1V4PA

Crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
b'MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanyl-tRNA synthetase
publication title Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 48
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1v4pA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1v4pA01
2ZZEA 3KEWA 1NYQA 3RFNA 1TKYA 1TKEA 1TJEA 1NYRA 3WQZA 2ZZFA 1WNUA 1TKGA 1V4PA 2ZZGA 1QF6A 2ZTGA 3RHUA 2E1BA 1WXOA 1V7OA
chains in the Genus database with same CATH superfamily
4A11A 3RFNA 3I7OA 3EI1A 4XR3A 1TKEA 3WQZA 4E5ZA 2ZZFA 2B5MA 2IUUA 1V4PA 1XVIA 2ZZGA 1QF6A 1ECRA 3I7PA 4CI3A 2E1BA 4A0BA 4AREA 2ZZEA 4AR9A 2B5LA 4XR1A 4XR2A 3KEWA 4A08A 4A09A 4AR1A 1NYRA 3EI3A 3ZX4A 1WNUA 2Y3UA 2Y50A 1WZCA 3I7NA 3ZUPA 3ZW7A 2ZTGA 3RHUA 4AR8A 3ZWDA 3I7LA 4CI2A 2EWJA 2I06A 3ZWKA 2IUTA 4ARFA 3I7KA 2ZOSA 4CI1A 5FQDA 2HYEA 1WXOA 3ZU6A 1NYQA 1TKYA 4XR0A 3I8CA 4E54A 2Y6IA 3EI4A 1TJEA 4TZ4A 2I05A 2IUSA 3I7HA 1TKGA 4A0AA 3ZTWA 3I89A 3ZTYA 3ZX5A 3E0CA 3I8EA 3EI2A 1V7OA
chains in the Genus database with same CATH topology
2ZZEA 4AR8A 4AR9A 4A11A 2B5LA 4XR1A 4XR2A 3RFNA 1NYQA 3I7LA 3KEWA 4A08A 3I7OA 3EI1A 4CI2A 1TKYA 2EWJA 2I06A 4XR0A 4AREA 4A09A 3I8CA 4E54A 2Y6IA 4XR3A 4AR1A 1TKEA 3EI4A 1TJEA 3WQZA 1NYRA 2IUTA 3EI3A 4TZ4A 2ZZFA 4ARFA 4E5ZA 2B5MA 1WNUA 2I05A 2IUUA 2Y3UA 3I7KA 2IUSA 2Y50A 3I7HA 1TKGA 4A0AA 1V4PA 3I89A 4CI1A 3I7NA 2ZZGA 1QF6A 5FQDA 2HYEA 1ECRA 2ZTGA 3E0CA 3RHUA 3I7PA 2E1BA 4CI3A 3I8EA 4A0BA 1WXOA 3EI2A 1V7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZE A;  3KEW A;  1NYQ A;  3RFN A;  1TKY A;  1TKE A;  1TJE A;  1NYR A;  3WQZ A;  2ZZF A;  1WNU A;  1TKG A;  1V4P A;  2ZZG A;  1QF6 A;  2ZTG A;  3RHU A;  2E1B A;  1WXO A;  1V7O A; 
#chains in the Genus database with same CATH topology
 4A11 A;  3RFN A;  3I7O A;  3EI1 A;  4XR3 A;  1TKE A;  3WQZ A;  4E5Z A;  2ZZF A;  2B5M A;  2IUU A;  1V4P A;  1XVI A;  2ZZG A;  1QF6 A;  1ECR A;  3I7P A;  4CI3 A;  2E1B A;  4A0B A;  4ARE A;  2ZZE A;  4AR9 A;  2B5L A;  4XR1 A;  4XR2 A;  3KEW A;  4A08 A;  4A09 A;  4AR1 A;  1NYR A;  3EI3 A;  3ZX4 A;  1WNU A;  2Y3U A;  2Y50 A;  1WZC A;  3I7N A;  3ZUP A;  3ZW7 A;  2ZTG A;  3RHU A;  4AR8 A;  3ZWD A;  3I7L A;  4CI2 A;  2EWJ A;  2I06 A;  3ZWK A;  2IUT A;  4ARF A;  3I7K A;  2ZOS A;  4CI1 A;  5FQD A;  2HYE A;  1WXO A;  3ZU6 A;  1NYQ A;  1TKY A;  4XR0 A;  3I8C A;  4E54 A;  2Y6I A;  3EI4 A;  1TJE A;  4TZ4 A;  2I05 A;  2IUS A;  3I7H A;  1TKG A;  4A0A A;  3ZTW A;  3I89 A;  3ZTY A;  3ZX5 A;  3E0C A;  3I8E A;  3EI2 A;  1V7O A; 
#chains in the Genus database with same CATH homology
 2ZZE A;  4AR8 A;  4AR9 A;  4A11 A;  2B5L A;  4XR1 A;  4XR2 A;  3RFN A;  1NYQ A;  3I7L A;  3KEW A;  4A08 A;  3I7O A;  3EI1 A;  4CI2 A;  1TKY A;  2EWJ A;  2I06 A;  4XR0 A;  4ARE A;  4A09 A;  3I8C A;  4E54 A;  2Y6I A;  4XR3 A;  4AR1 A;  1TKE A;  3EI4 A;  1TJE A;  3WQZ A;  1NYR A;  2IUT A;  3EI3 A;  4TZ4 A;  2ZZF A;  4ARF A;  4E5Z A;  2B5M A;  1WNU A;  2I05 A;  2IUU A;  2Y3U A;  3I7K A;  2IUS A;  2Y50 A;  3I7H A;  1TKG A;  4A0A A;  1V4P A;  3I89 A;  4CI1 A;  3I7N A;  2ZZG A;  1QF6 A;  5FQD A;  2HYE A;  1ECR A;  2ZTG A;  3E0C A;  3RHU A;  3I7P A;  2E1B A;  4CI3 A;  3I8E A;  4A0B A;  1WXO A;  3EI2 A;  1V7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...