1V4PA

Crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords alanyl-tRNA synthetase
total genus 48
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1v4pA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1v4pA01
1V7OA 2ZZEA 3WQZA 1TJEA 3RFNA 1NYQA 3RHUA 1TKYA 1WXOA 1NYRA 3KEWA 1WNUA 1TKEA 2ZZFA 2E1BA 1V4PA 2ZTGA 1QF6A 1TKGA 2ZZGA
chains in the Genus database with same CATH superfamily
3I7KA 3WQZA 4AR8A 3RFNA 1NYQA 4TZ4A 2HYEA 4XR3A 3I8CA 2B5LA 1WNUA 4CI1A 2ZZFA 3ZW7A 4XR0A 1V4PA 4XR2A 1QF6A 4ARFA 4A08A 2IUUA 3ZX4A 4E54A 1V7OA 2ZZEA 2Y6IA 1XVIA 3I8EA 3I7PA 1TKYA 4CI2A 2E1BA 3I89A 2Y50A 3ZTYA 3ZU6A 2IUTA 3ZWKA 3ZX5A 2B5MA 4E5ZA 4CI3A 1TJEA 3EI3A 4AR9A 4A11A 4A0BA 1NYRA 2I06A 4AR1A 2ZOSA 3I7HA 2ZTGA 3I7LA 3I7NA 4AREA 4A0AA 4A09A 3EI1A 2ZZGA 3ZUPA 2I05A 4XR1A 3RHUA 1WXOA 1WZCA 2Y3UA 3E0CA 3I7OA 3KEWA 1TKEA 3ZTWA 3EI2A 2EWJA 1ECRA 3EI4A 3ZWDA 5FQDA 1TKGA 2IUSA
chains in the Genus database with same CATH topology
3I7KA 3WQZA 4AR8A 3RFNA 1NYQA 4TZ4A 2HYEA 4XR3A 3I8CA 2B5LA 1WNUA 4CI1A 2ZZFA 4ARFA 4XR0A 1V4PA 4XR2A 1QF6A 4A08A 2IUUA 4E54A 1V7OA 2ZZEA 2Y6IA 3I8EA 3I7PA 1TKYA 4CI2A 2E1BA 3I89A 2Y50A 2IUTA 2B5MA 4E5ZA 4CI3A 1TJEA 3EI3A 4AR9A 4A11A 4A0BA 1NYRA 2I06A 4AR1A 3I7HA 2ZTGA 3I7LA 3I7NA 4AREA 4A0AA 4A09A 3EI1A 2ZZGA 2I05A 4XR1A 3RHUA 1WXOA 2Y3UA 3KEWA 3E0CA 3I7OA 3EI2A 1TKEA 2EWJA 1ECRA 3EI4A 5FQDA 1TKGA 2IUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V7O A;  2ZZE A;  3WQZ A;  1TJE A;  3RFN A;  1NYQ A;  3RHU A;  1TKY A;  1WXO A;  1NYR A;  3KEW A;  1WNU A;  1TKE A;  2ZZF A;  2E1B A;  1V4P A;  2ZTG A;  1QF6 A;  1TKG A;  2ZZG A; 
#chains in the Genus database with same CATH topology
 3I7K A;  3WQZ A;  4AR8 A;  3RFN A;  1NYQ A;  4TZ4 A;  2HYE A;  4XR3 A;  3I8C A;  2B5L A;  1WNU A;  4CI1 A;  2ZZF A;  3ZW7 A;  4XR0 A;  1V4P A;  4XR2 A;  1QF6 A;  4ARF A;  4A08 A;  2IUU A;  3ZX4 A;  4E54 A;  1V7O A;  2ZZE A;  2Y6I A;  1XVI A;  3I8E A;  3I7P A;  1TKY A;  4CI2 A;  2E1B A;  3I89 A;  2Y50 A;  3ZTY A;  3ZU6 A;  2IUT A;  3ZWK A;  3ZX5 A;  2B5M A;  4E5Z A;  4CI3 A;  1TJE A;  3EI3 A;  4AR9 A;  4A11 A;  4A0B A;  1NYR A;  2I06 A;  4AR1 A;  2ZOS A;  3I7H A;  2ZTG A;  3I7L A;  3I7N A;  4ARE A;  4A0A A;  4A09 A;  3EI1 A;  2ZZG A;  3ZUP A;  2I05 A;  4XR1 A;  3RHU A;  1WXO A;  1WZC A;  2Y3U A;  3E0C A;  3I7O A;  3KEW A;  1TKE A;  3ZTW A;  3EI2 A;  2EWJ A;  1ECR A;  3EI4 A;  3ZWD A;  5FQD A;  1TKG A;  2IUS A; 
#chains in the Genus database with same CATH homology
 3I7K A;  3WQZ A;  4AR8 A;  3RFN A;  1NYQ A;  4TZ4 A;  2HYE A;  4XR3 A;  3I8C A;  2B5L A;  1WNU A;  4CI1 A;  2ZZF A;  4ARF A;  4XR0 A;  1V4P A;  4XR2 A;  1QF6 A;  4A08 A;  2IUU A;  4E54 A;  1V7O A;  2ZZE A;  2Y6I A;  3I8E A;  3I7P A;  1TKY A;  4CI2 A;  2E1B A;  3I89 A;  2Y50 A;  2IUT A;  2B5M A;  4E5Z A;  4CI3 A;  1TJE A;  3EI3 A;  4AR9 A;  4A11 A;  4A0B A;  1NYR A;  2I06 A;  4AR1 A;  3I7H A;  2ZTG A;  3I7L A;  3I7N A;  4ARE A;  4A0A A;  4A09 A;  3EI1 A;  2ZZG A;  2I05 A;  4XR1 A;  3RHU A;  1WXO A;  2Y3U A;  3KEW A;  3E0C A;  3I7O A;  3EI2 A;  1TKE A;  2EWJ A;  1ECR A;  3EI4 A;  5FQD A;  1TKG A;  2IUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...