2HF2A 1UFQA 4PE5B 5FLYA 1VL1A 1LW6E 4RAQA 4D3DA 4RWEA 2C4HA 1UT8A 2V7BA 1XCBA 2J7PD 2RCYA 2WU3A 1TZ2A 4RU1A 2JGNA 4O2BF 3T5BA 3UGJA 1JHQA 1HDYA 3OZXA 1TUBB 5EJ6A 5F9MA 4OYHA 121PA 1FZTA 1E6UA 4CF5A 3EYAA 4W82A 3UHFA 1YE3A 2ZK7A 2CFOA 2I4IA 4N0MA 1ZC3A 1S96A 2NO7A 4G56A 4XQGA 1T4BA 2A5GA 1KH3A 2DBZA 1A1SA 2Q6IA 3O84A 1SBNE 2XRMA 2NNWB 4EPXA 2WWTA 3FPCA 1KZ7B 3X1JA 2QXYA 4IGFA 3I1FA 4BMXA 3T06B 3H2HA 2G67A 4R9RA 1A9XB 1VCNA 2YV3A 3ESRA 3QQPA 3W78A 4EENA 3UH1A 3VAZA 4QTYA 4HL6A 3KOWA 5EGSA 5G53C 5BV0A 1I3KA 2BHTA 4PRKA 4TWJA 1DC7A 2VXOA 2GN8A 2GPTA 3Q3HA 1GSAA 1YB2A 5EKDA 4M0FA 1C0IA 3JWIA 4TV8F 1CE8A 2ZQZA 4YCLA 4X1YB 1CIVA 2NPOA 5F73A 2JEYA 2GCNA 4IIJF 3V1UA 1W52X 4H1HA 1TA9A 2G8NA 3G23A 4ZT2A 2DULA 2YTZA 2CFRA 1IEQA 2W98A 3A6LA 1ZM7A 1F8YA 1H2FA 2OHGA 1NI4B 3Q7QA 3ZK9A 2I71A 2OQIA 3HZRA 4GSLA 3SFVA 4MW9A 1DJMA 2FG5A 3EC1A 4RCYA 3A1FA 5LPNA 3OTGA 2IV7A 5I4IA 1CJSA 3IUSA 1K27A 2RBGA 5HEKA 2GN6A 4J16C 2YS6A 3TTXA 2HWUA 3D9QX 1GRQA 4PRZA 1G1MA 2C9OA 3EVDA 4C04A 5IKPA 3AVQA 3H9GA 2F55A 1Q44A 3S5UA 1U8EA 5LXTB 1N1EA 3AOEC 2JFQA 3L0PA 3WSWA 1OFUX 1M5RA 2V7PA 4EMSA 1SBCA 5BXYA 3SE0A 1C1DB 3I9V1 2NU6B 2R00A 2VAWA 1E1CB 1WVIA 5J43A 5PNTA 4QUKA 2A7QA 2DWOA 3TPCA 2V5VA 3DC2A 5JATA 5THXA 4YEDA 3H8WA 3CKKA 1I4WA 4HFMA 3QF4A 3OPVA 2HHLA 1W96A 4Z9BA 3C7DB 4C20A 4EHBA 1ISMA 1YUNA 4RK5A 2NTJA 2QI9F 3CTMA 3LMKA 1QSGA 4DXAA 5ETJA 3HUUA 1G7RA 4I9UA 1K7SN 1U8XX 4H77A 4L51A 4MXDA 2H2FA 4N5DA 4RY9A 2ZTSA 5IK2D 1NVDA 2WFLA 4D42A 1WVMA 3GUHA 3T5DA 1AU9A 4RHTA 3V1LA 4HFNA 1UZUA 3DE6X 1SKBA 1Y3CE 1E1QD 1EAMA 2HRQA 2YHIB 3VU8A 5AKIA 2H2GA 2JZCA 5G1NA 4KREA 3ZTTA 4ARCA 5H3CA 4ZOAA 3PVSA 2D0PB 2OY0A 3RUAA 4CN8A 3P0EA 5AM5A 2J0UA 5CVEA 2BMVA 2ON6A 4JB3A 2MSCB 4TSRA 1E8DA 1XQYA 5BQXA 1SUEA 4EI7A 2E3JA 3CLRC 4NU6A 2NZ2A 3I1JA 3ILYA 1L2TA 2COKA 4P22A 1W5EA 1GA4A 1O5OA 2EJTA 3HI4A 3D6FA 1EXMA 1Z8NA 3Q3EA 4PHCA 4UMDA 1IG0A 4ZXPA 2TMKA 3H5IA 5B5SA 3EQ9A 3QRWA 3W6PA 3BBLA 3H1BA 3TK1A 1GQ2A 3ZHSA 3C16C 3GLVA 3LFTA 3ZX4A 4TVOA 3N70A 4BZZA 2SNIE 2Y3IA 1IIRA 3AHDA 3TQHA 3QHAA 4BIMA 1AHHA 3EJWA 4PGFA 1WKCA 5BV7A 3O4RA 1DBQA 2PJUA 4E94A 6AT1A 3IVXA 3ENQA 2XAAA 1BDJA 3HYSA 3BL8A 4KAXA 4PLWA 4X45A 1RXVA 2ZIXB 2JFWA 3LP8A 4XX0A 4RHFA 4CIVA 4MV6A 2FPRA 4Q9JA 4E5NA 1ATIA 2TECE 1RCFA 2FWJA 4KMMA 4MV1A 4R9VA 2FWNA 4C0LA 3KOUA 2JGKA 3VXKA 1OKKA 2V0NA 3Q6NA 4KQCA 4LJYA 5PGMA 5C8ZA 2A67A 4TRNA 4HDNA 4NK4A 1Y48E 3ORFA 1JALA 4RPGA 1ZCJA 1EDEA 2Q1UA 4QARA 1XOIA 3DOJA 3IGFA 3JQFA 4M1WA 5FWDA 5AVZA 4FWBA 4F2PA 1JHAA 2PD4A 5KOIA 2GCPA 4XQ9A 1WDLA 1XP5A 5JUWA 1VIDA 3B7WA 3WLLA 2EQAA 1RM4A 4W9NA 2IY7A 4Y2JA 1RHQA 5JADA 1ZD9A 1D8AA 3TZEA 5JHGB 1N2EA 1R5OA 5CLQA 2WG1A 4A4DA 5FTKA 1RRVA 4BMOB 3NX4A 1KQNA 4B75A 4EZIA 3VDMA 4K9MA 1L6IA 2FSIA 3PHHA 4OREX 3Q2IA 1H1TA 3LUPA 4JBNA 3NBAA 4LNUA 4JC5A 1NUAA 4MA0A 1RC1A 2BL4A 2X4GA 1RRCA 1OZ0A 2YV4A 2FPOA 4FFVA 3SZMA 3OCYA 3Q40A 1MO2A 1R74A 1SCIA 3QUSA 2FE1A 4WNAB 3JALA 4JUDX 3UK1A 3I42A 2GZRA 4HH3C 2C4VA 2VDKB 2YCBA 4DDVA 2WPDD 1LA2A 3GLSA 2DLCX 2MWMA 3OCCA 1KTVA 2EKBA 4WA8A 5K4AA 4EG6A 3LTNC 1JWLA 4BP8A 3GB9A 3CZMA 4BMSA 3FCAA 5KYNA 5I7AA 3FNGA 3OQHA 3F6PA 4WOCA 5BXQC 3CPJB 1ICIA 2XHZA 3DZBA 2BGTA 4XVRA 3PD0A 3W05A 4YDHB 1S2DA 2OM2A 2SCUA 3FSRA 3T99A 3A6PC 3L6DA 5EJ5A 2E55A 3FTFA 2IOQA 3NEJA 3D4PA 5B3KA 2LXNA 3FROA 4TKLA 3CONA 1H85A 1ZCBA 3PJEA 1RKXA 1T3SA 2YNMC 2FSGA 4WLOA 4R8SA 3UJ8A 4XX1A 3PC2A 4J8PA 5HF6A 3TLCA 4B3JA 3BGWA 1N33B 3ONDA 1PNQA 5K8LA 2P9HA 4RTQA 3TRJA 2I9PA 1X6VA 1DQPA 1QYCA 2P2CA 5JCXA 2R47A 3OJXA 1FNBA 2W2KA 5TV2A 1I7DA 3UMMA 1V7CA 1Z68A 4QDUA 3H1AA 5LIRA 3K30A 2LZ0A 4KPEC 4MKHA 3EMVA 1TD9A 2OO5C 3FETA 3EFEA 3IERA 3OFKA 3AVWA 1ETUA 2SHKA 4PAGA 4R2IA 1OT5A 3VUFA 1M8GA 1MFZA 1NJ8A 4QIHA 3G59A 4LRTB 1TMKA 3F6RA 4QUAA 4FW8A 1DZ3A 1GZ4A 1WBJB 1ZHFA 4QDTA 5E6RA 5EZ6B 2NZVG 1TCBA 1XNHA 2XB4A 4LWQA 4OYRA 2IV2X 1N9ZA 3A1TA 3IAFA 5LZ8A 5L3SB 2NSLA 3R09A 3RJ5A 1QLHA 2DAPA 4XWTA 2JFVA 4R8MA 2KLHA 4D3SA 1PUJA 3LZ6A 1XUOA 1PV4A 3RYFB 1ISJA 2X8JB 2C2OA 1JG1A 1A5ZA 4P8RA 1TZKA 4PNZA 3JRXA 2JLRA 3BERA 3OESA 3WMWA 1QQ7A 4XARA 1KK2A 1N6RA 1PDVA 4Z3OA 5BSVA 2YRFA 4GQBA 1I8TA 2WE8A 1H8HA 5B1DA 5CD1A 3M6WA 4GPTA 1YFLA 2VZ0A 2XCOA 3EXHB 1S0UA 2LKDA 2R7NA 5EN4A 1RXCA 2W0MA 2XYVA 3NDPA 5JT1A 3ZVLA 4Q1CA 1X1AA 1V43A 4YAEA 5A05A 1VBNA 4JSTA 1R4AA 4N5NA 5BQOA 5KQSA 2XCUA 3DBLA 2ECPA 3JVVA 4HZGA 4I3GA 1MAHA 4PS0A 1ADFA 2NO4A 3N76A 2Z5GA 4PQRA 3RSZA 1CZLA 2YMMA 4B6EA 1D7OA 3C3CA 1OXVA 4RJJA 1RJEA 5K2MA 2OILA 5BURA 1M2VB 5K3CA 4ZEOA 4C08A 1E60A 1F1BA 1RVV1 2P65A 5E1BA 1SKYB 1EGQA 1P0PA 1OC4A 2GN1A 4L95C 1JKFA 3ROQA 4JQZA 1M6WA 3F6EX 5ALSA 4QGFA 1G6OA 2AHOA 2FK8A 4N12A 4KSCA 3ZWOA 4D74A 2PUBA 3KBOA 4MKRA 5I3CA 4A10A 3TSZA 2K4MA 3BCHA 4X64B 1L5NA 2X1MA 4M1EA 4ZD6A 3HCBA 3IDZA 2WOJA 2TS1A 3SJBA 4BQNA 3W2IA 4TSFD 1EM8A 3PR2B 4N54A 1Z6AA 5KAMA 3HZHA 5IMBA 3VZCA 1CHDA 4FZRA 4ZCTA 5IXYA 2PUFA 3H1EA 5A4DA 1L9XA 4REOA 3NETA 1MKYA 3A6FA 3VKHA 1X9GA 3E27A 3HV0A 5COAA 1M5UA 5FI1B 3ZU4A 4DGSA 1OH7A 3D31A 4LSWA 3QSYA 3DWFA 1RAAA 3K71B 4P0QB 3E3LA 4KO3S 1JSRA 1WHTA 4MTLA 2FW9A 5CDHA 5AK5A 4LZZA 1SU8A 2CVOA 1IWOA 4IZOA 1JWBB 4Q4JA 3K09C 1N4AA 4DN6A 2ZS9A 5F23A 3BK1A 4Q01A 3WFZA 2VDJA 3AR9A 1NKSA 1SELA 3JWJA 1FDSA 4G07A 1H0KA 5F5LA 3WXMA 3ZUGA 4XDZA 1F0KA 3SR0A 1LNSA 3HY6A 3L02A 1Z0DA 2VH2A 1SY7A 3G2JA 4HN4B 4K88A 7REQB 2H11A 3MA0A 5FXMA 2VT3A 3L7AA 4BU0A 1CRWG 1ZM4A 4EH1A 4MRPA 1E3EA 1V4NA 4B76A 1P5ZB 2CHUA 4KIUA 5IJ0B 1WO8A 3K70C 3TGLA 4IDDA 1NN1A 2XGSA 4RNDB 1GA6A 5TMDA 2PAAA 4MYTA 1J2EA 3QNMA 4H3SA 4RA9B 5FFNA 5CA0B 2KX7A 3E5HA 4BJ6A 5HGJA 3C3MA 1N5OX 4V0RA 4ZVUA 1U3GA 2D74A 1XNGA 2HHJA 3JX9A 1DMRA 1JU4A 1YMQA 4ERXA 5CPFA 1EIWA 4JKYA 1GUDA 2FP4B 5JCOA 2XUKA 4DLZA 1FTYA 1M2VA 5DLEA 2C7VA 4GECA 1YAHA 1VI6A 2WVJA 4RCZA 3CG4A 5TARA 1PT5A 1X15A 1IEXA 1TK3A 2WWXA 3VTKA 1EXNA 1P3JA 2QQGA 1NQTA 3E53A 3H4TA 4UHKA 1SBHA 1XZKA 2JFBA 2V74B 3HVJA 2OWDA 3JVDA 4RKQA 1QGUA 2XNKA 3LD9A 4P92A 1OVMA 2W2TA 3CRW1 3DOUA 4IS3A 4ZOQI 5IT4A 2I6GA 1ZRMA 4FE4A 2JGEA 4F2GA 4G0PA 4UDXX 3P9RA 1QFSA 4Q9HA 1OTXA 1QHFA 3CSDA 2FSSA 2YVKA 3FDIA 3EZGA 4QGGA 4K28A 1Z75A 4IIEA 3IP1A 4ZT4A 4PYMA 3UAXA 3WSVA 4Q9LA 1H4VB 1P17A 1QIJA 3RS9A 2I65A 4YYEA 2FLWA 2H4ZA 3RV4A 4C6TA 5KPDA 2XMRA 1P6UA 2RGDA 4B8YA 1AKNA 1D03A 3FVQA 2XH8A 3M3DA 1U0GA 1UMCA 3RVDA 1V3TA 5EIFA 2JHAA 4PXSA 5K01A 5CU7A 3ER8A 3LKBA 4IQ4A 1GNPA 4EHFA 1LSUA 1PZGA 2BM8A 3QM1A 2VDUE 1RQNA 1US8B 3QVLA 1MB9A 4IFEA 1T9AA 3S3TA 3TB4A 1GTJ1 2YWDA 4W9NC 1VI5A 3GH1A 1BO6A 2R86A 2ZVQX 3HJFA 1N6HA 3LRTA 5ALRA 1CRZA 3EIQA 3KS9A 2GJSA 3N87A 3PQDA 4UULA 3QEAZ 1PL6A 4QOHA 4W1SA 1FIUA 4AUMA 2AA3A 2IBSA 1KKMA 2A1TS 5K2OA 2VSNA 4HLDA 1EG2A 1Z5OA 3MAAC 3SICE 1WKVA 1E3JA 5DT2A 4OATA 3U39A 4UTZA 3HUDA 1T9KA 4UE2A 3PWTA 5ALZA 3PIIA 3JY6A 3I28A 1UXOA 3PNVA 5ARDA 2UUOA 5E95A 3F46A 3RBVA 4URUR 5A9TA 1QQBA 3DTNA 3E61A 1T4CA 1LXCA 1TO2E 1GOTA 1A9RA 5AVUA 3D3WB 4IIFA 3U31A 4BX0A 1CR2A 3OFNA 4W5JA 5JAMA 4RXUA 2CLSA 4X8MA 3IBYA 3GEBA 3IODA 2NV0A 1R6VA 1DX4A 3EH1A 3WL7A 1ND6A 4G84A 4CDGA 1R0YA 2IUSA 1T6BY 2B98A 3ANLA 3S7ZA 2PD6A 3L9XA 5EC8A 5JLJA 3HXOA 4MUGA 2EJBA 1ZNZA 1YS7A 2SICE 2QY9A 3R3YA 1S2GA 4QE3A 3C3KA 1LLDA 5DTRA 1JHXA 4U3JA 4XGIA 2TMGA 5HDBB 3T7DA 1Z2EA 1YA8A 3LF1A 1KFKB 4P36A 4RYLA 2EKPA 2R0QC 2R96A 2Q1XA 1X7ZA 2ORWA 1E3TA 1MFPA 1XRQA 1PK9A 2ZU6A 2Z1DA 3D3KA 3D7NA 1Q74A 1CBUA 2WT9A 4CTNA 2PUEA 2HC9A 1JJVA 2CZGA 1WABA 2VHXA 3PLAE 3T1YB 2QK4A 3MSCA 1MAAA 5TDHA 2WA1A 4P82A 3LBHA 1YZHA 2CFTA 4NBNA 1YE5A 4KYIB 2B34A 5G0SA 3A6DA 2FMHA 5IAEA 4AQDA 3QEOA 4X9XA 2JARA 2CHGA 3ADKA 3EUFA 1XZCA 4GGMX 4Q7LA 1DXHA 4XIYA 4LDAA 3BSFA 4X61A 5SZHB 3RWOA 3W2TA 3LAWA 3V8EA 4CIYA 2MOKA 2D4HA 4LHEA 5GGXA 4JY7A 2CMFA 3HDJA 3LE8A 4IDCA 4OK3A 5BOSA 1S9DA 3WGJA 1RE0A 3D7LA 1RI4A 4M9CA 3RF7A 2XRZA 2BTQA 3RUEA 1T5TA 4RS4A 3ZCUA 4ZRMA 1R4MA 4DHEA 5CEJA 1L1RA 2F3SA 1Q20A 1X1CA 2HRZA 2JK1A 1TCCA 3K2BA 3M0EA 1RM0A 1GYQA 4LMPA 3SG0A 4PQGA 3X1WA 3R5XA 3I8XA 5CM2Z 3KXDA 1RVDA 3ICCA 3B6ZA 1HYBA 5DI3B 1C0LA 3KK0A 4HWSA 4UUMA 3X1YA 3ZZMA 4U7FA 2YQ5A 4AMUA 2HF7A 5JDCA 3NIFB 4NR0A 1BWSA 1L4BA 3WIVA 4K6HA 3OFND 3QH4A 5FKJA 4U0JA 5MN4A 3F0TA 3HKBB 3V97A 3VZBA 5L45A 4L3VA 4HQLA 2WQZA 1P8JA 1E8NA 1TKBA 2HMYB 2XYGA 4TUYB 2JFUA 3LVBA 5I4KA 3P9CA 3E82A 2GAFA 3O1JC 4MUBA 1GLNA 1XLTA 1LKZA 3C7AA 2HMTA 3L7YA 4YRGA 4B35A 3TOVA 2VJAA 3CG0A 3O3OB 4M0UA 4OA5A 1QDEA 4TZTA 2YIVX 4ZC1A 1BSVA 2X8AA 3BXZA 3KL2A 3PRKE 4R2JA 5HIIA 4AVYA 3CF6R 3VH1A 5BNIA 6Q21A 5JFOA 1KYQA 3SX2A 5FTJA 2COEA 4N8SA 1U6KA 3VPAA 2Y9PB 2OLJA 5IW8A 2ZIGA 1FP7A 1W2HA 4PBTA 2YJGA 5ES4B 4RPLA 1KMQA 4H0CA 4BKOA 2BZ0A 1HEIA 3QQ5A 3K31A 5LZ5A 1RPZA 4DY4A 1PRYA 2QL5A 2W6IA 3OY7A 3C74A 1O6GA 1MHPA 1GY8A 1T35A 2ZI6A 2AZDA 2FFQA 4IHJB 2CL6X 4Q9KA 1OAKA 4NYIR 3BK2A 1X9HA 4Z7NB 3IKTA 1KRXA 4ZARA 4P54A 5CFLA 1NT4A 4CQJA 1OAOC 1B8OA 4Y2PA 4BWVA 1MZPA 3NRCA 4MA5A 3W9YA 1AVTA 2R48A 1NPYA 4Y6SA 5EXEA 3E8MA 4OHPA 3WGHA 2GHRA 3C4QA 4W7SA 1LI5A 3PR1A 3DEIA 1YO6A 3BMCB 3LUBA 5AJXA 4EG4A 4FT4A 1H2XA 1J7KA 2AOTB 4OLHA 1MLDA 2IE8A 1RI2A 5DNEA 3NWJA 3ZK8A 2ZRBA 2AT1A 1V45E 1YC5A 1QP4A 2OHXA 4C1BA 1FNMA 1SEPA 1GLVA 1DQRA 1O94A 4M8KA 3ROTA 3U37A 1AQIA 1U7WA 1ONOA 3GJ7A 1U0JA 5C35A 3AP3A 2UYHA 1FLAA 3TLKA 1SXJE 2H3EA 4G2TA 3RVJA 2CL0X 3MPUA 1MQSA 1GGVA 3F8TA 1RLJA 2QLNA 3A7DA 3U81A 3T9EA 4AN4A 1C3VA 2J3EA 3IQXA 5KHLB 3IA2A 2OV8A 1NOIA 3KELA 3B8HA 1YTUA 3MTJA 2BT4A 4UJ3A 2D59A 3AY7A 3LOQA 3GNTA 4QU5A 4ZCIA 2O2SA 3S2UA 2DFDA 2EEPA 3HVIA 1UDWA 3C1UA 2AFHA 4HGZA 3TLAA 3JRNA 1P19A 3DEKA 2X5NA 1SXJA 1HDXA 2PMCA 3T9FA 1YC2A 1R00A 3SN6A 1NW7A 4J1SA 1A9XA 3UAVA 5IH3A 2PH7A 5JIBA 4HFRA 1LB1B 2PRIA 1P29A 1TLFA 2VS1A 4MVJF 4G4GA 2AVDA 4BO5A 1FEZA 1QFYA 2Y1FA 1XEWY 5EP3A 4PAQA 5TVGA 4IOMA 2I2DA 1WB6A 2PGIA 4PBRA 4LMAA 2VQ3A 3A28A 4QU9A 4DJFC 4AWBA 4PZEA 1LF5A 4A9AA 2VNSA 3GJTA 3SX4A 5A6SB 4CM6A 3VC7A 1YCHA 2UXCB 3E9MA 1ZOPA 4DIOA 2QGFA 5CPBA 5JSQA 1H0RA 2PFGA 3MELA 3TKAA 1VHJA 4Q7JB 4IHJA 2XUPA 3ENKA 2R751 1LJ8A 4GPD1 3EASA 1QIEA 2JGAA 4JFAA 4O02B 4NL4H 4A6EA 3WAJA 1PEKE 5KO2A 4HNQA 4J2OA 3V00A 2FPLA 1ODLA 3K3PA 4K7JA 4YJ3B 5HKLA 2IZ0A 3U7QA 4LQCA 1B6TA 1JMVA 2RJNA 5DTQA 3MQFA 3QOYA 5CYPA 2NAPA 3RD5A 4E5VA 5B7GA 3K32A 3TQOA 4O4HA 1LDNA 3RF6A 1UOQA 1PV1A 3MGCA 2BGJA 2AI3A 2WM8A 4RJTA 5JC1A 2RK3A 1K5DA 4HCJA 3QBJA 2X5OA 1H5QA 5CA0F 1Y7LA 4FD3A 3G2LA 2E1PA 3U4QB 1ZMBA 1AQYA 1ZAKA 2Q07A 2XJ9A 1CUFA 4M8NE 5KTOA 4A8JA 2B3TA 2IBTA 2IOFK 3MCUA 1CJMA 4ND5A 3T0IA 3IR6A 3WAGA 2XVZA 4AMYA 3ILXA 4PZ9A 4EBFA 1KZ6A 2OHOA 4UBJA 5JNRA 5A9SA 5H4GA 4BQPA 3NC0C 3WRVA 4TUYA 3YASA 1OH8A 2PWZA 5DM2A 2XKJE 4EP1A 5E2AA 1RWOA 2FEAA 4YT2A 2DECA 4PC7A 3FB4A 3G9ZA 2XECA 4QM6A 2J3DA 1MHTA 1H5NA 3S40A 1J49A 1Y37A 1P4JA 1GZUA 1GGKA 3KVVA 2PGLA 1Y7TA 5FD8A 4F91B 4Y6LA 2FQ1A 1H6BA 4GH5A 4ZQHA 1EUZA 4B48A 1QH0A 3H6KA 1FDWA 2J6IA 1LU9A 1OWPA 1T9GR 1US8A 3KBBA 5HMLA 1E0DA 1FS4A 2GBLA 2XE7A 1KZHA 5E3HA 4QVIA 2F3PA 4BNFA 3GWGA 1CQXA 3HUTA 4H31A 2FPIA 1OXTA 3LWBA 4P0TA 4J0GA 5CVCA 1NVGA 3VHXA 2PPVA 3ZWWA 3T3IA 4AJNA 5BR8B 4IIVA 1XL0A 3TDKA 2JH3A 2BM1A 1DFIA 2VA8A 3F97A 4KDCA 5FTWA 3TKLA 3DO5A 5JAQA 2H4HA 2Y9MB 1U1IA 5CCXA 4JQYA 3VQTA 3MEQA 4O3FA 2QOEA 1YB4A 4WHMA 1I3MA 4MW7A 5HWSA 4S05A 1XRNA 3AFNA 1ZEJA 4JJIA 1SQFA 4LX0A 1J0DA 4OLBA 5DLQC 1E5TA 1DEHA 3BOSA 4J4BA 1CDOA 1A2QA 2WF9A 1LDBA 1BMDA 421PA 4PQYA 1O6BA 2ZATA 4CV2A 2ZJ5A 2JFOA 2ADFA 5BYBA 3LBIA 3LYLA 3I6BA 1Y3AA 2E6UX 1M6VB 4YRPA 2FWAA 3V42A 1VTKA 3KQNA 2QTHA 1ZVMA 2JKZA 3DZKA 3FNBA 3ZW8A 5BQFA 3HN6A 4QTZA 4MI1A 1IATA 1EA5A 3M5WA 2WDPA 4DRYA 1WCYA 1S7GA 1QRDA 3PUHA 2P9FA 2ZQ5A 4JWKA 4ID9A 5LD2C 4AK9A 5LP6C 4BVKA 1DG3A 4MPPA 1LSOA 1Q0ZA 4MP8A 5BR4A 1SGWA 1GTVA 2XIJA 2Q0HA 4QO7A 1JU9A 5AM0A 3M83A 2FPWA 3E4DA 3C24A 2P8SA 3GGSA 3OE4A 5EWLB 3GA7A 2O2EA 3O4GA 1ZN8A 4CM5A 3R6GA 1QU2A 1O4WA 5DHQA 3F7MA 16PKA 1OD6A 1WXHA 3K6SA 1QMPA 1MH1A 1ECGA 1EUDA 3B20A 3DBOB 4MO2A 4CIXA 3M3HA 5A4MS 3SSOA 1AUXA 5ICGA 3LJKA 4WXHA 4HBGA 2QUHA 3M34A 4BKUA 3GAFA 4V2UA 3QLUC 5K0GA 1S2LA 5IF9A 2W2NA 1U0LA 2OHIA 2W22A 1XA3A 2WTMA 2Y8EA 4XPIB 5B55A 4OJMX 4HWRA 4YJFB 5DULA 1M74A 1YI8A 3E22A 1NUHA 2WYVA 1OFHA 5FYQA 4D9FA 3BFXA 4GLOA 1Y3DE 1JHYA 2CXXA 2V7EA 4UJ5A 5KYGA 3OCXA 3Q9UA 2QRNA 3AB3A 4O25A 4ZOLB 1I3OA 1GR1A 2PMDA 3OD5A 4G5RA 5EZYF 5L3QB 4ZI7F 4YLEA 1S2NA 4TYNA 5SZKB 3S6JA 2H08A 1PIWA 4XUGB 3DFFA 3GVXA 3WK4A 3L40A 1X7YA 4E6EA 4F3TA 4N5LA 3QLEA 4QSHA 4AYWA 2PH5A 4KBGA 4UM8B 3CNLA 3TBFA 5ALLA 3I2GA 1II8A 1W59A 1XTSA 3U0BA 2NYVA 4XM2A 1YBHA 3K9FC 4RD6A 3GEHA 5AJWA 2PVSA 1JHDA 4N1AA 4TMXA 2HOQA 2OCAA 2AKYA 3NYWA 4V03A 5FBRB 5B4VA 1SG0A 5I9BA 1CTQA 1ODKA 2MMGA 4Z1OA 3B60A 3LQQA 1TYCA 2OECA 1P4AA 4WOPA 1S1CA 2ZXUA 1EVKA 3OG9A 1SNYA 2YDXA 3L8GA 3VU9A 3PX3A 4AC9A 5IEJA 1GUZA 3DPUA 1JLSA 4IF4A 3MTQA 2NADA 3NQ41 1IUNA 1R5JA 1ZCAA 3JALB 3VZRA 3ZI4A 3WZLA 3CX6A 3ZIDA 3H4IA 1UM9B 2FW1A 3R0JA 1OFTA 1B0ZA 3N8DA 4ZDKA 4F85A 3CO0S 4RTKA 3ORHA 4UBMA 2DFKB 4ZMRA 3EAFA 3OICA 3SAJA 4WI1A 1O2DA 1K5HA 1R4NA 2CXHA 3AKEA 3MCVA 4UUNA 1UBHS 1KOLA 3KHSA 2QN3A 2B4KA 3QTLA 4J03A 5JD4A 1UKYA 3AHJA 3ZNQA 1RQ7A 4KQEA 3ZW9A 1Z29A 4JH0A 3I01M 4M6WB 3HKCB 2VSQA 2ZS8A 4WFIA 1GKYA 3OQJA 2JIZD 1JSZA 1Z2NX 1U28C 1OA0A 3ICOA 4LY6A 2F90A 4O2AA 5HZMA 4L4ZA 1FP2A 4DMUB 4RZXA 2B8EA 4RKYA 4YPOA 1EDBA 1EB9A 3V3TA 1OFGA 2XNSA 1P1CA 3BB4A 2RGGA 3PXBA 3TLGA 4EWLA 4QLBA 4D45A 2Q7DA 4I14A 4FFPA 1ND5A 3GRKA 2N75A 4OI1A 1J9ZA 4DQLA 4HSEA 4LRXA 2H1HA 4KIWA 2F59A 2VJNA 5E38A 3AL3A 3NOOA 4N0EA 1IK4A 1R88A 3UJAA 5CCBA 4YTEA 1NASA 4PPYA 1PO7A 4XFKA 5JO0A 5LIPA 1R3DA 1T3LA 4OJNA 1NYLA 2YXNA 2ONKA 3DAFA 4IIBA 3JD4A 1TKAA 1VL8A 2GVZC 1DKQA 4GEKA 2W70A 1KJJA 4Y2SA 2FVXA 1CRLA 1NAIA 5CAEA 2A9VA 3JQAD 4W5NA 2RIPA 3B48A 1AMNA 3ZWPA 3DMYA 1LDEA 2BKAA 3H19A 2Q3CA 4B3BA 1KBQA 3MRVA 4H08A 2L0XA 2Q28A 1JKJB 2XWBF 4X3CA 5FI0B 3WRXA 4LECA 2JLZA 1ZGZA 3Q7EA 3BAZA 2A1TR 3MXOA 3BTOA 2Q4RA 1IBMB 3OZUA 1SRQA 4XYEA 5EXSA 3U1BA 3NBYC 1SCKA 2PXXA 4HAZA 3IP5A 3PQ2A 4HNVA 5J1TB 1WJGA 4QRDA 4DB4A 4KAAA 1AHIA 3R7BA 4C0KA 3GK3A 1J2UA 3S27A 2FX2A 1JA9A 1GTL1 1V5IA 2AN1A 2IZ6A 2NTNA 1MO6A 1WZIA 1U3DA 3DHEA 4L4XA 4NDZA 3WL3A 3LM8A 4XX0B 5TQVA 1EXVA 1EFPA 3N75A 4H7PA 3KT0A 1UP4A 2GMWA 1P9OA 4BMZA 2OOKA 4Y6GB 3I73A 1ZD1A 1OYWA 3QX7A 1U7HA 3WLRA 4GBED 3DLTA 3ZGYA 2X19A 5JJ5A 4Z9AA 4UMEA 3DDZX 3ZKAA 4XKJA 3R7WA 3E7PA 3DMTA 2R8XA 2V7QA 3SYRA 1N34B 4K9PA 5ALNA 2CJPA 3B6KA 3R75A 1HURA 2YASA 2HJHA 3RG2A 1T9ZA 4H3VA 4P3NA 3WOHA 1HMPA 1RJWA 2Q0QA 1WXFA 3MF4A 1T2NA 3HSSA 3JQGB 3AP1A 1RXYA 4GOLD 4YK7A 4ZANA 2BH9A 1KRHA 3RYIB 3ROZA 4L0DA 3LLCA 3WIBA 2G06A 4RK1A 2WFMA 5TRTA 2C3OA 2AFRA 1W5BA 1NZDA 2BZSA 2I99A 3K0CC 3ITEA 4D92A 5BUZA 4QGSA 5ITWA 3LXMA 1H4SA 1PFVA 2JIMA 4LG1A 4C5AA 1YQTA 1GKIA 1U0OC 4JI4B 2IXAA 2R3SA 1F38A 3ZCRA 2EFJA 5I6DA 1DJPA 1L8OA 3MQ2A 1VXOA 3KJFA 2O3QA 3PE4A 4UBOA 1CVLA 2A3RA 3ZYCA 4BASA 3U7HB 4LSZA 3QU7A 3ZE7A 3EBPA 5M29A 5K0LA 2REBA 4GO1A 4HLCA 1FRNA 4N5HX 3KWMA 4I1OA 3B12A 3FRJA 4OHMA 3EXIB 5K0ZA 2OV2A 5IM4A 2P11A 3GCXA 3FSJX 5BW8A 2AUMA 1ZL0A 1O94C 4JUBA 1V1JA 3CZ4A 4ZV7A 4HHEA 1NQXA 4OSPA 4EVSA 3A4YA 4EO7A 3ABRB 2BUAA 5F1KA 3G9XA 2VATA 5B12A 4HO1X 4LTNA 4MARA 2BFDA 4JJ8A 1QZUA 3R7NA 4C88A 3C3WA 2HDHA 1Y8QB 3OLXA 2J07A 1LLQA 3IT3A 4Z0NA 4ZOLA 4I46A 5B3LA 1N6NA 1WMAA 2QRMA 2XTMA 2Y1XA 1DOAA 4MB0A 1SOWA 3QYJA 4KRGA 4NYJQ 1OLUB 2EZ4A 3QWIA 2P30A 1H94A 4M6WA 1F7VA 4Q1FA 9ABPA 3OWXA 2VPPA 3PS9A 2MSNA 1W1WA 1ZUIA 5AHXA 4KAJA 2Y1WA 1VMKA 3SSNA 2D62A 3BICA 3LGAA 3SJUA 1VCHA 3VUEA 1N6PA 3RVKA 3EMBA 5JCZA 5HRAA 1VHLA 3C15C 1J8MF 3ZXSA 1PNTA 3LP5A 3B1YA 1J33A 2Y93A 1ORTA 2JAPA 2ODQA 2QLBA 1AGNA 1P61B 3ESYA 1U2ZA 5HFJA 2VPXA 2CHQA 2QNRA 2Q6LA 1XRPA 3KWJA 4ROTA 2PR7A 4U0KA 1SHZA 3NHZA 4KWCA 1OOEA 1HFEL 2UU9B 3NXKA 1RJDA 4OAPA 1SC6A 5FORA 2YWBA 2X0JA 3NVDA 1ZA2A 1SWVA 4KQKA 5C8XA 4CIBA 1SUWA 2DKOA 1G20A 3ZCVA 1RI3A 4DT1B 3MB8A 3RRYA 1PEYA 3KKOA 5FUVA 5IKMA 5EE5B 2IHYA 3GMIA 3I6IA 4JC4A 5EIBC 1O1YA 2QZJA 2W6MA 1E1KA 1RLUA 1LPAB 3I64A 4MR7A 3W7AA 2V0CA 4JP3A 3V7YA 4ZZ1A 1QWSA 3LOUA 1VJRA 3PXXA 1YXMA 3ENZA 3G0OA 3GD5A 3A37A 4PCAA 3PGLA 2J87A 2J41A 2OAEA 3I3SR 3CLUC 4QZVA 2QMHA 2C5EA 5BQ3A 3RIMA 4G0QA 3Q5GA 5JRJA 3L43A 2F3QA 1HF3A 1QS0A 3J7TA 5EIEA 3OX4A 1W36B 4R8RA 3TTTA 3N7TA 4MITA 3IVMA 2F7SA 1B3BA 1FNDA 2WIJA 3KHUA 1QAMA 1R15A 3OJLA 4KRYA 4WA7A 4BNDA 4HV4A 1A0OA 2DFTA 4FR2A 4N03A 3EEYA 4M21A 2M6LA 1IEWA 3RBXA 2BGLA 3ONEA 1NV9A 3L5OA 4C22A 1WMFA 5AHKA 4OIMA 2OWEA 5EXPA 2XWJI 1GV0A 1JJBA 3WB2A 1YI0A 2H1SA 4ZQCB 2ZCVA 1I1OA 4C43A 3CVUA 1GGHA 5JD6A 3A3OA 5I8PA 1EU1A 3JYHA 1VLHA 2FOXA 2FQQA 2YWEA 1MVNA 2ERXA 4S04A 1VSUA 2BBOA 3SJZA 2G88A 2Q62A 3V8PA 1CCWA 1QPZA 3P2YA 5J4KA 1NXVA 2H31A 2R5WA 1CF2O 2BMAA 4A2WA 3CCCA 3ZYZA 5DO9A 1JEYA 4M1QA 1VE1A 2FG6C 4BPRA 2ZBPA 3TS1A 4L0QA 4J0HA 4QOJA 2W6JA 3OSZA 3BMNA 4Q19A 4LYJA 4MV3A 3D8BA 5H3LA 4DCPA 1IHDA 1JSCA 1T91A 3M8KA 4LF4B 4K1LA 3WL4A 3IUMA 1F8GA 1GUBA 1NY5A 1LRLA 3WYNA 5TT0A 1QVRA 1PDWA 1UPUA 3U9SA 3OQPA 5J23A 1RQLA 1Q0SA 3IE1A 2G83A 2OLKA 3HGQA 1O95D 3O94A 2GWHA 2X1LA 3EDRA 3QVGA 3IO3A 4LF7B 3BJIC 4O4LF 3SS9X 3LL4A 4JKOA 3CQ9A 1H0HA 5EINA 1R6XA 1HFJA 3GN2A 1IUKA 3FNRA 2FAXA 3GV0A 3VSDA 1JFSA 2C4KA 3TL3A 2BGIA 3AVOA 4NDAA 3RTAA 1VKZA 1W6UA 3FCCA 4IIJB 4NZ9A 3TL6A 3UAZA 3FWHA 3IAEA 2OYCA 1M2OA 1DHTA 3QKSA 1ESEA 5TJHA 5LMCA 4WXRA 3WP1B 1Z74A 2VXYA 4ZZIA 4I8IA 1YASA 4OQQA 2PGOA 3A10A 4CTMA 1ULAA 3RRFA 4PPGA 5AMXA 2VDPB 3KUCA 3TZLA 2D7JA 2PSFA 4X20A 5ERYA 3MMSA 1XWFA 2F00A 3OZFA 2B1IA 3SC4A 1T8YA 2QAIA 2H4YA 2UZ1A 1EUCA 2GVNA 4B33A 4ENRA 3K72B 2J67A 4RPIA 4RESA 4EA6A 1FDOA 4ZT6A 5C46F 4AQYB 1U9IA 2ID9A 1MA3A 1U0BB 4E03A 1C9JA 2EL7A 3CU5A 3ECSA 2HA4A 3HN7A 4NPAA 1DMSA 5BYJA 3HRKA 5LLTA 3HKBA 4P3YA 1WLYA 3CX4A 3U7QB 3GT7A 4EJ6A 3N7AA 1XTZA 2XT6A 4IV5A 4E5YA 1PTJC 3KKLA 4P0PB 4AW9A 4MMZB 3HDQA 1RHUA 2GUGA 3R76A 3U3KA 5EP4A 4E5MA 4CIWA 2I6XA 2EKDA 3PPIA 3IPCA 4ARAA 4BNTA 1MJGA 3QU4A 4NLLA 4ZEVA 2H2IA 4LVUA 1ZN7A 3GUCA 3ELWA 3FWZA 3QYPA 4GU5A 1W25A 3KNZA 4X94A 5J59A 3RKSA 5AVWA 4Q4AA 3VI4B 3FVRA 2ATVA 1ZM9A 1QU3A 1Y4AE 4CT0A 2C7GA 3H2GA 3OZ7A 1S01A 2BKXA 4KFSA 1CNFA 2PH1A 4AJ4A 5BMOA 4HDMA 4KWIA 5BW4A 3AXTA 1EFLA 5P21A 3KZNA 1KYVA 5JH7A 2IP4A 3L6UA 3N0VA 1L5RA 3KX2A 1CUJA 3PQ5A 4WJKB 1CD5A 2IOFA 1GCAA 1TCAA 3IOYA 3MMPA 3B1ZA 5FYDA 4FIDA 3OEED 5K3DA 4A91A 4J6EA 3ELYA 1T0HB 3N8GA 1PJ4A 4TWIA 1QGAA 2HWKA 4ZC8A 4ER3A 5EJEA 1O96B 3L7LA 1HQYE 1VJ0A 3FPBA 4PSKA 1MH9A 3E58A 2NX2A 2ZWAA 3BMQA 3F3YA 4ZVPA 1E6WA 3QXJA 3MFYA 3KRTA 2PUAA 2ZE5A 2I6UA 1X1RA 1SVSA 3BCUA 4PLYA 4BGEA 5BSHA 1RDFA 2CJYA 2OT3B 3B6EA 3CZRA 3TN7A 2V45A 2X0NA 5H7XA 1VMDA 2RDMA 3UENA 4II3A 3NYRA 5AVKA 1E2DA 3EOAI 1AA9A 5FOVA 3RKRA 4I1UA 3UICA 3C2QA 3I5AA 3NBFA 3VKUA 3IESA 3E9CA 1RR6A 2DFVA 1Z0IA 1LTHR 4K8OA 4MQMA 3FKQA 4CLOA 1PVDA 3ELBA 3V1KA 1TO6A 1Q6YA 5AVTA 4ZCRA 5HR5A 4AZSA 1H9CA 5E1MA 1PHRA 4FCTA 5B64A 3BA1A 5HILA 1TTHA 1PL8A 1XXLA 2X8BA 1KZGB 1NBIA 3NAMA 3RJMA 1Q1GA 3T1OA 4CEHA 1IZ0A 2CYBA 4OMDA 1WXEA 4H4EA 3C6KA 3GUUA 3LCCA 5SY6A 3WLOA 1ZUHA 5DX8A 4C5CA 1VKRA 1X77A 1N8KA 3FPJA 1OPRA 3AFIA 3ZN2A 5KQPA 5EP1A 1JZQA 2RHCA 3DR3A 4M38A 2AQIA 2NXEA 5M5BA 3EXG1 4ZVVA 1I0LA 4AUKA 1RBYA 3MJSA 4B1FA 2QMEA 5H8WA 4ZA2A 1R6TA 1B1CA 1QC5B 3RIEA 2DWPA 3P2IA 4QUDA 3RV3A 3N2KA 721PA 2VBGA 3SKYA 1BTOA 2O9JA 4LCEA 4OM8A 2NYUA 3L8YA 3RUDA 4IBOA 1DTWA 4MUYA 1XC7A 1XJQA 4R1QA 2FEPA 3IB3A 4Y2GA 2UYYA 2QYOA 1ISGA 1TW3A 4OHCA 5H16A 3RI3A 3SX0A 3PDIA 4DIMA 1N9KA 3EULA 2CV0A 4C0AC 2IGTA 2EERA 3FOFC 1Y6QA 2QYTA 2AMFA 3M89A 4CQMA 1YQQA 3DS8A 4YJKA 2AIRA 3ROKA 1OXKB 2A0YA 1VPTA 1GKUB 4L6CA 3UNXA 2RG7A 3L4JA 1KI1A 2OG1A 3HKEA 4FXPA 4M9XA 3ZOKA 4MVYA 1A8PA 2NIPA 2BYTA 2FWRA 4I9FA 5IC5A 1NM5A 3R0XA 1CZUA 1CYDA 4ZTZB 4YRQA 4OY3A 3BWCA 5EYPB 1DOZA 3WLPA 1X9IA 1I6KA 5F2OA 4HPXB 3B3JA 4G0XA 1NUTA 1P9RA 4DJEC 5IT0A 1QH1A 1IVSA 3W5SA 4C4SA 5GONA 2QPTA 4QJBA 4RWZA 1VSTA 4UXIA 2QG4A 1QFJA 4QQNA 2FJPA 2A8YA 2ZYIA 2H85A 4GZ6A 4C3OB 1EUCB 2X1HA 5ABPA 1RYFA 3UHOA 1M73E 1GZHB 3ZX5A 3SYTA 1AXEA 3JSAA 3UGKA 3U44B 4A15A 2FN8A 3FLMA 1EGMB 1K9SA 1FLNA 4LXHA 1DINA 4FMCB 1E3QA 2CWWA 5HZGA 4C7OB 2QTBA 1UXKA 3FPEA 4EHAA 2VZ9A 4ZHQF 3AEZA 3QUBA 2CCJA 1Y1RA 3RREA 9LDBA 1GPJA 3KOZA 1JDBB 5HTOA 4X91A 5G3ZA 1V1RB 1EQAA 2NP7A 3H5AA 3R9KA 2EBWA 2IXEA 2QJFA 2QPOA 5DGHA 2RGWA 4MVCA 4WLFA 1HKUA 4MWDA 1B0UA 4Y9UA 4IUCS 5ALEA 2GLTA 1NT2A 1WEHA 2GJ8A 3H5OA 3WGOA 4AZVA 4RZIA 4BLUA 2EFDB 5IABA 3OPXA 3QJ5A 1B93A 1G5QA 2JVJA 4HTAA 1ACMA 2BFEB 3JU3A 3OMXA 2CNLA 7YASA 1GG8A 1IYZA 4HXGA 5DEOA 4L16A 1DXYA 5AUNB 4FQ7A 2AJLI 3PNLA 4G0MA 4ODIA 4WFJA 1WTAA 2J5KA 4MR9A 4YRKA 1ZR4A 3NDBB 3PI7A 5BWLA 1LZLA 3QBVA 4KR9A 2FJUA 2C03A 3RU3A 4BJ1A 4E15A 1LW7A 2FN3A 5HW0A 2Z4RA 4OHRA 3QV2A 1RAGA 2QSZA 3OHMA 3ZQ6A 1NY6A 3GIWA 2B7LA 1DO8A 5ECYA 4AY3A 3GROA 4HTFB 2EHDA 1E7YA 2YQ4A 5B57C 5GIOE 3E0QA 1G5HA 1CUGA 3VYSB 1ABFA 3QZUA 2I2AA 3S70A 2DKNA 2XEDA 2ZAIA 3W5AA 4EF6A 2FZ4A 5BRJA 4WQMA 3VH4A 4FNOA 1JRLA 4ALLA 5TPWB 5EI5A 1JNYA 3GH3A 2OXIA 3G13A 3MMXA 2HIAA 5BSKA 4QNMA 3MGBA 1C3OB 5GMOA 3BYZA 4U6QA 5TGDA 2AOUB 3R8CA 5A4JA 2VJCA 1DO2A 4GF5A 2B4RO 2C59A 2QRJA 1ZI6A 2ICAA 1Q0RA 3AERA 1EWVA 1FYDA 1HRKA 3I2FA 5TC4A 3IC5A 3KOXA 3CNHA 1NWCA 1Z7WA 4FOLA 6CHYA 1X7XA 2V97A 3WWZA 2C98A 2CSUA 1UWCA 2Q6VA 2YV1A 3D3WA 1C41A 2CJFA 2FJ0A 1A88A 1B8NA 2YC2C 3C3DA 3DYVA 2PEZA 2JA2A 3QW4B 4PSVA 1E18A 2A94A 4I4TB 1APBA 1QIKA 4DCSA 2O1SA 2QSUA 4E31A 5JZSA 4F86A 5E9QA 1JVBA 3SJ7A 3VH2A 1YBAA 1A7JA 2RE8A 4DDHA 3OZSA 4CETA 3I9FA 3CVXA 4HWTA 2ZM5A 4L2IA 2GRUA 4Y2RA 4S35A 4D7AA 3LUFA 3ZJUA 1QHXA 5HFNA 4FP9A 4TXJA 2GZHA 3P20A 4DDUA 2JI9A 1FPMA 3DJFA 4INPA 1NXQA 4RZQA 1RC0A 4MUKA 4C6TB 4DR1B 1I94B 3L7DA 1TVCA 3NBQA 1P5JA 4H6VA 4JLJA 4KNYA 1SXJD 2J31A 5GOZA 5CFRA 1VRCA 1E62A 4OI0A 1KE1A 4UATA 4KACA 1ZVKA 4R8LA 4CMIA 2Z08A 1BWQA 4ZZ0A 4BV9A 1W9MA 2AOWA 5E0KB 5NULA 2GLXA 4URHA 2JJ2A 2XE8A 3Q9SA 1I3LA 1GNQA 3KT6A 4FB4A 4YQYA 1HC7A 4ARUA 2FMXA 5J5AA 1ZOIA 4HS4A 1QQTA 3I2JA 4HAIA 4AL4A 4IEFB 4Y6OA 5LLDA 4XSGA 4BUZA 5C52B 3FZYA 4MX8A 1SVMA 1NSTA 1I3NA 2BFCA 2I4TA 1UMDA 2F1IA 3HYNA 1XCLA 3MILA 3MJEA 1F8XA 2NOAA 3NDJA 3PEVA 3K1AB 2OCLA 3K0FB 4P4SA 3ZD6A 2YWCA 1UWVA 5A71A 1CF9A 1WQ1R 4B2PA 1JG6A 4BFWA 2XKAA 4FYKA 3K16A 3GEPA 4NAUA 4WE3A 4C89A 3ZLJA 1IHPA 2XAUA 4ZODA 2G5TA 4HJXA 2MR5A 3WFIA 4RANA 2ZZMA 1USVA 2PLNA 4US2R 4QTUB 1EBBA 3ZIAA 3OP1A 5K5EA 2PL5A 4R2KA 3W5UA 2A9JA 3CUVA 2ZIXA 1QG6A 3AGQA 4LI3X 2B37A 3E15A 2WJHA 2WPNA 4ABYA 1P39A 2R62A 2A9PA 3EA5A 1EFRD 1FS5A 4JUCA 4KP7A 3TTUA 1OCEA 1PQWA 1XJ5A 2AUNA 1HT1E 2C2YA 4NNOA 5E3JA 1CT9A 5CVJA 4ZAWA 1G6HA 4BX9A 1YU9A 1M2WA 2JJYA 3ROPA 3KKKA 4KMSA 1RWPA 2GN4A 5DWDA 4ETIA 1OLOA 1ZK3A 2BGRA 2Q45A 4NE9A 3TEFA 3PDUA 1U4OA 1ZOOA 1IZ9A 3ABOB 1NXOA 2DY0A 1PKXA 1NWHA 2N1BA 5CT8A 2CW5A 1J21A 4AROA 4TTVA 1NW5A 3K1AA 1WP4A 2ILTA 3VNUA 1NVXQ 3CEAA 2Q3DA 3CLUD 1N6IA 3OZDA 4YJDA 1XZNA 4RMJA 4PEVA 3FNQA 1O6FA 2JCXA 1IN8A 3N86A 2GQ0A 3PGXA 5LA6F 4Y8VA 2WWGA 3QE3A 4JLNA 4JI0B 3U40A 1TYZA 4G1EB 2Q3JA 1OY1A 3ZKWA 3HU1A 3HJCA 3WMFA 1JILA 2WTNA 3JAWA 4MJXA 4AKEA 4BNGA 4TT8A 4CMIB 1F6DA 1GAEO 3S8EA 2JFGA 3FPFA 4US0R 1D09A 2A84A 3HC7A 3HB0A 3NG1A 3HCWA 1AF4A 3O93A 2VDMB 3CNEA 3TO5A 5HG0A 3BQ9A 3EK2A 4OHBA 5LVAA 4PPFA 1KFBB 1Q22A 4G5GA 3EEQA 2QLLA 4YAIA 5AW8A 3U1VA 3UKDA 5KSOA 2HR1A 2MIIA 4TMFA 4LISA 4MKFA 3UHJA 1JDUA 1LLCA 4YCMA 3CLTC 3D4BA 2Q6OA 4L75A 8ATCA 3ZVNA 4B8ZA 3UY4A 4AG6A 1YHZA 4ES6A 1EBUA 4TV8A 5DP1A 2P68A 1HLGA 3AUKA 3AL0C 1BCRA 3RUPA 4KEAA 3N8NA 4C4XA 2CVZA 4J0CA 4M7WA 4EJSC 3WLAA 4B84A 1W6RA 3PPVA 1NZJA 5FNVB 3VPSA 1SK8A 3TFWA 5EWLA 5ADHA 4RCVA 4ZWNA 3RIYA 2CZQA 2ZSHA 3HDVA 1HQCA 3GFGA 3QEBZ 4YRDA 1RPNA 3BHMA 4NV0A 3JVEA 4K87A 1XBTA 3U4GA 3V4LA 1F2TB 2Y0EA 2G36A 1X7WA 1JUDA 5G3YA 3VV2A 3BEOA 3GDHA 3LRXA 1Z36A 4EW6A 5HCIA 3VR2D 1OREA 5LYYA 2NXJA 3DNPA 3HCNA 4IF6A 4ZU1X 3CVWA 4Q93A 3G5TA 4DIBA 2VA9A 4OL9A 2RONA 3TEJA 4BLTA 2G6BA 2X76A 4RHXA 5GIPE 2PUJA 4TQGA 4IV8A 4L2IB 1FL9A 3GMSA 1A76A 2ZBGA 2VIIA 5LB2A 4LN1A 4XTCS 1E96A 1NMQA 1PJTA 4RH1A 5CXSA 4WNCA 2FSVC 2ZIFA 4ASUA 2XMZA 1G9XA 2I3DA 2PKXA 3JAKA 3QBDA 4XWAA 5H9VA 2FPMA 5J5CA 3WIUA 1VPWA 3O9ZA 4ETWA 2LP4Y 4HTFA 4YB8A 2GBFA 3ECAA 3PQ6A 5ITVA 1J2TA 4AF8A 1JEEA 1KEWA 1U7OA 5CITA 5EE3A 2G40A 3JTMA 1N3YA 1SUAA 1V16A 2R84A 3K70B 1BGWA 1TJYA 3DEAA 1P5FA 1KYIA 3DLPX 3UXMA 1EHCA 2ATCA 3BQNB 4RACA 1ZGGA 3X2EA 2LV8A 4LWOA 4NYMR 1U7UA 3U3XA 3VR3D 5KTNA 4MRAA 4UBIA 3SDZA 1F06A 1TECE 3FFTA 3WTCA 3QVSA 1QH1B 2JC3A 4IDFA 4OAOA 4BFUA 3HXKA 3U3JA 2Q4OA 4FINA 5IMSA 3MLEA 4JASB 1JX6A 1DEXA 1PZFA 2OVFA 4HAUA 3B5EA 1CUZA 4AIIA 1J8DA 5IBQA 3PDIB 5CT9A 1YJQA 3GZNB 4OUKX 3UO8B 4BDTA 5SZIA 2MINB 3TLYA 5K3FB 1JEAA 2V55B 1EUYA 3PYXA 4KWHA 3VMMA 5CXUA 1GTMA 3OQNA 3GL9A 2FN7A 3BFJA 1QVWA 3LNTA 1UC8A 4JBXA 4NMMA 3WSTA 4BVAA 1TLLA 3FLAA 1OBHA 1Z28A 2ONZA 4Q66C 3ASZA 4Q6BA 1IEVA 2O54A 2ZIEA 3KV1A 4DBLE 2IZOA 3HM2A 5HNKA 4F3RA 2R4UA 4NJEB 2CLIB 1D4OA 1DDOA 1EK2A 2OYSA 1XA4A 2A59A 1ZGBA 2PRSA 5KTKA 2ASEA 2ZJ0A 4BOYA 5LBTA 2R85A 3P45A 3P4YA 2DUNA 4IZIA 2VHQA 2M6SA 1DPFA 2FSHA 1BVYF 1E8MA 3BHJA 3GFQA 4RVNA 3C5WP 5A1TA 5M2QA 5IJAA 2O06A 4NG4A 2Q99A 3QYAA 5C4MA 3K1YA 3D1LA 2BVNA 1L7PA 3BFKA 1ZQ9A 4N65A 3LWZA 1E9FA 2O50A 5DLYA 5BY2A 2J59A 4JN6B 2R9VA 2XYQA 4CLEA 3DV2A 4B40A 1SC4A 4TKUA 3W06A 1M2HA 1Y5MA 3CLVA 5KNDD 1MJNA 5HIJA 1O0CA 5B3AA 4BP3A 3O6VA 3OH8A 4M37A 1GPMA 3ROFA 2EKQA 3JV7A 2IDMA 1H4QA 2AJTA 2WJWA 3MINB 5KTMA 3NMUF 4LMBA 4P34A 4WVFA 1FXSA 4L0MA 1N5RA 2CLEB 1VE3A 4AXXA 2P6RA 2JI4A 1Q50A 2ZWOA 3URKA 3KOYA 3TOSA 4MR8A 4CQMD 2VWHA 4OK5A 3GFSA 4I5EA 3ZD8A 2GPAA 2WF6A 1WPRA 2A1IA 4IAOA 4G5XA 4WT7A 4JGIA 2WMOB 3NTLA 3X44A 2K5UA 4TV9B 1J2RA 4CKWA 1U9JA 1M7BA 1Y3IA 4RQAA 3SHFA 4DRXB 3Q7TA 2X7HA 1BNCA 5BRAA 4OA8A 3MK31 2XR1A 3IMEA 1J0CA 1A4XA 2XTZA 1QHEA 2JIQA 4FPXA 4LEIA 4OB7A 2TMDA 1OAAA 2NZXA 4PYRA 4CMEC 4GKBA 4ZT7A 4PIVA 1GNLA 1NMXA 4OV6B 2OVBA 1E2EA 2AKAB 2QQ0A 1NW6A 4IO1A 3K1JA 4YAWA 5EOVA 1Z13A 2OPBA 4RTSA 3GRUA 2ZAMA 3DOCA 3GCGA 2FUEA 5U4QA 3KQWA 3ROXA 2IHJA 3NUQA 1A77A 3M2PA 2LCQA 3W2GA 4NJOA 4DXDA 2OG2A 4FMCF 3TNYA 1CPYA 2QL7A 2C5FA 3GW8A 3WC4A 3MJ4A 2PBFA 1C3OA 1GNRA 4IDNA 4ERNA 4CLRA 1TJNA 2J1LA 4JOCA 1C7FA 3GGGA 4YHBA 4PLTA 3IEVA 4P81A 3RFUA 3TCNA 3O75A 2VT7A 2HRCA 2GZSA 2QMUA 4OK6A 2EZ9A 4BBAA 4Q4DA 5HOEA 4ZXFA 2JKYA 3ISVA 1JHVA 2O8FB 3VDXA 2PLFA 3BGVA 1S8AA 4RK7A 5AI4A 3TLEA 4QELA 1NE2A 4MKXA 4JITA 5BVHB 1I10A 2P9CA 2PJZA 4NU0A 5GM1A 1C3XA 4HR7A 3BTSA 1IJKA 4MI9A 3HJHA 1FJXA 1G21B 2FFRA 3G8BA 4OI4A 2ZTVA 4D9KA 2WFLB 4TN5A 4IH9A 4UXJA 1JJFA 1HM5A 3VU0A 4BNZA 1XEAA 1JIQA 1L1QA 2X7XA 4IXNA 4W8HA 3PQ7A 2IEGA 4RLHA 1AKRA 4I8DA 1G17A 3WZ2A 4P7GA 1ELOA 2WAYA 2ZW9A 2NPFA 5A0FA 1UMBA 4IMPA 4YJ3F 5JNTA 5KOHB 4X3OA 5JMWA 3DOEA 1Z0JA 2G9UA 2VPQA 4LBYA 1ULZA 5DN9A 1EI9A 1S02A 1LNQA 1MO5A 2PQ6A 2YN4A 2DQSA 2A0WA 1A9YA 2Q9BA 3IEXA 3KO8A 4FN4A 1U2QA 3R7LA 3TJRA 1CY6A 2OHFA 4BC1A 3FH0A 3HCAA 3QVKA 4D8UA 3URMA 5CA1B 4JB0A 4CKCB 3E5NA 4J7XA 4XLZA 1RFGE 1L4UA 4M36A 5BORA 1OIVA 4FU0A 3NOQA 1V4VA 2HWXA 1Y7IA 4GPIB 3BKWA 1NMYA 1S2IA 4MO9A 3RSFA 3Q1LA 1SU4A 2W5UA 4MW0A 4DEXA 3WLMA 4QVGA 4MS1B 4R05A 2NACA 2LWIA 5LUBA 3F98A 4P83A 5CLIA 5CR9A 4DDMA 3ZE0B 1ZNQO 4ZZ2A 3UMRA 4LXUA 3UQYS 4EHKA 1YD7A 4WK0B 1N2CE 4QFMA 3PDHA 4MEAA 3ABSB 4RPHA 1LPNA 1N32B 2IH5A 3V4FA 5JW6A 5JQWA 1E3SA 3GP8A 1N2OA 4JXKA 4D0RA 5C3MA 1VSQA 5BSGA 1IAQA 4R54A 1JR3E 4J6FA 2UUBB 1N2SA 1UJ6A 2I8AA 1KARA 3EUAA 3Q3GE 2OCDA 4I9HA 4RA6B 1ZD5A 2VP4A 2W0SA 1B1AA 3KJHA 2HJRA 1N0VC 1NQ5A 3MT8A 2V7XA 2ZB8A 1HY3A 4OLJA 3FWPA 5G40A 4L9RA 2XUGA 1P7PA 2FKNA 3CYFA 3G7UA 4FHDA 4FNAA 3TUIC 3O9VA 1IN1A 2P5UA 1V95A 3FBWA 1W5FA 3IT2A 4UHJA 4RULA 1Y8CA 4EZBA 3IIEA 2YW2A 1QX4A 2QTMA 3QEKA 2JCBA 4DYHA 1DRUA 1D2CA 2ONCA 4IH4A 4ENVA 2QD5A 2C57A 1C3LA 1JIIA 4MIYA 3EF3A 4XOUA 3ZHTA 3MAJA 3V9PA 1HZZA 3W4IA 1FUKA 4PLCA 5K99A 4CG2A 1KU0A 4PBSA 1TYEB 3IP3A 3OCWA 2Z43A 3PC8A 3U61B 2IW3A 1TB4A 4MVJH 1GPAA 1QZXA 3PQFA 3KAPA 4Q37A 4U7PB 3RSGA 2YXEA 2WIBA 3K73O 1ST3A 4CHGA 3PGKA 1ZJZA 3D6JA 1DKRA 4G63A 5HQ3A 4WKOA 1KEZA 2WIAA 1C4OA 1LBIA 1XEXB 2IF2A 1F17A 1OIXA 3C3EA 1TQ4A 4PX3A 2PUTA 3CT6A 4EKGA 5DNVA 1VP9A 3RSOA 4KLRA 5HJEA 3BE6A 1CEXA 4UEOA 3KTFA 1WA5A 2I7CA 3AR4A 3D0OA 4A0QA 1SVLA 2P2LA 1XNQB 1E2GA 3UJ7A 5EZQA 1F14A 2KSQA 2QMZA 4LVNA 1NJ6A 2YHAA 4XE5A 3TTYA 3OI7A 4QOSA 3WGNA 1KAOA 3OQIA 4IDGA 4IJUA 5AW4A 4G0UA 2PS1A 3AUTA 3TTWA 5IHXA 4M9RA 4UBLA 4UU8A 3ZZ1A 1JEDA 3P4XA 3U5ZB 3UT0A 1KI9A 4EX6A 1ADCA 2ZB2A 5JH7B 1XRJA 4L5CA 4GLBA 2AFIB 5AUQA 3WHPA 1TF5A 3GXBA 1PJBA 1ZJJA 3LLSA 3NBKA 3T7RA 1YWGO 3KJEA 5CB8A 4JLAA 1YZVA 1G0NA 2IH4A 1ISHA 3VSEA 3W3ZB 3L8EA 3DO8A 4EO4A 5A4IS 4DTIA 4WEQA 1RFLA 3O2SB 4N9QA 3CF4A 4GE0A 1ZM2A 4WXEA 2CDBA 2V6BA