1V4WA

Crystal structure of bluefin tuna hemoglobin deoxy form at ph7.5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
143
structure length
143
Chain Sequence
TTLSDKDKSTVKALWGKISKSADAIGADALGRMLAVYPQTKTYFSHWPDMSPGSGPVKAHGKKVMGGVALAVSKIDDLTTGLGDLSELHAFKMRVDPSNFKILSHCILVVVAKMFPKEFTPDAHVSLDKFLASVALALAERYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Mechanisms of pH Sensitivity in Tuna Hemoglobin: A STRUCTURAL EXPLANATION OF THE ROOT EFFECT
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords hemoglobin alpha chain
total genus 57
structure length 143
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1v4wA00
1V9QA 4X0LA 3S65B 3ZHWA 3PIAB 2DN1B 2HHEB 3AT6A 2DN2A 3GDJB 5KERA 1IRDB 1UVXA 2HZ2A 4AVEA 3H58A 2GRZA 2W72A 3D4XB 1O1LB 1X9FC 3ARLA 1T1NA 1YHRA 1HBSB 4TWUA 2EVKA 1HDBB 2D5ZA 1NZ3A 2KSCA 3QJBA 1HBHA 3ZJSA 3QMAA 1LFVA 2DC3A 1Y35A 4FH7A 3EOKA 3ZJPA 1BZ0B 3SDHA 2XKIA 1JPBA 3GLNA 5CN4A 1MYMA 1YIHB 2ZSRA 2NSSA 1NEJA 2HHBB 3MBAA 3CIUA 3WCWD 1J40B 3WCUD 1IWHB 2NSRA 4MQKB 2GTLB 1SDLB 1B86B 1YMBA 1CH3A 4XS0B 1NIHB 1YIEB 1A01A 1LH1A 3NMMB 1BVDA 1UX9A 1XZVB 3QM6A 3LR9A 1WLAA 1KD2B 4OODA 2ZLWA 1FN3B 1UT0A 1WVPA 3UHXA 3MKBB 1BUWA 2G11A 2ZFOD 3ONZB 1YFFA 2MGEA 1BIJB 5HBIA 3IC2B 3UHEA 3D1AA 1HACA 3WCTB 1CH9A 2ZWJA 2ZSNA 1Y09A 3GQRA 1Y5FB 2RI4A 1Y0DA 1NZ5A 2AUQA 2G0XA 2HZ3A 1NIHA 3WCWB 110MA 2G0RA 2VEEA 3DHRB 5EETA 2FRFA 5MBNA 1Y0CB 3AQ5A 2HHDB 1DKEA 2W6VB 1QXEB 1YGDB 2OH9A 5CNFA 1O1NA 3ZJJA 1JZKA 5HAVA 1GDIA 1MLUA 1A6MA 3ZH0A 1OUTB 2H8FB 1F63A 1Y5KA 1MLJA 3UHUA 1HBSA 3HRWB 2BLIA 1EW6A 3QJDA 1DO3A 1MOCA 2DN3B 2V1JA 2LH7A 1HBBB 1XQ5B 2O5TX 3UH5A 5ILMA 3DHTB 1MNIA 2HCOA 2Z85A 4IT8A 1QSHB 1N9IA 1YEUB 1CQXA 2H8FA 2VYWA 1O1MA 3PI8A 4PNJA 1O1NB 5EQMA 1BZ1B 2O5QX 3PI2A 3MYNA 1A00B 1Y4VB 1VREA 2ZS0D 1MCYA 2HBEB 2O5OX 1OFJA 5CN7A 3NFEB 1Y7GB 1Y7DB 5ILEA 1CMYA 1S69A 1O1JA 4NK1A 2EVPA 3G4QA 1Y5FA 3KMFC 4MXKA 1VXAA 3E4NA 2MYDA 3FH9B 1N9HA 1HACB 3WCTA 4FH6A 1NXFA 4HSWA 1GCVA 3G4WA 3OZVA 2ZLVA 3CY5B 1A0ZA 2GLNA 4OF9A 1BUWB 3DR9A 1CH2A 2VRYA 3EU1B 1LFYA 3UH6A 1UFPA 1BZZA 2MGMA 6HBIA 1XZVA 4HHBB 1HBBA 2AV3A 4NS2A 4ROMB 1C40A 1Y0TA 1B86A 1COHA 1S5YB 5JDOC 1LJWB 3QM7A 3CIUB 2MBWA 3R0GA 1LFTB 4WJGA 3BOMA 5HLQA 2MGKA 1XZ2B 3ZJHA 3PI8B 3D17B 4MXLA 1GDKA 3ED9A 2M6ZA 2HBSA 2LH5A 1XZUA 1YEQB 1YDZA 1MLMA 1UMOA 2AA1B 5EYJA 2WTGA 1VWTB 1GBUB 1LFZA 4N7NA 4F6FA 1MTIA 3UGZA 5C6EA 1XQ5A 1CG5A 1V4UA 3ZOLA 4NK2A 4WCHD 1N9XA 2GDMA 4ODCB 1ASHA 4HRTB 2VHBA 1ECAA 5E29B 1DXUB 1WMUA 3VRFB 3A5AA 2V1GA 1Y4BB 3GDJA 4SDHA 2V1KA 1YHEA 1A9WE 1G08B 1FCSA 4H2LA 1IT2A 1DO4A 1UFJA 2G14A 2ZLUA 3K9ZA 5CNCA 3ZJOA 1YVTA 1YEVA 1DKEB 2W6VA 2SPLA 2AA1A 1YMAA 3OK5A 3TM9A 1EWAA 1ECNA 1NS9A 3G52A 1MNJA 1MYHA 2FRKX 1MBNA 5SW7B 4TYXA 1S56A 4VHBA 1H97A 1J7WA 3ECZA 3WCVC 2XKHA 1Y4FA 4UURA 2QRWA 3GOUA 1LHTA 3LB4A 1S0HA 1YEOA 1NS9B 3M3BA 3LB2A 1NEJB 1QPWB 3VHBA 111MA 2FALA 1DTMA 3OJ1A 4MU5A 2ZS1B 2MGHA 3ASEA 5CHRA 3RJNB 3UH3A 3WHMB 1YE0B 1Y35B 1Y8WA 1HBHB 1FSXB 1Y31A 3AQ7A 3GQPA 2ZT0A 1K0YB 1DXTA 3CY5A 2HBFA 1DWTA 1DXVA 2O58X 1HBRB 1MYTA 3W4UB 3HEPA 1A01B 3MJUB 5EUIB 109MA 4XS0A 3S66A 1A9WA 2MGIA 1YEVB 1Y22B 3UHZA 2GTLA 1MWBA 3WCVB 3PI4A 1YVQA 2CMMA 2G0ZA 1RPSB 5CNBA 2MGJA 3UHHA 1UIWA 1YDZB 3UI0A 1Y7GA 3HHBA 3S65A 1FLPA 4X0LB 1OR6A 4ODCA 3B75B 3QJBB 1AJHA 4N7OB 2BNLA 1GBUA 5EE4D 5KKKA 3D4XA 3M3AA 3G4UA 2B7HA 1RQ3A 1HBAA 1MBSA 1G09B 1YEUA 1XZ5B 3UGYA 5CN6A 2LH6A 1FDHA 1XZ5A 2VYZA 4LPIA 2QSSA 1Y8HA 3A0GB 4MQGA 4G51B 1JZLA 2B7HB 105MA 1HGBA 1C40B 1Y0TB 3OGBA 2MGAA 1Y0AA 1CBMA 1PBXB 1OBMA 2VEBA 4MBNA 3SDNA 3HEOA 1V4XA 5HU6A 1Y5JA 3HENA 1UVYA 1MLFA 5CHQA 4C44A 1C7DB 4NI1A 1HDAA 1XY0B 2HHDA 102MA 1UIWB 1HV4A 3LQDA 1JW8A 1EBTA 1A0UA 2ZLXB 4KMWA 2HBDB 1NS6A 4YU4B 1S61A 4NXAA 3UHCA 3GYSB 2O5LX 4NI1B 5CMVA 2QSPA 1QXDA 2MGLA 1MLLA 2AV0A 1NGKA 2HBFB 5ILPA 1K0YA 4GZGA 1A00A 1THBA 1Y5JB 1HLBA 3A5BA 3O7NA 2H35B 1YE2B 1MBCA 2OH8A 3PI9B 2HCOB 1RSEA 1S5XB 1Y0AB 1IRCA 3GKTA 5E6EB 2Z6NA 2G0VA 3ONZA 2D2NA 1YCAA 1O1MB 2D6CA 1LTWA 1R1XB 2OLPA 1X9FB 1R1YA 1A6KA 1SI4A 1JZMA 112MA 3MVCA 1K1KA 3UH7A 1HBAB 1CBLA 5D5RA 1V4WB 1MDNA 1G0BA 1XZ4B 2NRLA 1HBIA 2DN3A 3PI1A 1RQ4B 4FWZA 1Y5KB 3OZWA 1HCOB 3UHNA 1HLMA 3B75A 2O5SX 5KDQA 1O1PA 3A5GA 1SDKA 2DHBA 2Z6TA 4FC3A 1VXDA 3HHBB 3WCWA 3E5OA 3ZJRA 4ESAA 1UX8A 1JP8A 2HZ1A 1JL7A 3V2VA 4YU4A 1MLGA 2ZLXA 5EE4C 1J7SA 3DHRA 2W72B 4HRTA 3TM3A 2BMMA 2G0SA 4ZVAA 5AZQA 1MYJA 4O4ZA 1F5OA 3D1AB 1Y22A 1J52A 4F6BA 1MLQA 1MOAA 1HBRA 107MA 1DXVB 3WCVD 2ZT3A 1IBEB 2ZSPA 1BABB 3WFWA 2ZSOA 2GTLC 1FSXA 3KUNA 1MNOA 3OZUA 2ZS1A 1J7YB 1Y01B 3WHMA 1DM1A 3VRGA 3UBVA 1MLNA 1YGFB 1LFQA 3OO5B 1CG8B 1LFTA 3RGKA 3RJ6A 4MQKA 2GRFA 4NI0B 3WCPB 2ZLTA 4PQCA 4KMVA 1ABWA 2D2MC 4ROMA 1JF4A 2VLXA 3WFXA 1CH1A 4FWYA 4MQJB 5HLUA 3A59B 1TU9A 3LB1A 1FSLA 2ZLTB 1Y83A 4ROLA 1J40A 3QJEA 1O1OB 1XXTB 2D2NC 1YG5B 3BCQA 1YIHA 2ZSZA 3E5IA 1HGCB 3G4YA 3OO4B 3P5QA 3VREA 4F6GA 3UHSA 4HRRB 3D7OA 1OJ6A 1YHEB 4MPMA 4H2LB 1MBOA 1MBAA 1Y7DA 1BBBA 1MZ0A 4F6DA 4FC3B 4F4OA 1YCBA 1CO9A 1YOHA 1Y4VA 3AT5B 1LFZB 1MLKA 1XZUB 2RAOA 1CPWA 1Y4PA 1QSIA 1GJNA 1Y31B 2R80B 1YHUA 5KDQB 3KUOA 2IG3A 1ECOA 2R4ZA 3D17A 1DUKA 3HYUB 2OIFA 3MN0A 1ABWB 2D60B 3BJ3A 3O89A 3GOUB 3ZJQA 1YZIB 1G0BB 3EDBA 1MOBA 1U7SA 1AJ9A 1XYEB 1W92A 1SHRA 1VXGA 5F2AA 1LFYB 4HHBA 1R1YB 1TESA 4U8UC 3HXNA 5M3SA 1GBVA 1FAWB 1DO1A 2QMBB 2ZLVB 2D2NB 3UHWA 3PT7B 4HSXA 1Y4RB 1BZPA 4M4BA 1BZRA 5F0BA 4DC7A 1DWSA 2R50A 1A4FB 2H35A 1Y4RA 2AURA 5C6YA 1J7SB 4MBAA 3ARJA 4F69A 2D2MB 2BW9M 1Y45A 2GTLD 1QXDB 1J3FA 1CLSA 3D1KB 3QJCA 1V75A 1VXEA 2DHBB 1PMBA 3GYSA 3WCTC 1J3YB 1HRMA 5HU6B 1HHOB 1JF3A 1YOIA 1HV4B 2QFNA 1MYIA 1M6CA 2ZS0B 4L2MA 1Y0WB 3IC2A 1C7DA 1DLWA 1Y8KB 3G4VA 2FAMA 1MLHA 2ZSQA 1J3ZB 4DWUA 1NZ2A 2QSSB 1QSHA 4KN3A 3NMLA 1G09A 2MGBA 1A6GA 1GZXB 1VXFA 1COHB 4YU3B 2GNWA 1O1KA 1RTEA 1LA6B 1YH9A 2GKNA 3QZZA 5JDOD 3FS4B 3BJ3B 1MLOA 3AG0A 4NZIA 1OUTA 1YENA 1J41A 1RQAB 1RQ3B 1HDSB 1VXCA 3IA3B 3NL7A 1Y8KA 1QXEA 1B0BA 3KMFA 1JP6A 1MKOB 2ZT2A 3P5QB 1MBIA 3FH9A 3MOUA 4O4TA 3A9MA 4MQIB 3E55A 1Y0CA 2C0KA 1JEBB 2MYEA 1O1LA 1BVCA 1SPEA 1Y2ZA 3D1KA 5EUIA 4WJG1 2GNVA 4H0BA 4BJAA 5AB8A 2MB5A 4MAXA 2PEGA 2D2MA 1DXTB 4ZVBA 1MNKA 1Y8WB 1M6MA 3ZJMA 2ZT1A 106MA 4C0NA 1ABYB 2LH1A 3NG6A 4U8UA 1JL6A 3VREB 1Y4QA 1BIJA 5E83B 4MQCA 4FWXA 1MWDA 1Y85B 3MJUA 3BJ2B 1RVWB 5E83A 1HGBB 3BCQB 2YRSB 1YG5A 1Y4GA 2QMBA 1FN3A 3GQPB 2BLJM 1KD2A 5CNGA 1YE0A 1MWCA 3QM9A 1IBEA 5B85A 1YIEA 1YOGA 2D2ND 1Y7ZA 3M38A 3NMMA 1HGAA 3IC0A 3ZOMA 1CP5A 2H8DB 2W31A 3ODQA 3IXFA 4ILZA 2VYYA 2QFKA 1VXHA 3HRWA 1LHSA 1DXDA 1Y4FB 1SPGB 2HHBA 1YVTB 2AUOA 3ZJIA 1O1IB 3U3EA 2GKMA 5SW7A 1F5PA 3UHYA 3G4RA 3UHQA 2EB9A 4O1TA 1Y4PB 1EBCA 1L2KA 1HDBA 2AUPA 1C7CA 4M4AA 2FRIX 3VRFA 1MGNA 1NPFA 1CH4A 1LFLA 3H57A 1X9FD 1NPGA 2ZLUB 1LFLB 1HGAB 5KERB 3S66B 1FDHG 2SPOA 2XYKA 4N8TA 2DN2B 1BBBB 2JHOA 3UHDA 1SI4B 1C7CB 5B84A 1YEQA 1UC3A 3PIAA 1CP0A 4HRRA 1JY7A 3AT6B 2RI4B 1XZ7A 1R1XA 1SDKB 1GDJA 2YRSA 1V4UB 1VRFA 1XZ2A 3BJ2A 1GLIA 1JDOA 1S5XA 1CIKA 2MHBB 1O1OA 2ZSTA 3WCUC 1XCHA 1S0HB 1S5YA 1YEOB 2EF2A 2ZLWB 3A59A 1V07A 2QU0B 5CN8A 5MBAA 1O16A 2ZSSA 4IROA 1LH5A 1LJWA 1HABA 1IWHA 1JEBA 3WR1B 3WFTA 2HBDA 1MYGA 1Y8IA 1CG8A 1A0UB 2PGHA 4G1BA 3K8BA 1CH7A 4MQCB 1MTJA 1Y7CB 1ABYA 1A3NB 2ZFOA 1J7YA 1LH6A 2WTHA 1O1JB 3ZJLA 1GDLA 1RQAA 1G08A 2O5MX 3SZKB 3WI8A 2FRJX 1FAWA 3HXNB 3WCWC 1Y2ZB 2LH2A 2SPMA 3TLDA 1DXUA 3K8BB 5JDOE 1O1KB 4DWTA 1AJ9B 1XYEA 3LHBA 1ABSA 1Y8HB 3A0GA 4MQGB 1HSYA 3GQGA 2DN1A 3HYUA 5CN5A 3NL7B 1A6NA 5CNEA 4KJTA 3UHKA 1YENB 1AZIA 2R80A 1QSIB 2D5XB 3UHBA 1RQ4A 2R1HA 4N7OA 2D5XA 1V4WA 1URYA 1IOPA 2ZS0C 1J3YA 4G1VA 103MA 3ORDA 3R5IB 1M9PB 1V75B 1Z8UB 1MBDA 2G10A 3QJCB 1LH3A 4HBIA 1MYFA 1CO8A 1N9FA 3G53A 3SZKA 1J3ZA 3DHTA 2G12A 1I3DA 1AJGA 2W6WA 1A4FA 1GCVB 1SWMA 1MLRA 3WCVA 1Y0WA 1CIOA 3OO4A 3VAUA 4M4AB 1C7BA 1Y46A 1URVA 3PT7A 2ZS1D 2MGDA 1H1XA 1THBB 3W4UA 4L7YB 4AVDA 3QQQA 1S6AA 5EYSA 5JDOF 4ROLB 2Z8AA 3WCUA 4NXCA 1A3NA 1SHRB 1G9VB 1Y7CA 2LH3A 1DTIA 4N7PA 1DLYA 2ZFBB 7HBIA 1Y8IB 1OUUB 3LQDB 1YVQB 2MGCA 1BZ1A 1HJTA 2O5BX 3IC0B 1G0AB 4MQHB 2W6YA 1J7WB 1GCWA 1YFFB 3G46A 4PQ6A 1V4XB 1JP9A 2DXMA 1XZ7B 2HBCB 1MLSA 1MNHA 1X46A 1BZ6A 1RTXA 3QM8A 1Y85A 2OHBA 4MQHA 3PI3A 1LUEA 1SDLA 4F68A 3MKBA 4JACA 2ZT4A 4F4OB 5JOMA 1OUUA 3QJDB 5HY8A 4O2GA 3PELA 3QZXA 4B3WA 3WCUB 3OVUC 1JWNA 4N8TB 1WMUB 2MYCA 3S1IA 1VHBA 1LFVB 1O1PB 3UHIA 2D5ZB 3MJPA 5EU2A 1D8UA 1OFKA 1V5HA 1NWIA 4F6JA 2WY4A 1YHUD 3LB3A 3UHRA 3AT5A 1GVHA 1MKOA 1CQ2A 2HBSB 3ODQB 4QAUA 1NAZA 2ZSXA 1MODA 1IRDA 2ZS1C 1O1IA 3HC9A 1J41B 2HBGA 5HY8B 1Y4BA 1RPSA 3BOMB 1FHJA 1SPGA 1T1NB 1YHRB 3EDAA 2G3HA 1Y09B 3GQRB 5E29A 3FS4A 1YH9B 3A2GA 2D2MD 2H8DA 6HBWA 1LFQB 3OO5A 3WFUA 1MTKA 1HGCA 2QLSB 3PT8A 3LR7A 1A3OA 1Y4QB 1Y7ZB 1VWTA 2R1HB 1NQPB 1XXTA 2EKUA 2HBCA 4U8UD 3DUTB 1Y83B 3DUTA 1CH5A 2ZSYA 3UHVA 1A0ZB 4F6IA 3ECXA 1A3OB 2W6XA 1KR7A 3PT8B 3BJ1A 2QSPB 2QLSA 1QPWA 1I3EA 2ZS0A 1G0AA 1U7RA 3GK9A 1HHOA 4H07A 1FHJB 3QM5A 4N7PB 2XKGA 1CMYB 2V1HA 5D1VA 1OR4A 2PEGB 3VRGB 2OHAA 2MGGA 3S48C 1HDAB 1XY0A 1CLSB 1BZ0A 3EOKB 3NFEA 3UBCA 4JYQA 1HDSA 3WCTD 1Q1FA 2HBEA 4L7YA 1HCOA 1BABA 2E2YA 1C7BB 1Y46B 1YMCA 1BINA 5CN9A 4MQIA 104MA 2ZFOB 5ILRA 4XDIA 1PBXA 3MJPB 2LHBA 1XZ4A 1LA6A 2PGHB 2R4YA 3AQ8A 4UIQA 3ZJNA 101MA 5EV5A 1NWNA 3PELB 5JGGA 1X9FA 1MOHA 4ESAB 2VLZA 2V1EA 2HHEA 1KFRA 2MYBA 3R5IA 4IROB 1QI8A 2BKMA 1F65A 2EB8A 2Z6NB 1MYZA 1CG5B 5E6EA 5C6EB 1DO7A 4YU3A 4N7NB 2Z6SA 3GKVB 3WTGB 3AQ6A 2R4WA 4PQBA 2D60A 1GZXA 1YE2A 3PI9A 4TWVA 2VM0A 2NX0A 2SPNA 3GKVA 3WTGA 2M6ZB 1NZ4A 1EMYA 2DXMB 1GLIB 1IT3A 2BLHA 1QI8B 1K1KB 2GRHA 1GCWB 1YHUB 1JY7B 1ITHA 5JGGB 2V1IA 1LH2A 5HLXA 3GQGB 3QQRA 5IKSA 3AQ9A 3HF4B 2ZFBA 1YHUC 4UZVA 1DUOA 1BJEA 1LH7A 4B4YA 1DWRA 1G9VA 1VXBA 3K3UA 1BZZB 4M4BB 2BWHA 3ECLA 3S1JA 3EU1A 2VLYA 2MYAA 3UHGA 1DXCA 3M39A 1Y45B 5AZRA 3D7OB 1Y0DB 3UHTA 1GBVB 2IN4A 1YGDA 1NS6B 4G51A 4O35A 1ECDA 3QJEB 4DC8A 3HF4A 2R4XA 3WR1A 2V1FA 1HABB 1IDRA 4MQJA 2ZFOC 2W72C 1M9PA 1HBGA 2QU0A 3MYMA 2NRMA 2BK9A 5CNDA 3WCPA 1YZIA 4NI0A 2GL3A 2RAOB 2MHBA 108MA 1NQPA 2EKTA 1Y4GB 5EOHA 1RVWA 1YGFA 6HBWB 3ARKA 3BJ1B 3V2ZA 2MGFA 3NG6B 4U8UB 3BA2A 1X3KA
chains in the Genus database with same CATH superfamily
1V9QA 4X0LA 3S65B 3ZHWA 3PIAB 2DN1B 2HHEB 3AT6A 4YJJA 2DN2A 3GDJB 5KERA 1IRDB 1UVXA 2HZ2A 4AVEA 3H58A 2GRZA 2W72A 3D4XB 1O1LB 1X9FC 3ARLA 4BS9A 1T1NA 1YHRA 4ETTA 1HBSB 1WACA 2UUMB 4TWUA 2EVKA 1HDBB 2D5ZA 1NZ3A 2KSCA 3QJBA 1HBHA 3ZJSA 3QMAA 1LFVA 2DC3A 1Y35A 4FH7A 3EOKA 3ZJPA 1BZ0B 3SDHA 2XKIA 2UULB 1JPBA 3GLNA 5CN4A 4RMPA 1MYMA 1YIHB 2ZSRA 2NSSA 1NEJA 2HHBB 1UVMA 3MBAA 3CIUA 3WCWD 1J40B 3WCUD 1IWHB 2NSRA 4MQKB 2GTLB 1SDLB 1B86B 1YMBA 1CH3A 4XS0B 1NIHB 1YIEB 1A01A 1LH1A 3NMMB 1BVDA 1UX9A 1XZVB 3QM6A 4YJJB 3LR9A 1WLAA 1KD2B 4OODA 2ZLWA 1FN3B 1UT0A 1WVPA 3UHXA 3MKBB 1BUWA 2G11A 2ZFOD 3ONZB 5FVBM 1YFFA 2MGEA 1BIJB 5HBIA 4B02A 3IC2B 3UHEA 3D1AA 2UULC 1HACA 3WCTB 1CH9A 2ZWJA 2ZSNA 1Y09A 3GQRA 1Y5FB 2RI4A 1Y0DA 1NZ5A 2AUQA 1LIAB 2G0XA 4ETUA 2HZ3A 1NIHA 3WCWB 3O2CA 110MA 2G0RA 2VEEA 3DHRB 5EETA 2FRFA 4Q70A 5MBNA 4ETVA 1Y0CB 3AQ5A 2HHDB 1DKEA 2W6VB 1QXEB 1YGDB 2OH9A 5CNFA 1O1NA 3ZJJA 1JZKA 5HAVA 1GDIA 1MLUA 1A6MA 3ZH0A 1OUTB 2H8FB 1F63A 1Y5KA 1MLJA 3UHUA 2VJHA 1HBSA 3HRWB 2BLIA 1EW6A 3QJDA 1DO3A 1MOCA 2DN3B 2V1JA 2LH7A 1HBBB 1XQ5B 2O5TX 3UH5A 5ILMA 3DHTB 1MNIA 2HCOA 2Z85A 4IT8A 1QSHB 1N9IA 1YEUB 1CQXA 2H8FA 2VYWA 3BRPA 1O1MA 3PI8A 4PNJA 2V8AA 1O1NB 5EQMA 1BZ1B 2O5QX 3PI2A 2C7KA 3MYNA 1A00B 1Y4VB 1VREA 2ZS0D 1MCYA 2HBEB 2O5OX 1OFJA 5CN7A 3NFEB 1Y7GB 1Y7DB 5ILEA 1CMYA 1S69A 1O1JA 4NK1A 2EVPA 3G4QA 1Y5FA 3KMFC 4MXKA 1VXAA 3E4NA 4H0MB 2MYDA 3FH9B 1N9HA 1HACB 3WCTA 4FH6A 4H0MA 1NXFA 2DKCA 4HSWA 1GCVA 3G4WA 3OZVA 2ZLVA 3CY5B 1A0ZA 2GLNA 4OF9A 1BUWB 2C7LB 3DR9A 1CH2A 2VRYA 3EU1B 5AQDA 1LFYA 3UH6A 1UFPA 1BZZA 2MGMA 1I7YA 6HBIA 1XZVA 4HHBB 1HBBA 2AV3A 5B13A 4NS2A 4ROMB 1C40A 1Y0TA 1B86A 1COHA 1S5YB 5JDOC 2UULD 1LJWB 3QM7A 3CIUB 2MBWA 3R0GA 1LFTB 4WJGA 3BOMA 5HLQA 2MGKA 1XZ2B 3ZJHA 3PI8B 3D17B 4MXLA 1GDKA 3ED9A 2M6ZA 2HBSA 2LH5A 1XZUA 1YEQB 1YDZA 1MLMA 1UMOA 2AA1B 5EYJA 2WTGA 1VWTB 1GBUB 1LFZA 4N7NA 4F6FA 1MTIA 3UGZA 5C6EA 1XQ5A 1CG5A 1V4UA 4PO5A 3ZOLA 4NK2A 4WCHD 1N9XA 2GDMA 4ODCB 1ASHA 4HRTB 2VHBA 1ECAA 5E29B 1DXUB 1WMUA 3VRFB 3A5AA 2V1GA 1Y4BB 3GDJA 1GH0A 4ESUA 4SDHA 2V1KA 3MWNA 1YHEA 1A9WE 1G08B 1FCSA 4H2LA 1IT2A 1DO4A 1UFJA 2G14A 2ZLUA 3K9ZA 5CNCA 4XXIA 3ZJOA 1YVTA 1YEVA 1DKEB 2W6VA 4N6SA 2SPLA 2AA1A 1YMAA 3OK5A 3TM9A 1EWAA 1ECNA 1NS9A 3G52A 1MNJA 1MYHA 2FRKX 1MBNA 5SW7B 4TYXA 1S56A 4VHBA 1H97A 1J7WA 3ECZA 3WCVC 2XKHA 1Y4FA 4UURA 2QRWA 3GOUA 1LHTA 3LB4A 1S0HA 1YEOA 1NS9B 3M3BA 3LB2A 1NEJB 1QPWB 3VHBA 1KN1B 4RMPB 111MA 2FALA 1DTMA 3OJ1A 4MU5A 2VMLA 2ZS1B 2MGHA 3ASEA 5CHRA 3RJNB 3UH3A 3WHMB 1YE0B 1Y35B 1Y8WA 1HBHB 1FSXB 1Y31A 3AQ7A 3GQPA 2ZT0A 1K0YB 1DXTA 3CY5A 2HBFA 1DWTA 1DXVA 2O58X 1HBRB 1MYTA 3W4UB 2UUNA 3HEPA 1A01B 3MJUB 5EUIB 109MA 4XS0A 3S66A 1A9WA 2MGIA 1YEVB 1Y22B 3UHZA 2GTLA 1MWBA 3WCVB 3PI4A 1YVQA 2CMMA 2G0ZA 1RPSB 5CNBA 4LMSB 2MGJA 3UHHA 1UIWA 1YDZB 3UI0A 1Y7GA 3HHBA 4X0LB 1FLPA 3S65A 1OR6A 4ODCA 3B75B 3QJBB 4AE0A 4PO5B 2C7KB 1F0LA 1AJHA 4N7OB 2BNLA 1GBUA 5EE4D 5KKKA 3D4XA 3M3AA 3G4UA 2B7HA 1RQ3A 1HBAA 1MBSA 5AQDM 1G09B 1YEUA 2YSKA 1CPCB 1XZ5B 3UGYA 5CN6A 2LH6A 1FDHA 1XF6C 1XZ5A 2VYZA 4LPIA 2QSSA 1Y8HA 3A0GB 4MQGA 4G51B 1JZLA 2B7HB 105MA 1HGBA 1C40B 1Y0TB 3OGBA 2MGAA 1Y0AA 1CBMA 1PBXB 1OBMA 2VEBA 4MBNA 3SDNA 3HEOA 1V4XA 5HU6A 1Y5JA 3HENA 1UVYA 1MLFA 3FEWX 5CHQA 4C44A 1C7DB 4NI1A 1HDAA 1XY0B 2HHDA 102MA 1UIWB 1HV4A 3LQDA 1JW8A 1EBTA 1A0UA 2ZLXB 4KMWA 2HBDB 1NS6A 4YU4B 1S61A 4NXAA 2WCRA 3UHCA 3GYSB 4A8WA 2O5LX 4NI1B 5CMVA 2QSPA 1QXDA 2MGLA 1MLLA 2AV0A 1NGKA 2HBFB 5ILPA 1K0YA 4GZGA 1A00A 4GY3B 1THBA 1Y5JB 1HLBA 3A5BA 3O7NA 4LMXB 1F99A 2H35B 1YE2B 1MBCA 2OH8A 3PI9B 2HCOB 2I88A 1RSEA 1S5XB 1Y0AB 1IRCA 3GKTA 5E6EB 2Z6NA 2G0VA 3ONZA 2D2NA 1YCAA 4ERVA 1O1MB 2D6CA 1LTWA 1R1XB 2OLPA 1X9FB 1R1YA 4HH0A 1A6KA 1SI4A 1JZMA 112MA 3MVCA 1K1KA 3UH7A 1HBAB 1UVKA 1CBLA 5D5RA 1V4WB 1MDNA 1G0BA 1XZ4B 2NRLA 1HBIA 2DN3A 3PI1A 1RQ4B 4FWZA 1Y5KB 3OZWA 1HCOB 3UHNA 1HLMA 3B75A 2O5SX 4GXEB 5KDQA 1O1PA 3A5GA 1SDKA 2DHBA 2Z6TA 4FC3A 1VXDA 3HHBB 3WCWA 3E5OA 3ZJRA 4ESAA 1UX8A 1JP8A 2HZ1A 1JL7A 3V2VA 4YU4A 1MLGA 2ZLXA 1J7SA 5EE4C 3DHRA 2W72B 4HRTA 3TM3A 2BMMA 2G0SA 4ZVAA 5AZQA 1MYJA 4O4ZA 1F5OA 3D1AB 1Y22A 1J52A 4F6BA 1MLQA 1MOAA 1HBRA 107MA 1DXVB 3WCVD 2ZT3A 1IBEB 2ZSPA 1BABB 3WFWA 2ZSOA 2GTLC 1FSXA 3KUNA 1MNOA 3OZUA 2ZS1A 1J7YB 4A8QA 1Y01B 3WHMA 1DM1A 3VRGA 3UBVA 1MLNA 1YGFB 1LFQA 3OO5B 1CG8B 1LFTA 4A8MP 3RGKA 3RJ6A 4MQKA 2GRFA 4NI0B 3WCPB 2ZLTA 4PQCA 4KMVA 1ABWA 2D2MC 4ROMA 4Z8KA 1JF4A 2VLXA 1HI0P 3WFXA 1CH1A 4FWYA 4MQJB 5HLUA 3A59B 1TU9A 1B33A 3LB1A 1FSLA 2ZLTB 1Y83A 4ROLA 1J40A 3QJEA 1O1OB 1XXTB 2D2NC 1YG5B 3BCQA 1YIHA 2ZSZA 3E5IA 1HGCB 3G4YA 3OO4B 3P5QA 3VREA 4N6SB 4F6GA 3UHSA 1ALLA 4HRRB 3D7OA 1OJ6A 1YHEB 4F0UB 4MPMA 1EYXB 4H2LB 3V58A 1MBOA 1MBAA 1Y7DA 1BBBA 1MZ0A 4F6DA 4FC3B 4F4OA 1YCBA 2C7JA 1CO9A 1YOHA 1Y4VA 3AT5B 1LFZB 2UUNB 1MLKA 1XZUB 2RAOA 1CPWA 1Y4PA 1QSIA 1GJNA 1Y31B 2R80B 1YHUA 5KDQB 3KUOA 2IG3A 1ECOA 2R4ZA 3D17A 1DUKA 1PHNA 4A8YA 3HYUB 2OIFA 3MN0A 1ABWB 2D60B 3BJ3A 3O89A 3GOUB 3ZJQA 1YZIB 1G0BB 3EDBA 1MOBA 3V57B 1U7SA 1AJ9A 1XYEB 1W92A 1SHRA 2BV8B 1I7YB 1VXGA 5F2AA 1LFYB 4HHBA 1R1YB 1TESA 4U8UC 3HXNA 5M3SA 1GBVA 1FAWB 1DO1A 2QMBB 2ZLVB 2D2NB 3UHWA 3PT7B 4HSXA 1Y4RB 1BZPA 4M4BA 1BZRA 5F0BA 4DC7A 1DWSA 2R50A 1A4FB 2H35A 1Y4RA 1F99B 2VJTA 2AURA 5C6YA 1J7SB 4MBAA 3ARJA 4F69A 4A8FA 2D2MB 2BW9M 1Y45A 2GTLD 1QXDB 1J3FA 1CLSA 3D1KB 3QJCA 1V75A 1VXEA 2DHBB 1PMBA 3GYSA 3WCTC 1J3YB 1HRMA 5HU6B 1HHOB 1HHTP 1JF3A 1YOIA 2VJTB 1HV4B 2QFNA 1MYIA 1M6CA 2ZS0B 4L2MA 1Y0WB 3IC2A 1C7DA 1DLWA 1Y8KB 3G4VA 1RH1A 2FAMA 1SGKA 1MLHA 2ZSQA 1J3ZB 4L1EB 1NZ2A 4DWUA 2QSSB 1QSHA 4KN3A 3NMLA 1G09A 2MGBA 1A6GA 1GZXB 1VXFA 1COHB 4YU3B 2GNWA 1O1KA 1RTEA 1LA6B 1YH9A 2GKNA 3QZZA 5JDOD 3FS4B 3BJ3B 1MLOA 3AG0A 4NZIA 1CPCA 1OUTA 1DDTA 1YENA 1J41A 1RQAB 1RQ3B 2X4AA 1HDSB 1VXCA 3IA3B 3NL7A 1Y8KA 1QXEA 1B0BA 3KMFA 1JP6A 1MKOB 2ZT2A 3P5QB 1MBIA 3FH9A 3MOUA 4O4TA 3A9MA 4MQIB 3E55A 1Y0CA 2C0KA 1JEBB 2MYEA 1O1LA 1BVCA 1SPEA 1Y2ZA 3GIOA 3D1KA 5EUIA 4WJG1 2GNVA 4H0BA 4BJAA 5AB8A 2MB5A 4MAXA 2PEGA 2D2MA 1DXTB 4ZVBA 1MNKA 1Y8WB 1M6MA 3ZJMA 2ZT1A 106MA 2J96A 4C0NA 1ABYB 2LH1A 2UUMX 3NG6A 4U8UA 1JL6A 3VREB 1Y4QA 1BIJA 5E83B 4MQCA 4FWXA 1MWDA 1Y85B 3MJUA 3BJ2B 1RVWB 3GUQA 5E83A 1HGBB 3BCQB 2YRSB 1YG5A 1Y4GA 2QMBA 1B8DA 1FN3A 3GQPB 2BLJM 1KD2A 5CNGA 1MDTA 1YE0A 1MWCA 3QM9A 1IBEA 5B85A 2VMLB 1YIEA 4ZIZB 1YOGA 2D2ND 1Y7ZA 3M38A 3NMMA 1HGAA 1KN1A 3IC0A 3ZOMA 1CP5A 2H8DB 2W31A 3ODQA 3IXFA 4ILZA 2VYYA 2QFKA 1VXHA 3HRWA 1LHSA 1DXDA 1Y4FB 1SPGB 2HHBA 3PMDA 1HI8A 1YVTB 2AUOA 3ZJIA 3NUHB 1O1IB 3U3EA 2GKMA 5SW7A 1F5PA 3UHYA 3G4RA 3UHQA 2EB9A 4O1TA 1Y4PB 1JBOB 1EBCA 2JLFA 1GH0B 1L2KA 1HDBA 2AUPA 1C7CA 4Q70B 4M4AA 2FRIX 2JL9A 1MGNA 3VRFA 1NPFA 1CH4A 1LFLA 3H57A 1X9FD 1NPGA 2ZLUB 1LFLB 1HGAB 5KERB 3S66B 1FDHG 2SPOA 2XYKA 4N8TA 2DN2B 1BBBB 2JHOA 3UHDA 1SI4B 1C7CB 5B84A 1YEQA 1UC3A 1LIAA 3PIAA 1CP0A 4HRRA 1JY7A 3AT6B 1ALLB 2RI4B 1XZ7A 3L0FB 1R1XA 1SDKB 1GDJA 2YRSA 1QGWC 1V4UB 1VRFA 1XZ2A 3BJ2A 1GLIA 1JDOA 1S5XA 1CIKA 2MHBB 1O1OA 2ZSTA 3WCUC 1XCHA 1S0HB 1S5YA 1YEOB 2EF2A 2ZLWB 3A59A 1V07A 2QU0B 5CN8A 5MBAA 1O16A 2ZSSA 4IROA 1LH5A 3RQRA 1KTPA 1LJWA 1HABA 1IWHA 3O18A 1JEBA 3WR1B 3WFTA 2HBDA 1MYGA 1Y8IA 1CG8A 1A0UB 2PGHA 4G1BA 3K8BA 1CH7A 4MQCB 1MTJA 1Y7CB 1ABYA 1A3NB 2ZFOA 1J7YA 1LH6A 2WTHA 1O1JB 3ZJLA 1GDLA 1RQAA 1G08A 2O5MX 3SZKB 3WI8A 2FRJX 1FAWA 3HXNB 3WCWC 1Y2ZB 2LH2A 2SPMA 3TLDA 1DXUA 3K8BB 5JDOE 1O1KB 3KVSA 4DWTA 1AJ9B 1XYEA 3V57A 3LHBA 1ABSA 3O18B 1Y8HB 3A0GA 4MQGB 1HSYA 1ON7B 1UVJA 3GQGA 2DN1A 3HYUA 5CN5A 3NL7B 1A6NA 5CNEA 3DBJA 3LQ9A 4KJTA 3UHKA 1YENB 2UULH 1AZIA 2R80A 1QSIB 2D5XB 3UHBA 1RQ4A 4AE1A 2R1HA 4N7OA 2D5XA 2V8AB 1V4WA 1URYA 1IOPA 2ZS0C 1J3YA 4G1VA 3DBJB 103MA 3BRPB 3ORDA 3R5IB 1M9PB 1UVNA 1V75B 1Z8UB 1MBDA 2G10A 3QJCB 1LH3A 4HBIA 1MYFA 1CO8A 1N9FA 3G53A 3SZKA 1ON7A 1J3ZA 4L1EA 3DHTA 3V58B 2G12A 1I3DA 4XXKA 1AJGA 2W6WA 1A4FA 1GCVB 1SWMA 3KVSB 1MLRA 3WCVA 1HA7B 1Y0WA 1CIOA 4F0TA 1COLA 1A87A 3OO4A 3VAUA 4M4AB 1C7BA 1Y46A 1URVA 3PT7A 2VJHB 2ZS1D 2MGDA 1H1XA 1THBB 3W4UA 4L7YB 4AVDA 3QQQA 1S6AA 5EYSA 5JDOF 4ROLB 2Z8AA 1B33B 3WCUA 4NXCA 1A3NA 1SHRB 1G9VB 1Y7CA 2LH3A 1DTIA 4N7PA 1DLYA 2ZFBB 7HBIA 1Y8IB 1OUUB 3LQDB 1YVQB 2MGCA 1BZ1A 1HJTA 2O5BX 3IC0B 1G0AB 4MQHB 2W6YA 1J7WB 1GCWA 1YFFB 3G46A 4PQ6A 1V4XB 1JP9A 2DXMA 1XZ7B 2HBCB 1MLSA 1MNHA 1X46A 1BZ6A 1NY9A 1RTXA 3QM8A 1Y85A 4A8SA 2OHBA 4MQHA 3PI3A 1LUEA 1SDLA 4F68A 2C7JB 3VNCA 3MKBA 4JACA 2ZT4A 4F4OB 5JOMA 1OUUA 3QJDB 5HY8A 4O2GA 3PELA 1PHNB 3QZXA 2UULA 4B3WA 3WCUB 3OVUC 1JWNA 4N8TB 1WMUB 2MYCA 3S1IA 1VHBA 1LFVB 1O1PB 3UHIA 2D5ZB 3MJPA 5EU2A 1D8UA 1OFKA 1V5HA 1NWIA 4F6JA 2WY4A 1YHUD 3LB3A 3UHRA 3AT5A 1GVHA 1MKOA 1CQ2A 2HBSB 3ODQB 4QAUA 1NAZA 2ZSXA 1MODA 1IRDA 3O2CB 2ZS1C 1O1IA 3HC9A 1J41B 4ZIZA 2HBGA 5HY8B 1Y4BA 1RPSA 3BOMB 1FHJA 1SPGA 1EYXA 1T1NB 1YHRB 3EDAA 2G3HA 1TOXA 1Y09B 3GQRB 5E29A 3FS4A 1YH9B 2WCQA 3A2GA 2D2MD 2DKDA 2H8DA 6HBWA 1LFQB 3OO5A 3WFUA 1MTKA 4A8OA 1HGCA 2QLSB 3PT8A 3LR7A 1A3OA 1Y4QB 1Y7ZB 1VWTA 2R1HB 1NQPB 1XXTA 2EKUA 2HBCA 1HHSA 4U8UD 3DUTB 1Y83B 3DUTA 2C7LA 1CH5A 4A8KA 2ZSYA 3UHVA 1A0ZB 4F6IA 1B8DB 3PMCA 3ECXA 1A3OB 2W6XA 1KR7A 3PT8B 3BJ1A 2QSPB 2QLSA 1QPWA 1I3EA 2ZS0A 4Z8KB 1G0AA 1U7RA 3GK9A 1HHOA 4H07A 1FHJB 3QM5A 4N7PB 2XKGA 1CMYB 2V1HA 5D1VA 1OR4A 1XDTT 2PEGB 3VRGB 1XG0C 2OHAA 2MGGA 3S48C 1HDAB 1XY0A 1CLSB 1BZ0A 3EOKB 3NFEA 3UBCA 4JYQA 1HDSA 3ZTAA 3WCTD 1Q1FA 2HBEA 4L7YA 1HCOA 1BABA 4TMAB 2E2YA 1C7BB 1Y46B 1YMCA 1BINA 5CN9A 4HH1A 2UUMA 4MQIA 104MA 2ZFOB 5ILRA 1HA7A 4XDIA 1PBXA 4F0TB 3MJPB 2LHBA 1XZ4A 2UUND 1LA6A 2PGHB 2R4YA 1UVIA 3AQ8A 4UIQA 3ZJNA 101MA 5EV5A 1NWNA 3PELB 5JGGA 1X9FA 1MOHA 4ESAB 2VLZA 2V1EA 2HHEA 1KFRA 2MYBA 3R5IA 2VJRB 4IROB 4GXEA 1QI8A 2BKMA 1F65A 2EB8A 2Z6NB 1MYZA 1CG5B 5E6EA 5C6EB 1DO7A 4YU3A 4N7NB 2Z6SA 3GKVB 3WTGB 3AQ6A 2R4WA 4PQBA 2D60A 1GZXA 1YE2A 3PI9A 4TWVA 2VM0A 2NX0A 2SPNA 3GKVA 3WTGA 2M6ZB 4GY3A 1NZ4A 1EMYA 2DXMB 1GLIB 1IT3A 2JLGA 2BLHA 4BJUA 1QI8B 1K1KB 2GRHA 1GCWB 1YHUB 2VJRA 3L0FA 1JY7B 1ITHA 5JGGB 2V1IA 1LH2A 5HLXA 3GQGB 3QQRA 5IKSA 3AQ9A 4LM6B 3HF4B 2ZFBA 1YHUC 1CIIA 1DUOA 4UZVA 1BJEA 1LH7A 4B4YA 1DWRA 1G9VA 1VXBA 3K3UA 1BZZB 4M4BB 2BWHA 5B13G 3ECLA 3S1JA 3EU1A 2VLYA 2MYAA 3UHGA 1DXCA 3M39A 1Y45B 5AZRA 1JBOA 3D7OB 4F0UA 1Y0DB 3UHTA 1GBVB 2IN4A 2DKAA 1YGDA 1HI1A 2BV8A 5FVBA 4ERTA 1NS6B 4G51A 4O35A 1ECDA 3QJEB 4DC8A 3HF4A 1KTPB 2R4XA 3WR1A 2V1FA 1HABB 1IDRA 4MQJA 2ZFOC 2W72C 1M9PA 1HBGA 2QU0A 3MYMA 2NRMA 2BK9A 5CNDA 3WCPA 1YZIA 4NI0A 2GL3A 1UVLA 2RAOB 2MHBA 108MA 1NQPA 2EKTA 1Y4GB 5EOHA 2X49A 1RVWA 1YGFA 6HBWB 3ARKA 3BJ1B 3V2ZA 2MGFA 3NG6B 4U8UB 3BA2A 1X3KA
chains in the Genus database with same CATH topology
1V9QA 4X0LA 3S65B 3ZHWA 3PIAB 2DN1B 2HHEB 3AT6A 2DN2A 3GDJB 5KERA 1IRDB 1UVXA 2HZ2A 4AVEA 3H58A 2GRZA 2W72A 3D4XB 1O1LB 1X9FC 3ARLA 1T1NA 1YHRA 1HBSB 4TWUA 2EVKA 1HDBB 2D5ZA 1NZ3A 2KSCA 3QJBA 1HBHA 3ZJSA 3QMAA 1LFVA 2DC3A 1Y35A 4FH7A 3EOKA 3ZJPA 1BZ0B 3SDHA 2XKIA 1JPBA 3GLNA 5CN4A 1MYMA 1YIHB 2ZSRA 2NSSA 1NEJA 2HHBB 3MBAA 3CIUA 3WCWD 1J40B 3WCUD 1IWHB 2NSRA 4MQKB 2GTLB 1SDLB 1B86B 1YMBA 1CH3A 4XS0B 1NIHB 1YIEB 1A01A 1LH1A 3NMMB 1BVDA 1UX9A 1XZVB 3QM6A 3LR9A 1WLAA 1KD2B 4OODA 2ZLWA 1FN3B 1UT0A 1WVPA 3UHXA 3MKBB 1BUWA 2G11A 2ZFOD 3ONZB 1YFFA 2MGEA 1BIJB 5HBIA 3IC2B 3UHEA 3D1AA 1HACA 3WCTB 1CH9A 2ZWJA 2ZSNA 1Y09A 3GQRA 1Y5FB 2RI4A 1Y0DA 1NZ5A 2AUQA 2G0XA 2HZ3A 1NIHA 3WCWB 110MA 2G0RA 2VEEA 3DHRB 5EETA 2FRFA 5MBNA 1Y0CB 3AQ5A 2HHDB 1DKEA 2W6VB 1QXEB 1YGDB 2OH9A 5CNFA 1O1NA 3ZJJA 1JZKA 5HAVA 1GDIA 1MLUA 1A6MA 3ZH0A 1OUTB 2H8FB 1F63A 1Y5KA 1MLJA 3UHUA 1HBSA 3HRWB 2BLIA 1EW6A 3QJDA 1DO3A 1MOCA 2DN3B 2V1JA 2LH7A 1HBBB 1XQ5B 2O5TX 3UH5A 5ILMA 3DHTB 1MNIA 2HCOA 2Z85A 4IT8A 1QSHB 1N9IA 1YEUB 1CQXA 2H8FA 2VYWA 1O1MA 3PI8A 4PNJA 1O1NB 5EQMA 1BZ1B 2O5QX 3PI2A 3MYNA 1A00B 1Y4VB 1VREA 2ZS0D 1MCYA 2HBEB 2O5OX 1OFJA 5CN7A 3NFEB 1Y7GB 1Y7DB 5ILEA 1CMYA 1S69A 1O1JA 4NK1A 2EVPA 3G4QA 1Y5FA 3KMFC 4MXKA 1VXAA 3E4NA 2MYDA 3FH9B 1N9HA 1HACB 3WCTA 4FH6A 1NXFA 4HSWA 1GCVA 3G4WA 3OZVA 2ZLVA 3CY5B 1A0ZA 2GLNA 4OF9A 1BUWB 3DR9A 1CH2A 2VRYA 3EU1B 1LFYA 3UH6A 1UFPA 1BZZA 2MGMA 6HBIA 1XZVA 4HHBB 1HBBA 2AV3A 4NS2A 4ROMB 1C40A 1Y0TA 1B86A 1COHA 1S5YB 5JDOC 1LJWB 3QM7A 3CIUB 2MBWA 3R0GA 1LFTB 4WJGA 3BOMA 5HLQA 2MGKA 1XZ2B 3ZJHA 3PI8B 3D17B 4MXLA 1GDKA 3ED9A 2M6ZA 2HBSA 2LH5A 1XZUA 1YEQB 1YDZA 1MLMA 1UMOA 2AA1B 5EYJA 2WTGA 1VWTB 1GBUB 1LFZA 4N7NA 4F6FA 1MTIA 3UGZA 5C6EA 1XQ5A 1CG5A 1V4UA 3ZOLA 4NK2A 4WCHD 1N9XA 2GDMA 4ODCB 1ASHA 4HRTB 2VHBA 1ECAA 5E29B 1DXUB 1WMUA 3VRFB 3A5AA 2V1GA 1Y4BB 3GDJA 4SDHA 2V1KA 1YHEA 1A9WE 1G08B 1FCSA 4H2LA 1IT2A 1DO4A 1UFJA 2G14A 2ZLUA 3K9ZA 5CNCA 3ZJOA 1YVTA 1YEVA 1DKEB 2W6VA 2SPLA 2AA1A 1YMAA 3OK5A 3TM9A 1EWAA 1ECNA 1NS9A 3G52A 1MNJA 1MYHA 2FRKX 1MBNA 5SW7B 4TYXA 1S56A 4VHBA 1H97A 1J7WA 3ECZA 3WCVC 2XKHA 1Y4FA 4UURA 2QRWA 3GOUA 1LHTA 3LB4A 1S0HA 1YEOA 1NS9B 3M3BA 3LB2A 1NEJB 1QPWB 3VHBA 111MA 2FALA 1DTMA 3OJ1A 4MU5A 2ZS1B 2MGHA 3ASEA 5CHRA 3RJNB 3UH3A 3WHMB 1YE0B 1Y35B 1Y8WA 1HBHB 1FSXB 1Y31A 3AQ7A 3GQPA 2ZT0A 1K0YB 1DXTA 3CY5A 2HBFA 1DWTA 1DXVA 2O58X 1HBRB 1MYTA 3W4UB 3HEPA 1A01B 3MJUB 5EUIB 109MA 4XS0A 3S66A 1A9WA 2MGIA 1YEVB 1Y22B 3UHZA 2GTLA 1MWBA 3WCVB 3PI4A 1YVQA 2CMMA 2G0ZA 1RPSB 5CNBA 2MGJA 3UHHA 1UIWA 1YDZB 3UI0A 1Y7GA 3HHBA 3S65A 1FLPA 4X0LB 1OR6A 4ODCA 3B75B 3QJBB 1AJHA 4N7OB 2BNLA 1GBUA 5EE4D 5KKKA 3D4XA 3M3AA 3G4UA 2B7HA 1RQ3A 1HBAA 1MBSA 1G09B 1YEUA 1XZ5B 3UGYA 5CN6A 2LH6A 1FDHA 1XZ5A 2VYZA 4LPIA 2QSSA 1Y8HA 3A0GB 4MQGA 4G51B 1JZLA 2B7HB 105MA 1HGBA 1C40B 1Y0TB 3OGBA 2MGAA 1Y0AA 1CBMA 1PBXB 1OBMA 2VEBA 4MBNA 3SDNA 3HEOA 1V4XA 5HU6A 1Y5JA 3HENA 1UVYA 1MLFA 5CHQA 4C44A 1C7DB 4NI1A 1HDAA 1XY0B 2HHDA 102MA 1UIWB 1HV4A 3LQDA 1JW8A 1EBTA 1A0UA 2ZLXB 4KMWA 2HBDB 1NS6A 4YU4B 1S61A 4NXAA 3UHCA 3GYSB 2O5LX 4NI1B 5CMVA 2QSPA 1QXDA 2MGLA 1MLLA 2AV0A 1NGKA 2HBFB 5ILPA 1K0YA 4GZGA 1A00A 1THBA 1Y5JB 1HLBA 3A5BA 3O7NA 2H35B 1YE2B 1MBCA 2OH8A 3PI9B 2HCOB 1RSEA 1S5XB 1Y0AB 1IRCA 3GKTA 5E6EB 2Z6NA 2G0VA 3ONZA 2D2NA 1YCAA 1O1MB 2D6CA 1LTWA 1R1XB 2OLPA 1X9FB 1R1YA 1A6KA 1SI4A 1JZMA 112MA 3MVCA 1K1KA 3UH7A 1HBAB 1CBLA 5D5RA 1V4WB 1MDNA 1G0BA 1XZ4B 2NRLA 1HBIA 2DN3A 3PI1A 1RQ4B 4FWZA 1Y5KB 3OZWA 1HCOB 3UHNA 1HLMA 3B75A 2O5SX 5KDQA 1O1PA 3A5GA 1SDKA 2DHBA 2Z6TA 4FC3A 1VXDA 3HHBB 3WCWA 3E5OA 3ZJRA 4ESAA 1UX8A 1JP8A 2HZ1A 1JL7A 3V2VA 4YU4A 1MLGA 2ZLXA 5EE4C 1J7SA 3DHRA 2W72B 4HRTA 3TM3A 2BMMA 2G0SA 4ZVAA 5AZQA 1MYJA 4O4ZA 1F5OA 3D1AB 1Y22A 1J52A 4F6BA 1MLQA 1MOAA 1HBRA 107MA 1DXVB 3WCVD 2ZT3A 1IBEB 2ZSPA 1BABB 3WFWA 2ZSOA 2GTLC 1FSXA 3KUNA 1MNOA 3OZUA 2ZS1A 1J7YB 1Y01B 3WHMA 1DM1A 3VRGA 3UBVA 1MLNA 1YGFB 1LFQA 3OO5B 1CG8B 1LFTA 3RGKA 3RJ6A 4MQKA 2GRFA 4NI0B 3WCPB 2ZLTA 4PQCA 4KMVA 1ABWA 2D2MC 4ROMA 1JF4A 2VLXA 3WFXA 1CH1A 4FWYA 4MQJB 5HLUA 3A59B 1TU9A 3LB1A 1FSLA 2ZLTB 1Y83A 4ROLA 1J40A 3QJEA 1O1OB 1XXTB 2D2NC 1YG5B 3BCQA 1YIHA 2ZSZA 3E5IA 1HGCB 3G4YA 3OO4B 3P5QA 3VREA 4F6GA 3UHSA 4HRRB 3D7OA 1OJ6A 1YHEB 4MPMA 4H2LB 1MBOA 1MBAA 1Y7DA 1BBBA 1MZ0A 4F6DA 4FC3B 4F4OA 1YCBA 1CO9A 1YOHA 1Y4VA 3AT5B 1LFZB 1MLKA 1XZUB 2RAOA 1CPWA 1Y4PA 1QSIA 1GJNA 1Y31B 2R80B 1YHUA 5KDQB 3KUOA 2IG3A 1ECOA 2R4ZA 3D17A 1DUKA 3HYUB 2OIFA 3MN0A 1ABWB 2D60B 3BJ3A 3O89A 3GOUB 3ZJQA 1YZIB 1G0BB 3EDBA 1MOBA 1U7SA 1AJ9A 1XYEB 1W92A 1SHRA 1VXGA 5F2AA 1LFYB 4HHBA 1R1YB 1TESA 4U8UC 3HXNA 5M3SA 1GBVA 1FAWB 1DO1A 2QMBB 2ZLVB 2D2NB 3UHWA 3PT7B 4HSXA 1Y4RB 1BZPA 4M4BA 1BZRA 5F0BA 4DC7A 1DWSA 2R50A 1A4FB 2H35A 1Y4RA 2AURA 5C6YA 1J7SB 4MBAA 3ARJA 4F69A 2D2MB 2BW9M 1Y45A 2GTLD 1QXDB 1J3FA 1CLSA 3D1KB 3QJCA 1V75A 1VXEA 2DHBB 1PMBA 3GYSA 3WCTC 1J3YB 1HRMA 5HU6B 1HHOB 1JF3A 1YOIA 1HV4B 2QFNA 1MYIA 1M6CA 2ZS0B 4L2MA 1Y0WB 3IC2A 1C7DA 1DLWA 1Y8KB 3G4VA 2FAMA 1MLHA 2ZSQA 1J3ZB 4DWUA 1NZ2A 2QSSB 1QSHA 4KN3A 3NMLA 1G09A 2MGBA 1A6GA 1GZXB 1VXFA 1COHB 4YU3B 2GNWA 1O1KA 1RTEA 1LA6B 1YH9A 2GKNA 3QZZA 5JDOD 3FS4B 3BJ3B 1MLOA 3AG0A 4NZIA 1OUTA 1YENA 1J41A 1RQAB 1RQ3B 1HDSB 1VXCA 3IA3B 3NL7A 1Y8KA 1QXEA 1B0BA 3KMFA 1JP6A 1MKOB 2ZT2A 3P5QB 1MBIA 3FH9A 3MOUA 4O4TA 3A9MA 4MQIB 3E55A 1Y0CA 2C0KA 1JEBB 2MYEA 1O1LA 1BVCA 1SPEA 1Y2ZA 3D1KA 5EUIA 4WJG1 2GNVA 4H0BA 4BJAA 5AB8A 2MB5A 4MAXA 2PEGA 2D2MA 1DXTB 4ZVBA 1MNKA 1Y8WB 1M6MA 3ZJMA 2ZT1A 106MA 4C0NA 1ABYB 2LH1A 3NG6A 4U8UA 1JL6A 3VREB 1Y4QA 1BIJA 5E83B 4MQCA 4FWXA 1MWDA 1Y85B 3MJUA 3BJ2B 1RVWB 5E83A 1HGBB 3BCQB 2YRSB 1YG5A 1Y4GA 2QMBA 1FN3A 3GQPB 2BLJM 1KD2A 5CNGA 1YE0A 1MWCA 3QM9A 1IBEA 5B85A 1YIEA 1YOGA 2D2ND 1Y7ZA 3M38A 3NMMA 1HGAA 3IC0A 3ZOMA 1CP5A 2H8DB 2W31A 3ODQA 3IXFA 4ILZA 2VYYA 2QFKA 1VXHA 3HRWA 1LHSA 1DXDA 1Y4FB 1SPGB 2HHBA 1YVTB 2AUOA 3ZJIA 1O1IB 3U3EA 2GKMA 5SW7A 1F5PA 3UHYA 3G4RA 3UHQA 2EB9A 4O1TA 1Y4PB 1EBCA 1L2KA 1HDBA 2AUPA 1C7CA 4M4AA 2FRIX 3VRFA 1MGNA 1NPFA 1CH4A 1LFLA 3H57A 1X9FD 1NPGA 2ZLUB 1LFLB 1HGAB 5KERB 3S66B 1FDHG 2SPOA 2XYKA 4N8TA 2DN2B 1BBBB 2JHOA 3UHDA 1SI4B 1C7CB 5B84A 1YEQA 1UC3A 3PIAA 1CP0A 4HRRA 1JY7A 3AT6B 2RI4B 1XZ7A 1R1XA 1SDKB 1GDJA 2YRSA 1V4UB 1VRFA 1XZ2A 3BJ2A 1GLIA 1JDOA 1S5XA 1CIKA 2MHBB 1O1OA 2ZSTA 3WCUC 1XCHA 1S0HB 1S5YA 1YEOB 2EF2A 2ZLWB 3A59A 1V07A 2QU0B 5CN8A 5MBAA 1O16A 2ZSSA 4IROA 1LH5A 1LJWA 1HABA 1IWHA 1JEBA 3WR1B 3WFTA 2HBDA 1MYGA 1Y8IA 1CG8A 1A0UB 2PGHA 4G1BA 3K8BA 1CH7A 4MQCB 1MTJA 1Y7CB 1ABYA 1A3NB 2ZFOA 1J7YA 1LH6A 2WTHA 1O1JB 3ZJLA 1GDLA 1RQAA 1G08A 2O5MX 3SZKB 3WI8A 2FRJX 1FAWA 3HXNB 3WCWC 1Y2ZB 2LH2A 2SPMA 3TLDA 1DXUA 3K8BB 5JDOE 1O1KB 4DWTA 1AJ9B 1XYEA 3LHBA 1ABSA 1Y8HB 3A0GA 4MQGB 1HSYA 3GQGA 2DN1A 3HYUA 5CN5A 3NL7B 1A6NA 5CNEA 4KJTA 3UHKA 1YENB 1AZIA 2R80A 1QSIB 2D5XB 3UHBA 1RQ4A 2R1HA 4N7OA 2D5XA 1V4WA 1URYA 1IOPA 2ZS0C 1J3YA 4G1VA 103MA 3ORDA 3R5IB 1M9PB 1V75B 1Z8UB 1MBDA 2G10A 3QJCB 1LH3A 4HBIA 1MYFA 1CO8A 1N9FA 3G53A 3SZKA 1J3ZA 3DHTA 2G12A 1I3DA 1AJGA 2W6WA 1A4FA 1GCVB 1SWMA 1MLRA 3WCVA 1Y0WA 1CIOA 3OO4A 3VAUA 4M4AB 1C7BA 1Y46A 1URVA 3PT7A 2ZS1D 2MGDA 1H1XA 1THBB 3W4UA 4L7YB 4AVDA 3QQQA 1S6AA 5EYSA 5JDOF 4ROLB 2Z8AA 3WCUA 4NXCA 1A3NA 1SHRB 1G9VB 1Y7CA 2LH3A 1DTIA 4N7PA 1DLYA 2ZFBB 7HBIA 1Y8IB 1OUUB 3LQDB 1YVQB 2MGCA 1BZ1A 1HJTA 2O5BX 3IC0B 1G0AB 4MQHB 2W6YA 1J7WB 1GCWA 1YFFB 3G46A 4PQ6A 1V4XB 1JP9A 2DXMA 1XZ7B 2HBCB 1MLSA 1MNHA 1X46A 1BZ6A 1RTXA 3QM8A 1Y85A 2OHBA 4MQHA 3PI3A 1LUEA 1SDLA 4F68A 3MKBA 4JACA 2ZT4A 4F4OB 5JOMA 1OUUA 3QJDB 5HY8A 4O2GA 3PELA 3QZXA 4B3WA 3WCUB 3OVUC 1JWNA 4N8TB 1WMUB 2MYCA 3S1IA 1VHBA 1LFVB 1O1PB 3UHIA 2D5ZB 3MJPA 5EU2A 1D8UA 1OFKA 1V5HA 1NWIA 4F6JA 2WY4A 1YHUD 3LB3A 3UHRA 3AT5A 1GVHA 1MKOA 1CQ2A 2HBSB 3ODQB 4QAUA 1NAZA 2ZSXA 1MODA 1IRDA 2ZS1C 1O1IA 3HC9A 1J41B 2HBGA 5HY8B 1Y4BA 1RPSA 3BOMB 1FHJA 1SPGA 1T1NB 1YHRB 3EDAA 2G3HA 1Y09B 3GQRB 5E29A 3FS4A 1YH9B 3A2GA 2D2MD 2H8DA 6HBWA 1LFQB 3OO5A 3WFUA 1MTKA 1HGCA 2QLSB 3PT8A 3LR7A 1A3OA 1Y4QB 1Y7ZB 1VWTA 2R1HB 1NQPB 1XXTA 2EKUA 2HBCA 4U8UD 3DUTB 1Y83B 3DUTA 1CH5A 2ZSYA 3UHVA 1A0ZB 4F6IA 3ECXA 1A3OB 2W6XA 1KR7A 3PT8B 3BJ1A 2QSPB 2QLSA 1QPWA 1I3EA 2ZS0A 1G0AA 1U7RA 3GK9A 1HHOA 4H07A 1FHJB 3QM5A 4N7PB 2XKGA 1CMYB 2V1HA 5D1VA 1OR4A 2PEGB 3VRGB 2OHAA 2MGGA 3S48C 1HDAB 1XY0A 1CLSB 1BZ0A 3EOKB 3NFEA 3UBCA 4JYQA 1HDSA 3WCTD 1Q1FA 2HBEA 4L7YA 1HCOA 1BABA 2E2YA 1C7BB 1Y46B 1YMCA 1BINA 5CN9A 4MQIA 104MA 2ZFOB 5ILRA 4XDIA 1PBXA 3MJPB 2LHBA 1XZ4A 1LA6A 2PGHB 2R4YA 3AQ8A 4UIQA 3ZJNA 101MA 5EV5A 1NWNA 3PELB 5JGGA 1X9FA 1MOHA 4ESAB 2VLZA 2V1EA 2HHEA 1KFRA 2MYBA 3R5IA 4IROB 1QI8A 2BKMA 1F65A 2EB8A 2Z6NB 1MYZA 1CG5B 5E6EA 5C6EB 1DO7A 4YU3A 4N7NB 2Z6SA 3GKVB 3WTGB 3AQ6A 2R4WA 4PQBA 2D60A 1GZXA 1YE2A 3PI9A 4TWVA 2VM0A 2NX0A 2SPNA 3GKVA 3WTGA 2M6ZB 1NZ4A 1EMYA 2DXMB 1GLIB 1IT3A 2BLHA 1QI8B 1K1KB 2GRHA 1GCWB 1YHUB 1JY7B 1ITHA 5JGGB 2V1IA 1LH2A 5HLXA 3GQGB 3QQRA 5IKSA 3AQ9A 3HF4B 2ZFBA 1YHUC 4UZVA 1DUOA 1BJEA 1LH7A 4B4YA 1DWRA 1G9VA 1VXBA 3K3UA 1BZZB 4M4BB 2BWHA 3ECLA 3S1JA 3EU1A 2VLYA 2MYAA 3UHGA 1DXCA 3M39A 1Y45B 5AZRA 3D7OB 1Y0DB 3UHTA 1GBVB 2IN4A 1YGDA 1NS6B 4G51A 4O35A 1ECDA 3QJEB 4DC8A 3HF4A 2R4XA 3WR1A 2V1FA 1HABB 1IDRA 4MQJA 2ZFOC 2W72C 1M9PA 1HBGA 2QU0A 3MYMA 2NRMA 2BK9A 5CNDA 3WCPA 1YZIA 4NI0A 2GL3A 2RAOB 2MHBA 108MA 1NQPA 2EKTA 1Y4GB 5EOHA 1RVWA 1YGFA 6HBWB 3ARKA 3BJ1B 3V2ZA 2MGFA 3NG6B 4U8UB 3BA2A 1X3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9Q A;  4X0L A;  3S65 B;  3ZHW A;  3PIA B;  2DN1 B;  2HHE B;  3AT6 A;  2DN2 A;  3GDJ B;  5KER A;  1IRD B;  1UVX A;  2HZ2 A;  4AVE A;  3H58 A;  2GRZ A;  2W72 A;  3D4X B;  1O1L B;  1X9F C;  3ARL A;  1T1N A;  1YHR A;  1HBS B;  4TWU A;  2EVK A;  1HDB B;  2D5Z A;  1NZ3 A;  2KSC A;  3QJB A;  1HBH A;  3ZJS A;  3QMA A;  1LFV A;  2DC3 A;  1Y35 A;  4FH7 A;  3EOK A;  3ZJP A;  1BZ0 B;  3SDH A;  2XKI A;  1JPB A;  3GLN A;  5CN4 A;  1MYM A;  1YIH B;  2ZSR A;  2NSS A;  1NEJ A;  2HHB B;  3MBA A;  3CIU A;  3WCW D;  1J40 B;  3WCU D;  1IWH B;  2NSR A;  4MQK B;  2GTL B;  1SDL B;  1B86 B;  1YMB A;  1CH3 A;  4XS0 B;  1NIH B;  1YIE B;  1A01 A;  1LH1 A;  3NMM B;  1BVD A;  1UX9 A;  1XZV B;  3QM6 A;  3LR9 A;  1WLA A;  1KD2 B;  4OOD A;  2ZLW A;  1FN3 B;  1UT0 A;  1WVP A;  3UHX A;  3MKB B;  1BUW A;  2G11 A;  2ZFO D;  3ONZ B;  1YFF A;  2MGE A;  1BIJ B;  5HBI A;  3IC2 B;  3UHE A;  3D1A A;  1HAC A;  3WCT B;  1CH9 A;  2ZWJ A;  2ZSN A;  1Y09 A;  3GQR A;  1Y5F B;  2RI4 A;  1Y0D A;  1NZ5 A;  2AUQ A;  2G0X A;  2HZ3 A;  1NIH A;  3WCW B;  110M A;  2G0R A;  2VEE A;  3DHR B;  5EET A;  2FRF A;  5MBN A;  1Y0C B;  3AQ5 A;  2HHD B;  1DKE A;  2W6V B;  1QXE B;  1YGD B;  2OH9 A;  5CNF A;  1O1N A;  3ZJJ A;  1JZK A;  5HAV A;  1GDI A;  1MLU A;  1A6M A;  3ZH0 A;  1OUT B;  2H8F B;  1F63 A;  1Y5K A;  1MLJ A;  3UHU A;  1HBS A;  3HRW B;  2BLI A;  1EW6 A;  3QJD A;  1DO3 A;  1MOC A;  2DN3 B;  2V1J A;  2LH7 A;  1HBB B;  1XQ5 B;  2O5T X;  3UH5 A;  5ILM A;  3DHT B;  1MNI A;  2HCO A;  2Z85 A;  4IT8 A;  1QSH B;  1N9I A;  1YEU B;  1CQX A;  2H8F A;  2VYW A;  1O1M A;  3PI8 A;  4PNJ A;  1O1N B;  5EQM A;  1BZ1 B;  2O5Q X;  3PI2 A;  3MYN A;  1A00 B;  1Y4V B;  1VRE A;  2ZS0 D;  1MCY A;  2HBE B;  2O5O X;  1OFJ A;  5CN7 A;  3NFE B;  1Y7G B;  1Y7D B;  5ILE A;  1CMY A;  1S69 A;  1O1J A;  4NK1 A;  2EVP A;  3G4Q A;  1Y5F A;  3KMF C;  4MXK A;  1VXA A;  3E4N A;  2MYD A;  3FH9 B;  1N9H A;  1HAC B;  3WCT A;  4FH6 A;  1NXF A;  4HSW A;  1GCV A;  3G4W A;  3OZV A;  2ZLV A;  3CY5 B;  1A0Z A;  2GLN A;  4OF9 A;  1BUW B;  3DR9 A;  1CH2 A;  2VRY A;  3EU1 B;  1LFY A;  3UH6 A;  1UFP A;  1BZZ A;  2MGM A;  6HBI A;  1XZV A;  4HHB B;  1HBB A;  2AV3 A;  4NS2 A;  4ROM B;  1C40 A;  1Y0T A;  1B86 A;  1COH A;  1S5Y B;  5JDO C;  1LJW B;  3QM7 A;  3CIU B;  2MBW A;  3R0G A;  1LFT B;  4WJG A;  3BOM A;  5HLQ A;  2MGK A;  1XZ2 B;  3ZJH A;  3PI8 B;  3D17 B;  4MXL A;  1GDK A;  3ED9 A;  2M6Z A;  2HBS A;  2LH5 A;  1XZU A;  1YEQ B;  1YDZ A;  1MLM A;  1UMO A;  2AA1 B;  5EYJ A;  2WTG A;  1VWT B;  1GBU B;  1LFZ A;  4N7N A;  4F6F A;  1MTI A;  3UGZ A;  5C6E A;  1XQ5 A;  1CG5 A;  1V4U A;  3ZOL A;  4NK2 A;  4WCH D;  1N9X A;  2GDM A;  4ODC B;  1ASH A;  4HRT B;  2VHB A;  1ECA A;  5E29 B;  1DXU B;  1WMU A;  3VRF B;  3A5A A;  2V1G A;  1Y4B B;  3GDJ A;  4SDH A;  2V1K A;  1YHE A;  1A9W E;  1G08 B;  1FCS A;  4H2L A;  1IT2 A;  1DO4 A;  1UFJ A;  2G14 A;  2ZLU A;  3K9Z A;  5CNC A;  3ZJO A;  1YVT A;  1YEV A;  1DKE B;  2W6V A;  2SPL A;  2AA1 A;  1YMA A;  3OK5 A;  3TM9 A;  1EWA A;  1ECN A;  1NS9 A;  3G52 A;  1MNJ A;  1MYH A;  2FRK X;  1MBN A;  5SW7 B;  4TYX A;  1S56 A;  4VHB A;  1H97 A;  1J7W A;  3ECZ A;  3WCV C;  2XKH A;  1Y4F A;  4UUR A;  2QRW A;  3GOU A;  1LHT A;  3LB4 A;  1S0H A;  1YEO A;  1NS9 B;  3M3B A;  3LB2 A;  1NEJ B;  1QPW B;  3VHB A;  111M A;  2FAL A;  1DTM A;  3OJ1 A;  4MU5 A;  2ZS1 B;  2MGH A;  3ASE A;  5CHR A;  3RJN B;  3UH3 A;  3WHM B;  1YE0 B;  1Y35 B;  1Y8W A;  1HBH B;  1FSX B;  1Y31 A;  3AQ7 A;  3GQP A;  2ZT0 A;  1K0Y B;  1DXT A;  3CY5 A;  2HBF A;  1DWT A;  1DXV A;  2O58 X;  1HBR B;  1MYT A;  3W4U B;  3HEP A;  1A01 B;  3MJU B;  5EUI B;  109M A;  4XS0 A;  3S66 A;  1A9W A;  2MGI A;  1YEV B;  1Y22 B;  3UHZ A;  2GTL A;  1MWB A;  3WCV B;  3PI4 A;  1YVQ A;  2CMM A;  2G0Z A;  1RPS B;  5CNB A;  2MGJ A;  3UHH A;  1UIW A;  1YDZ B;  3UI0 A;  1Y7G A;  3HHB A;  3S65 A;  1FLP A;  4X0L B;  1OR6 A;  4ODC A;  3B75 B;  3QJB B;  1AJH A;  4N7O B;  2BNL A;  1GBU A;  5EE4 D;  5KKK A;  3D4X A;  3M3A A;  3G4U A;  2B7H A;  1RQ3 A;  1HBA A;  1MBS A;  1G09 B;  1YEU A;  1XZ5 B;  3UGY A;  5CN6 A;  2LH6 A;  1FDH A;  1XZ5 A;  2VYZ A;  4LPI A;  2QSS A;  1Y8H A;  3A0G B;  4MQG A;  4G51 B;  1JZL A;  2B7H B;  105M A;  1HGB A;  1C40 B;  1Y0T B;  3OGB A;  2MGA A;  1Y0A A;  1CBM A;  1PBX B;  1OBM A;  2VEB A;  4MBN A;  3SDN A;  3HEO A;  1V4X A;  5HU6 A;  1Y5J A;  3HEN A;  1UVY A;  1MLF A;  5CHQ A;  4C44 A;  1C7D B;  4NI1 A;  1HDA A;  1XY0 B;  2HHD A;  102M A;  1UIW B;  1HV4 A;  3LQD A;  1JW8 A;  1EBT A;  1A0U A;  2ZLX B;  4KMW A;  2HBD B;  1NS6 A;  4YU4 B;  1S61 A;  4NXA A;  3UHC A;  3GYS B;  2O5L X;  4NI1 B;  5CMV A;  2QSP A;  1QXD A;  2MGL A;  1MLL A;  2AV0 A;  1NGK A;  2HBF B;  5ILP A;  1K0Y A;  4GZG A;  1A00 A;  1THB A;  1Y5J B;  1HLB A;  3A5B A;  3O7N A;  2H35 B;  1YE2 B;  1MBC A;  2OH8 A;  3PI9 B;  2HCO B;  1RSE A;  1S5X B;  1Y0A B;  1IRC A;  3GKT A;  5E6E B;  2Z6N A;  2G0V A;  3ONZ A;  2D2N A;  1YCA A;  1O1M B;  2D6C A;  1LTW A;  1R1X B;  2OLP A;  1X9F B;  1R1Y A;  1A6K A;  1SI4 A;  1JZM A;  112M A;  3MVC A;  1K1K A;  3UH7 A;  1HBA B;  1CBL A;  5D5R A;  1V4W B;  1MDN A;  1G0B A;  1XZ4 B;  2NRL A;  1HBI A;  2DN3 A;  3PI1 A;  1RQ4 B;  4FWZ A;  1Y5K B;  3OZW A;  1HCO B;  3UHN A;  1HLM A;  3B75 A;  2O5S X;  5KDQ A;  1O1P A;  3A5G A;  1SDK A;  2DHB A;  2Z6T A;  4FC3 A;  1VXD A;  3HHB B;  3WCW A;  3E5O A;  3ZJR A;  4ESA A;  1UX8 A;  1JP8 A;  2HZ1 A;  1JL7 A;  3V2V A;  4YU4 A;  1MLG A;  2ZLX A;  5EE4 C;  1J7S A;  3DHR A;  2W72 B;  4HRT A;  3TM3 A;  2BMM A;  2G0S A;  4ZVA A;  5AZQ A;  1MYJ A;  4O4Z A;  1F5O A;  3D1A B;  1Y22 A;  1J52 A;  4F6B A;  1MLQ A;  1MOA A;  1HBR A;  107M A;  1DXV B;  3WCV D;  2ZT3 A;  1IBE B;  2ZSP A;  1BAB B;  3WFW A;  2ZSO A;  2GTL C;  1FSX A;  3KUN A;  1MNO A;  3OZU A;  2ZS1 A;  1J7Y B;  1Y01 B;  3WHM A;  1DM1 A;  3VRG A;  3UBV A;  1MLN A;  1YGF B;  1LFQ A;  3OO5 B;  1CG8 B;  1LFT A;  3RGK A;  3RJ6 A;  4MQK A;  2GRF A;  4NI0 B;  3WCP B;  2ZLT A;  4PQC A;  4KMV A;  1ABW A;  2D2M C;  4ROM A;  1JF4 A;  2VLX A;  3WFX A;  1CH1 A;  4FWY A;  4MQJ B;  5HLU A;  3A59 B;  1TU9 A;  3LB1 A;  1FSL A;  2ZLT B;  1Y83 A;  4ROL A;  1J40 A;  3QJE A;  1O1O B;  1XXT B;  2D2N C;  1YG5 B;  3BCQ A;  1YIH A;  2ZSZ A;  3E5I A;  1HGC B;  3G4Y A;  3OO4 B;  3P5Q A;  3VRE A;  4F6G A;  3UHS A;  4HRR B;  3D7O A;  1OJ6 A;  1YHE B;  4MPM A;  4H2L B;  1MBO A;  1MBA A;  1Y7D A;  1BBB A;  1MZ0 A;  4F6D A;  4FC3 B;  4F4O A;  1YCB A;  1CO9 A;  1YOH A;  1Y4V A;  3AT5 B;  1LFZ B;  1MLK A;  1XZU B;  2RAO A;  1CPW A;  1Y4P A;  1QSI A;  1GJN A;  1Y31 B;  2R80 B;  1YHU A;  5KDQ B;  3KUO A;  2IG3 A;  1ECO A;  2R4Z A;  3D17 A;  1DUK A;  3HYU B;  2OIF A;  3MN0 A;  1ABW B;  2D60 B;  3BJ3 A;  3O89 A;  3GOU B;  3ZJQ A;  1YZI B;  1G0B B;  3EDB A;  1MOB A;  1U7S A;  1AJ9 A;  1XYE B;  1W92 A;  1SHR A;  1VXG A;  5F2A A;  1LFY B;  4HHB A;  1R1Y B;  1TES A;  4U8U C;  3HXN A;  5M3S A;  1GBV A;  1FAW B;  1DO1 A;  2QMB B;  2ZLV B;  2D2N B;  3UHW A;  3PT7 B;  4HSX A;  1Y4R B;  1BZP A;  4M4B A;  1BZR A;  5F0B A;  4DC7 A;  1DWS A;  2R50 A;  1A4F B;  2H35 A;  1Y4R A;  2AUR A;  5C6Y A;  1J7S B;  4MBA A;  3ARJ A;  4F69 A;  2D2M B;  2BW9 M;  1Y45 A;  2GTL D;  1QXD B;  1J3F A;  1CLS A;  3D1K B;  3QJC A;  1V75 A;  1VXE A;  2DHB B;  1PMB A;  3GYS A;  3WCT C;  1J3Y B;  1HRM A;  5HU6 B;  1HHO B;  1JF3 A;  1YOI A;  1HV4 B;  2QFN A;  1MYI A;  1M6C A;  2ZS0 B;  4L2M A;  1Y0W B;  3IC2 A;  1C7D A;  1DLW A;  1Y8K B;  3G4V A;  2FAM A;  1MLH A;  2ZSQ A;  1J3Z B;  4DWU A;  1NZ2 A;  2QSS B;  1QSH A;  4KN3 A;  3NML A;  1G09 A;  2MGB A;  1A6G A;  1GZX B;  1VXF A;  1COH B;  4YU3 B;  2GNW A;  1O1K A;  1RTE A;  1LA6 B;  1YH9 A;  2GKN A;  3QZZ A;  5JDO D;  3FS4 B;  3BJ3 B;  1MLO A;  3AG0 A;  4NZI A;  1OUT A;  1YEN A;  1J41 A;  1RQA B;  1RQ3 B;  1HDS B;  1VXC A;  3IA3 B;  3NL7 A;  1Y8K A;  1QXE A;  1B0B A;  3KMF A;  1JP6 A;  1MKO B;  2ZT2 A;  3P5Q B;  1MBI A;  3FH9 A;  3MOU A;  4O4T A;  3A9M A;  4MQI B;  3E55 A;  1Y0C A;  2C0K A;  1JEB B;  2MYE A;  1O1L A;  1BVC A;  1SPE A;  1Y2Z A;  3D1K A;  5EUI A;  4WJG 1;  2GNV A;  4H0B A;  4BJA A;  5AB8 A;  2MB5 A;  4MAX A;  2PEG A;  2D2M A;  1DXT B;  4ZVB A;  1MNK A;  1Y8W B;  1M6M A;  3ZJM A;  2ZT1 A;  106M A;  4C0N A;  1ABY B;  2LH1 A;  3NG6 A;  4U8U A;  1JL6 A;  3VRE B;  1Y4Q A;  1BIJ A;  5E83 B;  4MQC A;  4FWX A;  1MWD A;  1Y85 B;  3MJU A;  3BJ2 B;  1RVW B;  5E83 A;  1HGB B;  3BCQ B;  2YRS B;  1YG5 A;  1Y4G A;  2QMB A;  1FN3 A;  3GQP B;  2BLJ M;  1KD2 A;  5CNG A;  1YE0 A;  1MWC A;  3QM9 A;  1IBE A;  5B85 A;  1YIE A;  1YOG A;  2D2N D;  1Y7Z A;  3M38 A;  3NMM A;  1HGA A;  3IC0 A;  3ZOM A;  1CP5 A;  2H8D B;  2W31 A;  3ODQ A;  3IXF A;  4ILZ A;  2VYY A;  2QFK A;  1VXH A;  3HRW A;  1LHS A;  1DXD A;  1Y4F B;  1SPG B;  2HHB A;  1YVT B;  2AUO A;  3ZJI A;  1O1I B;  3U3E A;  2GKM A;  5SW7 A;  1F5P A;  3UHY A;  3G4R A;  3UHQ A;  2EB9 A;  4O1T A;  1Y4P B;  1EBC A;  1L2K A;  1HDB A;  2AUP A;  1C7C A;  4M4A A;  2FRI X;  3VRF A;  1MGN A;  1NPF A;  1CH4 A;  1LFL A;  3H57 A;  1X9F D;  1NPG A;  2ZLU B;  1LFL B;  1HGA B;  5KER B;  3S66 B;  1FDH G;  2SPO A;  2XYK A;  4N8T A;  2DN2 B;  1BBB B;  2JHO A;  3UHD A;  1SI4 B;  1C7C B;  5B84 A;  1YEQ A;  1UC3 A;  3PIA A;  1CP0 A;  4HRR A;  1JY7 A;  3AT6 B;  2RI4 B;  1XZ7 A;  1R1X A;  1SDK B;  1GDJ A;  2YRS A;  1V4U B;  1VRF A;  1XZ2 A;  3BJ2 A;  1GLI A;  1JDO A;  1S5X A;  1CIK A;  2MHB B;  1O1O A;  2ZST A;  3WCU C;  1XCH A;  1S0H B;  1S5Y A;  1YEO B;  2EF2 A;  2ZLW B;  3A59 A;  1V07 A;  2QU0 B;  5CN8 A;  5MBA A;  1O16 A;  2ZSS A;  4IRO A;  1LH5 A;  1LJW A;  1HAB A;  1IWH A;  1JEB A;  3WR1 B;  3WFT A;  2HBD A;  1MYG A;  1Y8I A;  1CG8 A;  1A0U B;  2PGH A;  4G1B A;  3K8B A;  1CH7 A;  4MQC B;  1MTJ A;  1Y7C B;  1ABY A;  1A3N B;  2ZFO A;  1J7Y A;  1LH6 A;  2WTH A;  1O1J B;  3ZJL A;  1GDL A;  1RQA A;  1G08 A;  2O5M X;  3SZK B;  3WI8 A;  2FRJ X;  1FAW A;  3HXN B;  3WCW C;  1Y2Z B;  2LH2 A;  2SPM A;  3TLD A;  1DXU A;  3K8B B;  5JDO E;  1O1K B;  4DWT A;  1AJ9 B;  1XYE A;  3LHB A;  1ABS A;  1Y8H B;  3A0G A;  4MQG B;  1HSY A;  3GQG A;  2DN1 A;  3HYU A;  5CN5 A;  3NL7 B;  1A6N A;  5CNE A;  4KJT A;  3UHK A;  1YEN B;  1AZI A;  2R80 A;  1QSI B;  2D5X B;  3UHB A;  1RQ4 A;  2R1H A;  4N7O A;  2D5X A;  1V4W A;  1URY A;  1IOP A;  2ZS0 C;  1J3Y A;  4G1V A;  103M A;  3ORD A;  3R5I B;  1M9P B;  1V75 B;  1Z8U B;  1MBD A;  2G10 A;  3QJC B;  1LH3 A;  4HBI A;  1MYF A;  1CO8 A;  1N9F A;  3G53 A;  3SZK A;  1J3Z A;  3DHT A;  2G12 A;  1I3D A;  1AJG A;  2W6W A;  1A4F A;  1GCV B;  1SWM A;  1MLR A;  3WCV A;  1Y0W A;  1CIO A;  3OO4 A;  3VAU A;  4M4A B;  1C7B A;  1Y46 A;  1URV A;  3PT7 A;  2ZS1 D;  2MGD A;  1H1X A;  1THB B;  3W4U A;  4L7Y B;  4AVD A;  3QQQ A;  1S6A A;  5EYS A;  5JDO F;  4ROL B;  2Z8A A;  3WCU A;  4NXC A;  1A3N A;  1SHR B;  1G9V B;  1Y7C A;  2LH3 A;  1DTI A;  4N7P A;  1DLY A;  2ZFB B;  7HBI A;  1Y8I B;  1OUU B;  3LQD B;  1YVQ B;  2MGC A;  1BZ1 A;  1HJT A;  2O5B X;  3IC0 B;  1G0A B;  4MQH B;  2W6Y A;  1J7W B;  1GCW A;  1YFF B;  3G46 A;  4PQ6 A;  1V4X B;  1JP9 A;  2DXM A;  1XZ7 B;  2HBC B;  1MLS A;  1MNH A;  1X46 A;  1BZ6 A;  1RTX A;  3QM8 A;  1Y85 A;  2OHB A;  4MQH A;  3PI3 A;  1LUE A;  1SDL A;  4F68 A;  3MKB A;  4JAC A;  2ZT4 A;  4F4O B;  5JOM A;  1OUU A;  3QJD B;  5HY8 A;  4O2G A;  3PEL A;  3QZX A;  4B3W A;  3WCU B;  3OVU C;  1JWN A;  4N8T B;  1WMU B;  2MYC A;  3S1I A;  1VHB A;  1LFV B;  1O1P B;  3UHI A;  2D5Z B;  3MJP A;  5EU2 A;  1D8U A;  1OFK A;  1V5H A;  1NWI A;  4F6J A;  2WY4 A;  1YHU D;  3LB3 A;  3UHR A;  3AT5 A;  1GVH A;  1MKO A;  1CQ2 A;  2HBS B;  3ODQ B;  4QAU A;  1NAZ A;  2ZSX A;  1MOD A;  1IRD A;  2ZS1 C;  1O1I A;  3HC9 A;  1J41 B;  2HBG A;  5HY8 B;  1Y4B A;  1RPS A;  3BOM B;  1FHJ A;  1SPG A;  1T1N B;  1YHR B;  3EDA A;  2G3H A;  1Y09 B;  3GQR B;  5E29 A;  3FS4 A;  1YH9 B;  3A2G A;  2D2M D;  2H8D A;  6HBW A;  1LFQ B;  3OO5 A;  3WFU A;  1MTK A;  1HGC A;  2QLS B;  3PT8 A;  3LR7 A;  1A3O A;  1Y4Q B;  1Y7Z B;  1VWT A;  2R1H B;  1NQP B;  1XXT A;  2EKU A;  2HBC A;  4U8U D;  3DUT B;  1Y83 B;  3DUT A;  1CH5 A;  2ZSY A;  3UHV A;  1A0Z B;  4F6I A;  3ECX A;  1A3O B;  2W6X A;  1KR7 A;  3PT8 B;  3BJ1 A;  2QSP B;  2QLS A;  1QPW A;  1I3E A;  2ZS0 A;  1G0A A;  1U7R A;  3GK9 A;  1HHO A;  4H07 A;  1FHJ B;  3QM5 A;  4N7P B;  2XKG A;  1CMY B;  2V1H A;  5D1V A;  1OR4 A;  2PEG B;  3VRG B;  2OHA A;  2MGG A;  3S48 C;  1HDA B;  1XY0 A;  1CLS B;  1BZ0 A;  3EOK B;  3NFE A;  3UBC A;  4JYQ A;  1HDS A;  3WCT D;  1Q1F A;  2HBE A;  4L7Y A;  1HCO A;  1BAB A;  2E2Y A;  1C7B B;  1Y46 B;  1YMC A;  1BIN A;  5CN9 A;  4MQI A;  104M A;  2ZFO B;  5ILR A;  4XDI A;  1PBX A;  3MJP B;  2LHB A;  1XZ4 A;  1LA6 A;  2PGH B;  2R4Y A;  3AQ8 A;  4UIQ A;  3ZJN A;  101M A;  5EV5 A;  1NWN A;  3PEL B;  5JGG A;  1X9F A;  1MOH A;  4ESA B;  2VLZ A;  2V1E A;  2HHE A;  1KFR A;  2MYB A;  3R5I A;  4IRO B;  1QI8 A;  2BKM A;  1F65 A;  2EB8 A;  2Z6N B;  1MYZ A;  1CG5 B;  5E6E A;  5C6E B;  1DO7 A;  4YU3 A;  4N7N B;  2Z6S A;  3GKV B;  3WTG B;  3AQ6 A;  2R4W A;  4PQB A;  2D60 A;  1GZX A;  1YE2 A;  3PI9 A;  4TWV A;  2VM0 A;  2NX0 A;  2SPN A;  3GKV A;  3WTG A;  2M6Z B;  1NZ4 A;  1EMY A;  2DXM B;  1GLI B;  1IT3 A;  2BLH A;  1QI8 B;  1K1K B;  2GRH A;  1GCW B;  1YHU B;  1JY7 B;  1ITH A;  5JGG B;  2V1I A;  1LH2 A;  5HLX A;  3GQG B;  3QQR A;  5IKS A;  3AQ9 A;  3HF4 B;  2ZFB A;  1YHU C;  4UZV A;  1DUO A;  1BJE A;  1LH7 A;  4B4Y A;  1DWR A;  1G9V A;  1VXB A;  3K3U A;  1BZZ B;  4M4B B;  2BWH A;  3ECL A;  3S1J A;  3EU1 A;  2VLY A;  2MYA A;  3UHG A;  1DXC A;  3M39 A;  1Y45 B;  5AZR A;  3D7O B;  1Y0D B;  3UHT A;  1GBV B;  2IN4 A;  1YGD A;  1NS6 B;  4G51 A;  4O35 A;  1ECD A;  3QJE B;  4DC8 A;  3HF4 A;  2R4X A;  3WR1 A;  2V1F A;  1HAB B;  1IDR A;  4MQJ A;  2ZFO C;  2W72 C;  1M9P A;  1HBG A;  2QU0 A;  3MYM A;  2NRM A;  2BK9 A;  5CND A;  3WCP A;  1YZI A;  4NI0 A;  2GL3 A;  2RAO B;  2MHB A;  108M A;  1NQP A;  2EKT A;  1Y4G B;  5EOH A;  1RVW A;  1YGF A;  6HBW B;  3ARK A;  3BJ1 B;  3V2Z A;  2MGF A;  3NG6 B;  4U8U B;  3BA2 A;  1X3K A; 
#chains in the Genus database with same CATH topology
 1V9Q A;  4X0L A;  3S65 B;  3ZHW A;  3PIA B;  2DN1 B;  2HHE B;  3AT6 A;  4YJJ A;  2DN2 A;  3GDJ B;  5KER A;  1IRD B;  1UVX A;  2HZ2 A;  4AVE A;  3H58 A;  2GRZ A;  2W72 A;  3D4X B;  1O1L B;  1X9F C;  3ARL A;  4BS9 A;  1T1N A;  1YHR A;  4ETT A;  1HBS B;  1WAC A;  2UUM B;  4TWU A;  2EVK A;  1HDB B;  2D5Z A;  1NZ3 A;  2KSC A;  3QJB A;  1HBH A;  3ZJS A;  3QMA A;  1LFV A;  2DC3 A;  1Y35 A;  4FH7 A;  3EOK A;  3ZJP A;  1BZ0 B;  3SDH A;  2XKI A;  2UUL B;  1JPB A;  3GLN A;  5CN4 A;  4RMP A;  1MYM A;  1YIH B;  2ZSR A;  2NSS A;  1NEJ A;  2HHB B;  1UVM A;  3MBA A;  3CIU A;  3WCW D;  1J40 B;  3WCU D;  1IWH B;  2NSR A;  4MQK B;  2GTL B;  1SDL B;  1B86 B;  1YMB A;  1CH3 A;  4XS0 B;  1NIH B;  1YIE B;  1A01 A;  1LH1 A;  3NMM B;  1BVD A;  1UX9 A;  1XZV B;  3QM6 A;  4YJJ B;  3LR9 A;  1WLA A;  1KD2 B;  4OOD A;  2ZLW A;  1FN3 B;  1UT0 A;  1WVP A;  3UHX A;  3MKB B;  1BUW A;  2G11 A;  2ZFO D;  3ONZ B;  5FVB M;  1YFF A;  2MGE A;  1BIJ B;  5HBI A;  4B02 A;  3IC2 B;  3UHE A;  3D1A A;  2UUL C;  1HAC A;  3WCT B;  1CH9 A;  2ZWJ A;  2ZSN A;  1Y09 A;  3GQR A;  1Y5F B;  2RI4 A;  1Y0D A;  1NZ5 A;  2AUQ A;  1LIA B;  2G0X A;  4ETU A;  2HZ3 A;  1NIH A;  3WCW B;  3O2C A;  110M A;  2G0R A;  2VEE A;  3DHR B;  5EET A;  2FRF A;  4Q70 A;  5MBN A;  4ETV A;  1Y0C B;  3AQ5 A;  2HHD B;  1DKE A;  2W6V B;  1QXE B;  1YGD B;  2OH9 A;  5CNF A;  1O1N A;  3ZJJ A;  1JZK A;  5HAV A;  1GDI A;  1MLU A;  1A6M A;  3ZH0 A;  1OUT B;  2H8F B;  1F63 A;  1Y5K A;  1MLJ A;  3UHU A;  2VJH A;  1HBS A;  3HRW B;  2BLI A;  1EW6 A;  3QJD A;  1DO3 A;  1MOC A;  2DN3 B;  2V1J A;  2LH7 A;  1HBB B;  1XQ5 B;  2O5T X;  3UH5 A;  5ILM A;  3DHT B;  1MNI A;  2HCO A;  2Z85 A;  4IT8 A;  1QSH B;  1N9I A;  1YEU B;  1CQX A;  2H8F A;  2VYW A;  3BRP A;  1O1M A;  3PI8 A;  4PNJ A;  2V8A A;  1O1N B;  5EQM A;  1BZ1 B;  2O5Q X;  3PI2 A;  2C7K A;  3MYN A;  1A00 B;  1Y4V B;  1VRE A;  2ZS0 D;  1MCY A;  2HBE B;  2O5O X;  1OFJ A;  5CN7 A;  3NFE B;  1Y7G B;  1Y7D B;  5ILE A;  1CMY A;  1S69 A;  1O1J A;  4NK1 A;  2EVP A;  3G4Q A;  1Y5F A;  3KMF C;  4MXK A;  1VXA A;  3E4N A;  4H0M B;  2MYD A;  3FH9 B;  1N9H A;  1HAC B;  3WCT A;  4FH6 A;  4H0M A;  1NXF A;  2DKC A;  4HSW A;  1GCV A;  3G4W A;  3OZV A;  2ZLV A;  3CY5 B;  1A0Z A;  2GLN A;  4OF9 A;  1BUW B;  2C7L B;  3DR9 A;  1CH2 A;  2VRY A;  3EU1 B;  5AQD A;  1LFY A;  3UH6 A;  1UFP A;  1BZZ A;  2MGM A;  1I7Y A;  6HBI A;  1XZV A;  4HHB B;  1HBB A;  2AV3 A;  5B13 A;  4NS2 A;  4ROM B;  1C40 A;  1Y0T A;  1B86 A;  1COH A;  1S5Y B;  5JDO C;  2UUL D;  1LJW B;  3QM7 A;  3CIU B;  2MBW A;  3R0G A;  1LFT B;  4WJG A;  3BOM A;  5HLQ A;  2MGK A;  1XZ2 B;  3ZJH A;  3PI8 B;  3D17 B;  4MXL A;  1GDK A;  3ED9 A;  2M6Z A;  2HBS A;  2LH5 A;  1XZU A;  1YEQ B;  1YDZ A;  1MLM A;  1UMO A;  2AA1 B;  5EYJ A;  2WTG A;  1VWT B;  1GBU B;  1LFZ A;  4N7N A;  4F6F A;  1MTI A;  3UGZ A;  5C6E A;  1XQ5 A;  1CG5 A;  1V4U A;  4PO5 A;  3ZOL A;  4NK2 A;  4WCH D;  1N9X A;  2GDM A;  4ODC B;  1ASH A;  4HRT B;  2VHB A;  1ECA A;  5E29 B;  1DXU B;  1WMU A;  3VRF B;  3A5A A;  2V1G A;  1Y4B B;  3GDJ A;  1GH0 A;  4ESU A;  4SDH A;  2V1K A;  3MWN A;  1YHE A;  1A9W E;  1G08 B;  1FCS A;  4H2L A;  1IT2 A;  1DO4 A;  1UFJ A;  2G14 A;  2ZLU A;  3K9Z A;  5CNC A;  4XXI A;  3ZJO A;  1YVT A;  1YEV A;  1DKE B;  2W6V A;  4N6S A;  2SPL A;  2AA1 A;  1YMA A;  3OK5 A;  3TM9 A;  1EWA A;  1ECN A;  1NS9 A;  3G52 A;  1MNJ A;  1MYH A;  2FRK X;  1MBN A;  5SW7 B;  4TYX A;  1S56 A;  4VHB A;  1H97 A;  1J7W A;  3ECZ A;  3WCV C;  2XKH A;  1Y4F A;  4UUR A;  2QRW A;  3GOU A;  1LHT A;  3LB4 A;  1S0H A;  1YEO A;  1NS9 B;  3M3B A;  3LB2 A;  1NEJ B;  1QPW B;  3VHB A;  1KN1 B;  4RMP B;  111M A;  2FAL A;  1DTM A;  3OJ1 A;  4MU5 A;  2VML A;  2ZS1 B;  2MGH A;  3ASE A;  5CHR A;  3RJN B;  3UH3 A;  3WHM B;  1YE0 B;  1Y35 B;  1Y8W A;  1HBH B;  1FSX B;  1Y31 A;  3AQ7 A;  3GQP A;  2ZT0 A;  1K0Y B;  1DXT A;  3CY5 A;  2HBF A;  1DWT A;  1DXV A;  2O58 X;  1HBR B;  1MYT A;  3W4U B;  2UUN A;  3HEP A;  1A01 B;  3MJU B;  5EUI B;  109M A;  4XS0 A;  3S66 A;  1A9W A;  2MGI A;  1YEV B;  1Y22 B;  3UHZ A;  2GTL A;  1MWB A;  3WCV B;  3PI4 A;  1YVQ A;  2CMM A;  2G0Z A;  1RPS B;  5CNB A;  4LMS B;  2MGJ A;  3UHH A;  1UIW A;  1YDZ B;  3UI0 A;  1Y7G A;  3HHB A;  4X0L B;  1FLP A;  3S65 A;  1OR6 A;  4ODC A;  3B75 B;  3QJB B;  4AE0 A;  4PO5 B;  2C7K B;  1F0L A;  1AJH A;  4N7O B;  2BNL A;  1GBU A;  5EE4 D;  5KKK A;  3D4X A;  3M3A A;  3G4U A;  2B7H A;  1RQ3 A;  1HBA A;  1MBS A;  5AQD M;  1G09 B;  1YEU A;  2YSK A;  1CPC B;  1XZ5 B;  3UGY A;  5CN6 A;  2LH6 A;  1FDH A;  1XF6 C;  1XZ5 A;  2VYZ A;  4LPI A;  2QSS A;  1Y8H A;  3A0G B;  4MQG A;  4G51 B;  1JZL A;  2B7H B;  105M A;  1HGB A;  1C40 B;  1Y0T B;  3OGB A;  2MGA A;  1Y0A A;  1CBM A;  1PBX B;  1OBM A;  2VEB A;  4MBN A;  3SDN A;  3HEO A;  1V4X A;  5HU6 A;  1Y5J A;  3HEN A;  1UVY A;  1MLF A;  3FEW X;  5CHQ A;  4C44 A;  1C7D B;  4NI1 A;  1HDA A;  1XY0 B;  2HHD A;  102M A;  1UIW B;  1HV4 A;  3LQD A;  1JW8 A;  1EBT A;  1A0U A;  2ZLX B;  4KMW A;  2HBD B;  1NS6 A;  4YU4 B;  1S61 A;  4NXA A;  2WCR A;  3UHC A;  3GYS B;  4A8W A;  2O5L X;  4NI1 B;  5CMV A;  2QSP A;  1QXD A;  2MGL A;  1MLL A;  2AV0 A;  1NGK A;  2HBF B;  5ILP A;  1K0Y A;  4GZG A;  1A00 A;  4GY3 B;  1THB A;  1Y5J B;  1HLB A;  3A5B A;  3O7N A;  4LMX B;  1F99 A;  2H35 B;  1YE2 B;  1MBC A;  2OH8 A;  3PI9 B;  2HCO B;  2I88 A;  1RSE A;  1S5X B;  1Y0A B;  1IRC A;  3GKT A;  5E6E B;  2Z6N A;  2G0V A;  3ONZ A;  2D2N A;  1YCA A;  4ERV A;  1O1M B;  2D6C A;  1LTW A;  1R1X B;  2OLP A;  1X9F B;  1R1Y A;  4HH0 A;  1A6K A;  1SI4 A;  1JZM A;  112M A;  3MVC A;  1K1K A;  3UH7 A;  1HBA B;  1UVK A;  1CBL A;  5D5R A;  1V4W B;  1MDN A;  1G0B A;  1XZ4 B;  2NRL A;  1HBI A;  2DN3 A;  3PI1 A;  1RQ4 B;  4FWZ A;  1Y5K B;  3OZW A;  1HCO B;  3UHN A;  1HLM A;  3B75 A;  2O5S X;  4GXE B;  5KDQ A;  1O1P A;  3A5G A;  1SDK A;  2DHB A;  2Z6T A;  4FC3 A;  1VXD A;  3HHB B;  3WCW A;  3E5O A;  3ZJR A;  4ESA A;  1UX8 A;  1JP8 A;  2HZ1 A;  1JL7 A;  3V2V A;  4YU4 A;  1MLG A;  2ZLX A;  1J7S A;  5EE4 C;  3DHR A;  2W72 B;  4HRT A;  3TM3 A;  2BMM A;  2G0S A;  4ZVA A;  5AZQ A;  1MYJ A;  4O4Z A;  1F5O A;  3D1A B;  1Y22 A;  1J52 A;  4F6B A;  1MLQ A;  1MOA A;  1HBR A;  107M A;  1DXV B;  3WCV D;  2ZT3 A;  1IBE B;  2ZSP A;  1BAB B;  3WFW A;  2ZSO A;  2GTL C;  1FSX A;  3KUN A;  1MNO A;  3OZU A;  2ZS1 A;  1J7Y B;  4A8Q A;  1Y01 B;  3WHM A;  1DM1 A;  3VRG A;  3UBV A;  1MLN A;  1YGF B;  1LFQ A;  3OO5 B;  1CG8 B;  1LFT A;  4A8M P;  3RGK A;  3RJ6 A;  4MQK A;  2GRF A;  4NI0 B;  3WCP B;  2ZLT A;  4PQC A;  4KMV A;  1ABW A;  2D2M C;  4ROM A;  4Z8K A;  1JF4 A;  2VLX A;  1HI0 P;  3WFX A;  1CH1 A;  4FWY A;  4MQJ B;  5HLU A;  3A59 B;  1TU9 A;  1B33 A;  3LB1 A;  1FSL A;  2ZLT B;  1Y83 A;  4ROL A;  1J40 A;  3QJE A;  1O1O B;  1XXT B;  2D2N C;  1YG5 B;  3BCQ A;  1YIH A;  2ZSZ A;  3E5I A;  1HGC B;  3G4Y A;  3OO4 B;  3P5Q A;  3VRE A;  4N6S B;  4F6G A;  3UHS A;  1ALL A;  4HRR B;  3D7O A;  1OJ6 A;  1YHE B;  4F0U B;  4MPM A;  1EYX B;  4H2L B;  3V58 A;  1MBO A;  1MBA A;  1Y7D A;  1BBB A;  1MZ0 A;  4F6D A;  4FC3 B;  4F4O A;  1YCB A;  2C7J A;  1CO9 A;  1YOH A;  1Y4V A;  3AT5 B;  1LFZ B;  2UUN B;  1MLK A;  1XZU B;  2RAO A;  1CPW A;  1Y4P A;  1QSI A;  1GJN A;  1Y31 B;  2R80 B;  1YHU A;  5KDQ B;  3KUO A;  2IG3 A;  1ECO A;  2R4Z A;  3D17 A;  1DUK A;  1PHN A;  4A8Y A;  3HYU B;  2OIF A;  3MN0 A;  1ABW B;  2D60 B;  3BJ3 A;  3O89 A;  3GOU B;  3ZJQ A;  1YZI B;  1G0B B;  3EDB A;  1MOB A;  3V57 B;  1U7S A;  1AJ9 A;  1XYE B;  1W92 A;  1SHR A;  2BV8 B;  1I7Y B;  1VXG A;  5F2A A;  1LFY B;  4HHB A;  1R1Y B;  1TES A;  4U8U C;  3HXN A;  5M3S A;  1GBV A;  1FAW B;  1DO1 A;  2QMB B;  2ZLV B;  2D2N B;  3UHW A;  3PT7 B;  4HSX A;  1Y4R B;  1BZP A;  4M4B A;  1BZR A;  5F0B A;  4DC7 A;  1DWS A;  2R50 A;  1A4F B;  2H35 A;  1Y4R A;  1F99 B;  2VJT A;  2AUR A;  5C6Y A;  1J7S B;  4MBA A;  3ARJ A;  4F69 A;  4A8F A;  2D2M B;  2BW9 M;  1Y45 A;  2GTL D;  1QXD B;  1J3F A;  1CLS A;  3D1K B;  3QJC A;  1V75 A;  1VXE A;  2DHB B;  1PMB A;  3GYS A;  3WCT C;  1J3Y B;  1HRM A;  5HU6 B;  1HHO B;  1HHT P;  1JF3 A;  1YOI A;  2VJT B;  1HV4 B;  2QFN A;  1MYI A;  1M6C A;  2ZS0 B;  4L2M A;  1Y0W B;  3IC2 A;  1C7D A;  1DLW A;  1Y8K B;  3G4V A;  1RH1 A;  2FAM A;  1SGK A;  1MLH A;  2ZSQ A;  1J3Z B;  4L1E B;  1NZ2 A;  4DWU A;  2QSS B;  1QSH A;  4KN3 A;  3NML A;  1G09 A;  2MGB A;  1A6G A;  1GZX B;  1VXF A;  1COH B;  4YU3 B;  2GNW A;  1O1K A;  1RTE A;  1LA6 B;  1YH9 A;  2GKN A;  3QZZ A;  5JDO D;  3FS4 B;  3BJ3 B;  1MLO A;  3AG0 A;  4NZI A;  1CPC A;  1OUT A;  1DDT A;  1YEN A;  1J41 A;  1RQA B;  1RQ3 B;  2X4A A;  1HDS B;  1VXC A;  3IA3 B;  3NL7 A;  1Y8K A;  1QXE A;  1B0B A;  3KMF A;  1JP6 A;  1MKO B;  2ZT2 A;  3P5Q B;  1MBI A;  3FH9 A;  3MOU A;  4O4T A;  3A9M A;  4MQI B;  3E55 A;  1Y0C A;  2C0K A;  1JEB B;  2MYE A;  1O1L A;  1BVC A;  1SPE A;  1Y2Z A;  3GIO A;  3D1K A;  5EUI A;  4WJG 1;  2GNV A;  4H0B A;  4BJA A;  5AB8 A;  2MB5 A;  4MAX A;  2PEG A;  2D2M A;  1DXT B;  4ZVB A;  1MNK A;  1Y8W B;  1M6M A;  3ZJM A;  2ZT1 A;  106M A;  2J96 A;  4C0N A;  1ABY B;  2LH1 A;  2UUM X;  3NG6 A;  4U8U A;  1JL6 A;  3VRE B;  1Y4Q A;  1BIJ A;  5E83 B;  4MQC A;  4FWX A;  1MWD A;  1Y85 B;  3MJU A;  3BJ2 B;  1RVW B;  3GUQ A;  5E83 A;  1HGB B;  3BCQ B;  2YRS B;  1YG5 A;  1Y4G A;  2QMB A;  1B8D A;  1FN3 A;  3GQP B;  2BLJ M;  1KD2 A;  5CNG A;  1MDT A;  1YE0 A;  1MWC A;  3QM9 A;  1IBE A;  5B85 A;  2VML B;  1YIE A;  4ZIZ B;  1YOG A;  2D2N D;  1Y7Z A;  3M38 A;  3NMM A;  1HGA A;  1KN1 A;  3IC0 A;  3ZOM A;  1CP5 A;  2H8D B;  2W31 A;  3ODQ A;  3IXF A;  4ILZ A;  2VYY A;  2QFK A;  1VXH A;  3HRW A;  1LHS A;  1DXD A;  1Y4F B;  1SPG B;  2HHB A;  3PMD A;  1HI8 A;  1YVT B;  2AUO A;  3ZJI A;  3NUH B;  1O1I B;  3U3E A;  2GKM A;  5SW7 A;  1F5P A;  3UHY A;  3G4R A;  3UHQ A;  2EB9 A;  4O1T A;  1Y4P B;  1JBO B;  1EBC A;  2JLF A;  1GH0 B;  1L2K A;  1HDB A;  2AUP A;  1C7C A;  4Q70 B;  4M4A A;  2FRI X;  2JL9 A;  1MGN A;  3VRF A;  1NPF A;  1CH4 A;  1LFL A;  3H57 A;  1X9F D;  1NPG A;  2ZLU B;  1LFL B;  1HGA B;  5KER B;  3S66 B;  1FDH G;  2SPO A;  2XYK A;  4N8T A;  2DN2 B;  1BBB B;  2JHO A;  3UHD A;  1SI4 B;  1C7C B;  5B84 A;  1YEQ A;  1UC3 A;  1LIA A;  3PIA A;  1CP0 A;  4HRR A;  1JY7 A;  3AT6 B;  1ALL B;  2RI4 B;  1XZ7 A;  3L0F B;  1R1X A;  1SDK B;  1GDJ A;  2YRS A;  1QGW C;  1V4U B;  1VRF A;  1XZ2 A;  3BJ2 A;  1GLI A;  1JDO A;  1S5X A;  1CIK A;  2MHB B;  1O1O A;  2ZST A;  3WCU C;  1XCH A;  1S0H B;  1S5Y A;  1YEO B;  2EF2 A;  2ZLW B;  3A59 A;  1V07 A;  2QU0 B;  5CN8 A;  5MBA A;  1O16 A;  2ZSS A;  4IRO A;  1LH5 A;  3RQR A;  1KTP A;  1LJW A;  1HAB A;  1IWH A;  3O18 A;  1JEB A;  3WR1 B;  3WFT A;  2HBD A;  1MYG A;  1Y8I A;  1CG8 A;  1A0U B;  2PGH A;  4G1B A;  3K8B A;  1CH7 A;  4MQC B;  1MTJ A;  1Y7C B;  1ABY A;  1A3N B;  2ZFO A;  1J7Y A;  1LH6 A;  2WTH A;  1O1J B;  3ZJL A;  1GDL A;  1RQA A;  1G08 A;  2O5M X;  3SZK B;  3WI8 A;  2FRJ X;  1FAW A;  3HXN B;  3WCW C;  1Y2Z B;  2LH2 A;  2SPM A;  3TLD A;  1DXU A;  3K8B B;  5JDO E;  1O1K B;  3KVS A;  4DWT A;  1AJ9 B;  1XYE A;  3V57 A;  3LHB A;  1ABS A;  3O18 B;  1Y8H B;  3A0G A;  4MQG B;  1HSY A;  1ON7 B;  1UVJ A;  3GQG A;  2DN1 A;  3HYU A;  5CN5 A;  3NL7 B;  1A6N A;  5CNE A;  3DBJ A;  3LQ9 A;  4KJT A;  3UHK A;  1YEN B;  2UUL H;  1AZI A;  2R80 A;  1QSI B;  2D5X B;  3UHB A;  1RQ4 A;  4AE1 A;  2R1H A;  4N7O A;  2D5X A;  2V8A B;  1V4W A;  1URY A;  1IOP A;  2ZS0 C;  1J3Y A;  4G1V A;  3DBJ B;  103M A;  3BRP B;  3ORD A;  3R5I B;  1M9P B;  1UVN A;  1V75 B;  1Z8U B;  1MBD A;  2G10 A;  3QJC B;  1LH3 A;  4HBI A;  1MYF A;  1CO8 A;  1N9F A;  3G53 A;  3SZK A;  1ON7 A;  1J3Z A;  4L1E A;  3DHT A;  3V58 B;  2G12 A;  1I3D A;  4XXK A;  1AJG A;  2W6W A;  1A4F A;  1GCV B;  1SWM A;  3KVS B;  1MLR A;  3WCV A;  1HA7 B;  1Y0W A;  1CIO A;  4F0T A;  1COL A;  1A87 A;  3OO4 A;  3VAU A;  4M4A B;  1C7B A;  1Y46 A;  1URV A;  3PT7 A;  2VJH B;  2ZS1 D;  2MGD A;  1H1X A;  1THB B;  3W4U A;  4L7Y B;  4AVD A;  3QQQ A;  1S6A A;  5EYS A;  5JDO F;  4ROL B;  2Z8A A;  1B33 B;  3WCU A;  4NXC A;  1A3N A;  1SHR B;  1G9V B;  1Y7C A;  2LH3 A;  1DTI A;  4N7P A;  1DLY A;  2ZFB B;  7HBI A;  1Y8I B;  1OUU B;  3LQD B;  1YVQ B;  2MGC A;  1BZ1 A;  1HJT A;  2O5B X;  3IC0 B;  1G0A B;  4MQH B;  2W6Y A;  1J7W B;  1GCW A;  1YFF B;  3G46 A;  4PQ6 A;  1V4X B;  1JP9 A;  2DXM A;  1XZ7 B;  2HBC B;  1MLS A;  1MNH A;  1X46 A;  1BZ6 A;  1NY9 A;  1RTX A;  3QM8 A;  1Y85 A;  4A8S A;  2OHB A;  4MQH A;  3PI3 A;  1LUE A;  1SDL A;  4F68 A;  2C7J B;  3VNC A;  3MKB A;  4JAC A;  2ZT4 A;  4F4O B;  5JOM A;  1OUU A;  3QJD B;  5HY8 A;  4O2G A;  3PEL A;  1PHN B;  3QZX A;  2UUL A;  4B3W A;  3WCU B;  3OVU C;  1JWN A;  4N8T B;  1WMU B;  2MYC A;  3S1I A;  1VHB A;  1LFV B;  1O1P B;  3UHI A;  2D5Z B;  3MJP A;  5EU2 A;  1D8U A;  1OFK A;  1V5H A;  1NWI A;  4F6J A;  2WY4 A;  1YHU D;  3LB3 A;  3UHR A;  3AT5 A;  1GVH A;  1MKO A;  1CQ2 A;  2HBS B;  3ODQ B;  4QAU A;  1NAZ A;  2ZSX A;  1MOD A;  1IRD A;  3O2C B;  2ZS1 C;  1O1I A;  3HC9 A;  1J41 B;  4ZIZ A;  2HBG A;  5HY8 B;  1Y4B A;  1RPS A;  3BOM B;  1FHJ A;  1SPG A;  1EYX A;  1T1N B;  1YHR B;  3EDA A;  2G3H A;  1TOX A;  1Y09 B;  3GQR B;  5E29 A;  3FS4 A;  1YH9 B;  2WCQ A;  3A2G A;  2D2M D;  2DKD A;  2H8D A;  6HBW A;  1LFQ B;  3OO5 A;  3WFU A;  1MTK A;  4A8O A;  1HGC A;  2QLS B;  3PT8 A;  3LR7 A;  1A3O A;  1Y4Q B;  1Y7Z B;  1VWT A;  2R1H B;  1NQP B;  1XXT A;  2EKU A;  2HBC A;  1HHS A;  4U8U D;  3DUT B;  1Y83 B;  3DUT A;  2C7L A;  1CH5 A;  4A8K A;  2ZSY A;  3UHV A;  1A0Z B;  4F6I A;  1B8D B;  3PMC A;  3ECX A;  1A3O B;  2W6X A;  1KR7 A;  3PT8 B;  3BJ1 A;  2QSP B;  2QLS A;  1QPW A;  1I3E A;  2ZS0 A;  4Z8K B;  1G0A A;  1U7R A;  3GK9 A;  1HHO A;  4H07 A;  1FHJ B;  3QM5 A;  4N7P B;  2XKG A;  1CMY B;  2V1H A;  5D1V A;  1OR4 A;  1XDT T;  2PEG B;  3VRG B;  1XG0 C;  2OHA A;  2MGG A;  3S48 C;  1HDA B;  1XY0 A;  1CLS B;  1BZ0 A;  3EOK B;  3NFE A;  3UBC A;  4JYQ A;  1HDS A;  3ZTA A;  3WCT D;  1Q1F A;  2HBE A;  4L7Y A;  1HCO A;  1BAB A;  4TMA B;  2E2Y A;  1C7B B;  1Y46 B;  1YMC A;  1BIN A;  5CN9 A;  4HH1 A;  2UUM A;  4MQI A;  104M A;  2ZFO B;  5ILR A;  1HA7 A;  4XDI A;  1PBX A;  4F0T B;  3MJP B;  2LHB A;  1XZ4 A;  2UUN D;  1LA6 A;  2PGH B;  2R4Y A;  1UVI A;  3AQ8 A;  4UIQ A;  3ZJN A;  101M A;  5EV5 A;  1NWN A;  3PEL B;  5JGG A;  1X9F A;  1MOH A;  4ESA B;  2VLZ A;  2V1E A;  2HHE A;  1KFR A;  2MYB A;  3R5I A;  2VJR B;  4IRO B;  4GXE A;  1QI8 A;  2BKM A;  1F65 A;  2EB8 A;  2Z6N B;  1MYZ A;  1CG5 B;  5E6E A;  5C6E B;  1DO7 A;  4YU3 A;  4N7N B;  2Z6S A;  3GKV B;  3WTG B;  3AQ6 A;  2R4W A;  4PQB A;  2D60 A;  1GZX A;  1YE2 A;  3PI9 A;  4TWV A;  2VM0 A;  2NX0 A;  2SPN A;  3GKV A;  3WTG A;  2M6Z B;  4GY3 A;  1NZ4 A;  1EMY A;  2DXM B;  1GLI B;  1IT3 A;  2JLG A;  2BLH A;  4BJU A;  1QI8 B;  1K1K B;  2GRH A;  1GCW B;  1YHU B;  2VJR A;  3L0F A;  1JY7 B;  1ITH A;  5JGG B;  2V1I A;  1LH2 A;  5HLX A;  3GQG B;  3QQR A;  5IKS A;  3AQ9 A;  4LM6 B;  3HF4 B;  2ZFB A;  1YHU C;  1CII A;  1DUO A;  4UZV A;  1BJE A;  1LH7 A;  4B4Y A;  1DWR A;  1G9V A;  1VXB A;  3K3U A;  1BZZ B;  4M4B B;  2BWH A;  5B13 G;  3ECL A;  3S1J A;  3EU1 A;  2VLY A;  2MYA A;  3UHG A;  1DXC A;  3M39 A;  1Y45 B;  5AZR A;  1JBO A;  3D7O B;  4F0U A;  1Y0D B;  3UHT A;  1GBV B;  2IN4 A;  2DKA A;  1YGD A;  1HI1 A;  2BV8 A;  5FVB A;  4ERT A;  1NS6 B;  4G51 A;  4O35 A;  1ECD A;  3QJE B;  4DC8 A;  3HF4 A;  1KTP B;  2R4X A;  3WR1 A;  2V1F A;  1HAB B;  1IDR A;  4MQJ A;  2ZFO C;  2W72 C;  1M9P A;  1HBG A;  2QU0 A;  3MYM A;  2NRM A;  2BK9 A;  5CND A;  3WCP A;  1YZI A;  4NI0 A;  2GL3 A;  1UVL A;  2RAO B;  2MHB A;  108M A;  1NQP A;  2EKT A;  1Y4G B;  5EOH A;  2X49 A;  1RVW A;  1YGF A;  6HBW B;  3ARK A;  3BJ1 B;  3V2Z A;  2MGF A;  3NG6 B;  4U8U B;  3BA2 A;  1X3K A; 
#chains in the Genus database with same CATH homology
 1V9Q A;  4X0L A;  3S65 B;  3ZHW A;  3PIA B;  2DN1 B;  2HHE B;  3AT6 A;  2DN2 A;  3GDJ B;  5KER A;  1IRD B;  1UVX A;  2HZ2 A;  4AVE A;  3H58 A;  2GRZ A;  2W72 A;  3D4X B;  1O1L B;  1X9F C;  3ARL A;  1T1N A;  1YHR A;  1HBS B;  4TWU A;  2EVK A;  1HDB B;  2D5Z A;  1NZ3 A;  2KSC A;  3QJB A;  1HBH A;  3ZJS A;  3QMA A;  1LFV A;  2DC3 A;  1Y35 A;  4FH7 A;  3EOK A;  3ZJP A;  1BZ0 B;  3SDH A;  2XKI A;  1JPB A;  3GLN A;  5CN4 A;  1MYM A;  1YIH B;  2ZSR A;  2NSS A;  1NEJ A;  2HHB B;  3MBA A;  3CIU A;  3WCW D;  1J40 B;  3WCU D;  1IWH B;  2NSR A;  4MQK B;  2GTL B;  1SDL B;  1B86 B;  1YMB A;  1CH3 A;  4XS0 B;  1NIH B;  1YIE B;  1A01 A;  1LH1 A;  3NMM B;  1BVD A;  1UX9 A;  1XZV B;  3QM6 A;  3LR9 A;  1WLA A;  1KD2 B;  4OOD A;  2ZLW A;  1FN3 B;  1UT0 A;  1WVP A;  3UHX A;  3MKB B;  1BUW A;  2G11 A;  2ZFO D;  3ONZ B;  1YFF A;  2MGE A;  1BIJ B;  5HBI A;  3IC2 B;  3UHE A;  3D1A A;  1HAC A;  3WCT B;  1CH9 A;  2ZWJ A;  2ZSN A;  1Y09 A;  3GQR A;  1Y5F B;  2RI4 A;  1Y0D A;  1NZ5 A;  2AUQ A;  2G0X A;  2HZ3 A;  1NIH A;  3WCW B;  110M A;  2G0R A;  2VEE A;  3DHR B;  5EET A;  2FRF A;  5MBN A;  1Y0C B;  3AQ5 A;  2HHD B;  1DKE A;  2W6V B;  1QXE B;  1YGD B;  2OH9 A;  5CNF A;  1O1N A;  3ZJJ A;  1JZK A;  5HAV A;  1GDI A;  1MLU A;  1A6M A;  3ZH0 A;  1OUT B;  2H8F B;  1F63 A;  1Y5K A;  1MLJ A;  3UHU A;  1HBS A;  3HRW B;  2BLI A;  1EW6 A;  3QJD A;  1DO3 A;  1MOC A;  2DN3 B;  2V1J A;  2LH7 A;  1HBB B;  1XQ5 B;  2O5T X;  3UH5 A;  5ILM A;  3DHT B;  1MNI A;  2HCO A;  2Z85 A;  4IT8 A;  1QSH B;  1N9I A;  1YEU B;  1CQX A;  2H8F A;  2VYW A;  1O1M A;  3PI8 A;  4PNJ A;  1O1N B;  5EQM A;  1BZ1 B;  2O5Q X;  3PI2 A;  3MYN A;  1A00 B;  1Y4V B;  1VRE A;  2ZS0 D;  1MCY A;  2HBE B;  2O5O X;  1OFJ A;  5CN7 A;  3NFE B;  1Y7G B;  1Y7D B;  5ILE A;  1CMY A;  1S69 A;  1O1J A;  4NK1 A;  2EVP A;  3G4Q A;  1Y5F A;  3KMF C;  4MXK A;  1VXA A;  3E4N A;  2MYD A;  3FH9 B;  1N9H A;  1HAC B;  3WCT A;  4FH6 A;  1NXF A;  4HSW A;  1GCV A;  3G4W A;  3OZV A;  2ZLV A;  3CY5 B;  1A0Z A;  2GLN A;  4OF9 A;  1BUW B;  3DR9 A;  1CH2 A;  2VRY A;  3EU1 B;  1LFY A;  3UH6 A;  1UFP A;  1BZZ A;  2MGM A;  6HBI A;  1XZV A;  4HHB B;  1HBB A;  2AV3 A;  4NS2 A;  4ROM B;  1C40 A;  1Y0T A;  1B86 A;  1COH A;  1S5Y B;  5JDO C;  1LJW B;  3QM7 A;  3CIU B;  2MBW A;  3R0G A;  1LFT B;  4WJG A;  3BOM A;  5HLQ A;  2MGK A;  1XZ2 B;  3ZJH A;  3PI8 B;  3D17 B;  4MXL A;  1GDK A;  3ED9 A;  2M6Z A;  2HBS A;  2LH5 A;  1XZU A;  1YEQ B;  1YDZ A;  1MLM A;  1UMO A;  2AA1 B;  5EYJ A;  2WTG A;  1VWT B;  1GBU B;  1LFZ A;  4N7N A;  4F6F A;  1MTI A;  3UGZ A;  5C6E A;  1XQ5 A;  1CG5 A;  1V4U A;  3ZOL A;  4NK2 A;  4WCH D;  1N9X A;  2GDM A;  4ODC B;  1ASH A;  4HRT B;  2VHB A;  1ECA A;  5E29 B;  1DXU B;  1WMU A;  3VRF B;  3A5A A;  2V1G A;  1Y4B B;  3GDJ A;  4SDH A;  2V1K A;  1YHE A;  1A9W E;  1G08 B;  1FCS A;  4H2L A;  1IT2 A;  1DO4 A;  1UFJ A;  2G14 A;  2ZLU A;  3K9Z A;  5CNC A;  3ZJO A;  1YVT A;  1YEV A;  1DKE B;  2W6V A;  2SPL A;  2AA1 A;  1YMA A;  3OK5 A;  3TM9 A;  1EWA A;  1ECN A;  1NS9 A;  3G52 A;  1MNJ A;  1MYH A;  2FRK X;  1MBN A;  5SW7 B;  4TYX A;  1S56 A;  4VHB A;  1H97 A;  1J7W A;  3ECZ A;  3WCV C;  2XKH A;  1Y4F A;  4UUR A;  2QRW A;  3GOU A;  1LHT A;  3LB4 A;  1S0H A;  1YEO A;  1NS9 B;  3M3B A;  3LB2 A;  1NEJ B;  1QPW B;  3VHB A;  111M A;  2FAL A;  1DTM A;  3OJ1 A;  4MU5 A;  2ZS1 B;  2MGH A;  3ASE A;  5CHR A;  3RJN B;  3UH3 A;  3WHM B;  1YE0 B;  1Y35 B;  1Y8W A;  1HBH B;  1FSX B;  1Y31 A;  3AQ7 A;  3GQP A;  2ZT0 A;  1K0Y B;  1DXT A;  3CY5 A;  2HBF A;  1DWT A;  1DXV A;  2O58 X;  1HBR B;  1MYT A;  3W4U B;  3HEP A;  1A01 B;  3MJU B;  5EUI B;  109M A;  4XS0 A;  3S66 A;  1A9W A;  2MGI A;  1YEV B;  1Y22 B;  3UHZ A;  2GTL A;  1MWB A;  3WCV B;  3PI4 A;  1YVQ A;  2CMM A;  2G0Z A;  1RPS B;  5CNB A;  2MGJ A;  3UHH A;  1UIW A;  1YDZ B;  3UI0 A;  1Y7G A;  3HHB A;  3S65 A;  1FLP A;  4X0L B;  1OR6 A;  4ODC A;  3B75 B;  3QJB B;  1AJH A;  4N7O B;  2BNL A;  1GBU A;  5EE4 D;  5KKK A;  3D4X A;  3M3A A;  3G4U A;  2B7H A;  1RQ3 A;  1HBA A;  1MBS A;  1G09 B;  1YEU A;  1XZ5 B;  3UGY A;  5CN6 A;  2LH6 A;  1FDH A;  1XZ5 A;  2VYZ A;  4LPI A;  2QSS A;  1Y8H A;  3A0G B;  4MQG A;  4G51 B;  1JZL A;  2B7H B;  105M A;  1HGB A;  1C40 B;  1Y0T B;  3OGB A;  2MGA A;  1Y0A A;  1CBM A;  1PBX B;  1OBM A;  2VEB A;  4MBN A;  3SDN A;  3HEO A;  1V4X A;  5HU6 A;  1Y5J A;  3HEN A;  1UVY A;  1MLF A;  5CHQ A;  4C44 A;  1C7D B;  4NI1 A;  1HDA A;  1XY0 B;  2HHD A;  102M A;  1UIW B;  1HV4 A;  3LQD A;  1JW8 A;  1EBT A;  1A0U A;  2ZLX B;  4KMW A;  2HBD B;  1NS6 A;  4YU4 B;  1S61 A;  4NXA A;  3UHC A;  3GYS B;  2O5L X;  4NI1 B;  5CMV A;  2QSP A;  1QXD A;  2MGL A;  1MLL A;  2AV0 A;  1NGK A;  2HBF B;  5ILP A;  1K0Y A;  4GZG A;  1A00 A;  1THB A;  1Y5J B;  1HLB A;  3A5B A;  3O7N A;  2H35 B;  1YE2 B;  1MBC A;  2OH8 A;  3PI9 B;  2HCO B;  1RSE A;  1S5X B;  1Y0A B;  1IRC A;  3GKT A;  5E6E B;  2Z6N A;  2G0V A;  3ONZ A;  2D2N A;  1YCA A;  1O1M B;  2D6C A;  1LTW A;  1R1X B;  2OLP A;  1X9F B;  1R1Y A;  1A6K A;  1SI4 A;  1JZM A;  112M A;  3MVC A;  1K1K A;  3UH7 A;  1HBA B;  1CBL A;  5D5R A;  1V4W B;  1MDN A;  1G0B A;  1XZ4 B;  2NRL A;  1HBI A;  2DN3 A;  3PI1 A;  1RQ4 B;  4FWZ A;  1Y5K B;  3OZW A;  1HCO B;  3UHN A;  1HLM A;  3B75 A;  2O5S X;  5KDQ A;  1O1P A;  3A5G A;  1SDK A;  2DHB A;  2Z6T A;  4FC3 A;  1VXD A;  3HHB B;  3WCW A;  3E5O A;  3ZJR A;  4ESA A;  1UX8 A;  1JP8 A;  2HZ1 A;  1JL7 A;  3V2V A;  4YU4 A;  1MLG A;  2ZLX A;  5EE4 C;  1J7S A;  3DHR A;  2W72 B;  4HRT A;  3TM3 A;  2BMM A;  2G0S A;  4ZVA A;  5AZQ A;  1MYJ A;  4O4Z A;  1F5O A;  3D1A B;  1Y22 A;  1J52 A;  4F6B A;  1MLQ A;  1MOA A;  1HBR A;  107M A;  1DXV B;  3WCV D;  2ZT3 A;  1IBE B;  2ZSP A;  1BAB B;  3WFW A;  2ZSO A;  2GTL C;  1FSX A;  3KUN A;  1MNO A;  3OZU A;  2ZS1 A;  1J7Y B;  1Y01 B;  3WHM A;  1DM1 A;  3VRG A;  3UBV A;  1MLN A;  1YGF B;  1LFQ A;  3OO5 B;  1CG8 B;  1LFT A;  3RGK A;  3RJ6 A;  4MQK A;  2GRF A;  4NI0 B;  3WCP B;  2ZLT A;  4PQC A;  4KMV A;  1ABW A;  2D2M C;  4ROM A;  1JF4 A;  2VLX A;  3WFX A;  1CH1 A;  4FWY A;  4MQJ B;  5HLU A;  3A59 B;  1TU9 A;  3LB1 A;  1FSL A;  2ZLT B;  1Y83 A;  4ROL A;  1J40 A;  3QJE A;  1O1O B;  1XXT B;  2D2N C;  1YG5 B;  3BCQ A;  1YIH A;  2ZSZ A;  3E5I A;  1HGC B;  3G4Y A;  3OO4 B;  3P5Q A;  3VRE A;  4F6G A;  3UHS A;  4HRR B;  3D7O A;  1OJ6 A;  1YHE B;  4MPM A;  4H2L B;  1MBO A;  1MBA A;  1Y7D A;  1BBB A;  1MZ0 A;  4F6D A;  4FC3 B;  4F4O A;  1YCB A;  1CO9 A;  1YOH A;  1Y4V A;  3AT5 B;  1LFZ B;  1MLK A;  1XZU B;  2RAO A;  1CPW A;  1Y4P A;  1QSI A;  1GJN A;  1Y31 B;  2R80 B;  1YHU A;  5KDQ B;  3KUO A;  2IG3 A;  1ECO A;  2R4Z A;  3D17 A;  1DUK A;  3HYU B;  2OIF A;  3MN0 A;  1ABW B;  2D60 B;  3BJ3 A;  3O89 A;  3GOU B;  3ZJQ A;  1YZI B;  1G0B B;  3EDB A;  1MOB A;  1U7S A;  1AJ9 A;  1XYE B;  1W92 A;  1SHR A;  1VXG A;  5F2A A;  1LFY B;  4HHB A;  1R1Y B;  1TES A;  4U8U C;  3HXN A;  5M3S A;  1GBV A;  1FAW B;  1DO1 A;  2QMB B;  2ZLV B;  2D2N B;  3UHW A;  3PT7 B;  4HSX A;  1Y4R B;  1BZP A;  4M4B A;  1BZR A;  5F0B A;  4DC7 A;  1DWS A;  2R50 A;  1A4F B;  2H35 A;  1Y4R A;  2AUR A;  5C6Y A;  1J7S B;  4MBA A;  3ARJ A;  4F69 A;  2D2M B;  2BW9 M;  1Y45 A;  2GTL D;  1QXD B;  1J3F A;  1CLS A;  3D1K B;  3QJC A;  1V75 A;  1VXE A;  2DHB B;  1PMB A;  3GYS A;  3WCT C;  1J3Y B;  1HRM A;  5HU6 B;  1HHO B;  1JF3 A;  1YOI A;  1HV4 B;  2QFN A;  1MYI A;  1M6C A;  2ZS0 B;  4L2M A;  1Y0W B;  3IC2 A;  1C7D A;  1DLW A;  1Y8K B;  3G4V A;  2FAM A;  1MLH A;  2ZSQ A;  1J3Z B;  4DWU A;  1NZ2 A;  2QSS B;  1QSH A;  4KN3 A;  3NML A;  1G09 A;  2MGB A;  1A6G A;  1GZX B;  1VXF A;  1COH B;  4YU3 B;  2GNW A;  1O1K A;  1RTE A;  1LA6 B;  1YH9 A;  2GKN A;  3QZZ A;  5JDO D;  3FS4 B;  3BJ3 B;  1MLO A;  3AG0 A;  4NZI A;  1OUT A;  1YEN A;  1J41 A;  1RQA B;  1RQ3 B;  1HDS B;  1VXC A;  3IA3 B;  3NL7 A;  1Y8K A;  1QXE A;  1B0B A;  3KMF A;  1JP6 A;  1MKO B;  2ZT2 A;  3P5Q B;  1MBI A;  3FH9 A;  3MOU A;  4O4T A;  3A9M A;  4MQI B;  3E55 A;  1Y0C A;  2C0K A;  1JEB B;  2MYE A;  1O1L A;  1BVC A;  1SPE A;  1Y2Z A;  3D1K A;  5EUI A;  4WJG 1;  2GNV A;  4H0B A;  4BJA A;  5AB8 A;  2MB5 A;  4MAX A;  2PEG A;  2D2M A;  1DXT B;  4ZVB A;  1MNK A;  1Y8W B;  1M6M A;  3ZJM A;  2ZT1 A;  106M A;  4C0N A;  1ABY B;  2LH1 A;  3NG6 A;  4U8U A;  1JL6 A;  3VRE B;  1Y4Q A;  1BIJ A;  5E83 B;  4MQC A;  4FWX A;  1MWD A;  1Y85 B;  3MJU A;  3BJ2 B;  1RVW B;  5E83 A;  1HGB B;  3BCQ B;  2YRS B;  1YG5 A;  1Y4G A;  2QMB A;  1FN3 A;  3GQP B;  2BLJ M;  1KD2 A;  5CNG A;  1YE0 A;  1MWC A;  3QM9 A;  1IBE A;  5B85 A;  1YIE A;  1YOG A;  2D2N D;  1Y7Z A;  3M38 A;  3NMM A;  1HGA A;  3IC0 A;  3ZOM A;  1CP5 A;  2H8D B;  2W31 A;  3ODQ A;  3IXF A;  4ILZ A;  2VYY A;  2QFK A;  1VXH A;  3HRW A;  1LHS A;  1DXD A;  1Y4F B;  1SPG B;  2HHB A;  1YVT B;  2AUO A;  3ZJI A;  1O1I B;  3U3E A;  2GKM A;  5SW7 A;  1F5P A;  3UHY A;  3G4R A;  3UHQ A;  2EB9 A;  4O1T A;  1Y4P B;  1EBC A;  1L2K A;  1HDB A;  2AUP A;  1C7C A;  4M4A A;  2FRI X;  3VRF A;  1MGN A;  1NPF A;  1CH4 A;  1LFL A;  3H57 A;  1X9F D;  1NPG A;  2ZLU B;  1LFL B;  1HGA B;  5KER B;  3S66 B;  1FDH G;  2SPO A;  2XYK A;  4N8T A;  2DN2 B;  1BBB B;  2JHO A;  3UHD A;  1SI4 B;  1C7C B;  5B84 A;  1YEQ A;  1UC3 A;  3PIA A;  1CP0 A;  4HRR A;  1JY7 A;  3AT6 B;  2RI4 B;  1XZ7 A;  1R1X A;  1SDK B;  1GDJ A;  2YRS A;  1V4U B;  1VRF A;  1XZ2 A;  3BJ2 A;  1GLI A;  1JDO A;  1S5X A;  1CIK A;  2MHB B;  1O1O A;  2ZST A;  3WCU C;  1XCH A;  1S0H B;  1S5Y A;  1YEO B;  2EF2 A;  2ZLW B;  3A59 A;  1V07 A;  2QU0 B;  5CN8 A;  5MBA A;  1O16 A;  2ZSS A;  4IRO A;  1LH5 A;  1LJW A;  1HAB A;  1IWH A;  1JEB A;  3WR1 B;  3WFT A;  2HBD A;  1MYG A;  1Y8I A;  1CG8 A;  1A0U B;  2PGH A;  4G1B A;  3K8B A;  1CH7 A;  4MQC B;  1MTJ A;  1Y7C B;  1ABY A;  1A3N B;  2ZFO A;  1J7Y A;  1LH6 A;  2WTH A;  1O1J B;  3ZJL A;  1GDL A;  1RQA A;  1G08 A;  2O5M X;  3SZK B;  3WI8 A;  2FRJ X;  1FAW A;  3HXN B;  3WCW C;  1Y2Z B;  2LH2 A;  2SPM A;  3TLD A;  1DXU A;  3K8B B;  5JDO E;  1O1K B;  4DWT A;  1AJ9 B;  1XYE A;  3LHB A;  1ABS A;  1Y8H B;  3A0G A;  4MQG B;  1HSY A;  3GQG A;  2DN1 A;  3HYU A;  5CN5 A;  3NL7 B;  1A6N A;  5CNE A;  4KJT A;  3UHK A;  1YEN B;  1AZI A;  2R80 A;  1QSI B;  2D5X B;  3UHB A;  1RQ4 A;  2R1H A;  4N7O A;  2D5X A;  1V4W A;  1URY A;  1IOP A;  2ZS0 C;  1J3Y A;  4G1V A;  103M A;  3ORD A;  3R5I B;  1M9P B;  1V75 B;  1Z8U B;  1MBD A;  2G10 A;  3QJC B;  1LH3 A;  4HBI A;  1MYF A;  1CO8 A;  1N9F A;  3G53 A;  3SZK A;  1J3Z A;  3DHT A;  2G12 A;  1I3D A;  1AJG A;  2W6W A;  1A4F A;  1GCV B;  1SWM A;  1MLR A;  3WCV A;  1Y0W A;  1CIO A;  3OO4 A;  3VAU A;  4M4A B;  1C7B A;  1Y46 A;  1URV A;  3PT7 A;  2ZS1 D;  2MGD A;  1H1X A;  1THB B;  3W4U A;  4L7Y B;  4AVD A;  3QQQ A;  1S6A A;  5EYS A;  5JDO F;  4ROL B;  2Z8A A;  3WCU A;  4NXC A;  1A3N A;  1SHR B;  1G9V B;  1Y7C A;  2LH3 A;  1DTI A;  4N7P A;  1DLY A;  2ZFB B;  7HBI A;  1Y8I B;  1OUU B;  3LQD B;  1YVQ B;  2MGC A;  1BZ1 A;  1HJT A;  2O5B X;  3IC0 B;  1G0A B;  4MQH B;  2W6Y A;  1J7W B;  1GCW A;  1YFF B;  3G46 A;  4PQ6 A;  1V4X B;  1JP9 A;  2DXM A;  1XZ7 B;  2HBC B;  1MLS A;  1MNH A;  1X46 A;  1BZ6 A;  1RTX A;  3QM8 A;  1Y85 A;  2OHB A;  4MQH A;  3PI3 A;  1LUE A;  1SDL A;  4F68 A;  3MKB A;  4JAC A;  2ZT4 A;  4F4O B;  5JOM A;  1OUU A;  3QJD B;  5HY8 A;  4O2G A;  3PEL A;  3QZX A;  4B3W A;  3WCU B;  3OVU C;  1JWN A;  4N8T B;  1WMU B;  2MYC A;  3S1I A;  1VHB A;  1LFV B;  1O1P B;  3UHI A;  2D5Z B;  3MJP A;  5EU2 A;  1D8U A;  1OFK A;  1V5H A;  1NWI A;  4F6J A;  2WY4 A;  1YHU D;  3LB3 A;  3UHR A;  3AT5 A;  1GVH A;  1MKO A;  1CQ2 A;  2HBS B;  3ODQ B;  4QAU A;  1NAZ A;  2ZSX A;  1MOD A;  1IRD A;  2ZS1 C;  1O1I A;  3HC9 A;  1J41 B;  2HBG A;  5HY8 B;  1Y4B A;  1RPS A;  3BOM B;  1FHJ A;  1SPG A;  1T1N B;  1YHR B;  3EDA A;  2G3H A;  1Y09 B;  3GQR B;  5E29 A;  3FS4 A;  1YH9 B;  3A2G A;  2D2M D;  2H8D A;  6HBW A;  1LFQ B;  3OO5 A;  3WFU A;  1MTK A;  1HGC A;  2QLS B;  3PT8 A;  3LR7 A;  1A3O A;  1Y4Q B;  1Y7Z B;  1VWT A;  2R1H B;  1NQP B;  1XXT A;  2EKU A;  2HBC A;  4U8U D;  3DUT B;  1Y83 B;  3DUT A;  1CH5 A;  2ZSY A;  3UHV A;  1A0Z B;  4F6I A;  3ECX A;  1A3O B;  2W6X A;  1KR7 A;  3PT8 B;  3BJ1 A;  2QSP B;  2QLS A;  1QPW A;  1I3E A;  2ZS0 A;  1G0A A;  1U7R A;  3GK9 A;  1HHO A;  4H07 A;  1FHJ B;  3QM5 A;  4N7P B;  2XKG A;  1CMY B;  2V1H A;  5D1V A;  1OR4 A;  2PEG B;  3VRG B;  2OHA A;  2MGG A;  3S48 C;  1HDA B;  1XY0 A;  1CLS B;  1BZ0 A;  3EOK B;  3NFE A;  3UBC A;  4JYQ A;  1HDS A;  3WCT D;  1Q1F A;  2HBE A;  4L7Y A;  1HCO A;  1BAB A;  2E2Y A;  1C7B B;  1Y46 B;  1YMC A;  1BIN A;  5CN9 A;  4MQI A;  104M A;  2ZFO B;  5ILR A;  4XDI A;  1PBX A;  3MJP B;  2LHB A;  1XZ4 A;  1LA6 A;  2PGH B;  2R4Y A;  3AQ8 A;  4UIQ A;  3ZJN A;  101M A;  5EV5 A;  1NWN A;  3PEL B;  5JGG A;  1X9F A;  1MOH A;  4ESA B;  2VLZ A;  2V1E A;  2HHE A;  1KFR A;  2MYB A;  3R5I A;  4IRO B;  1QI8 A;  2BKM A;  1F65 A;  2EB8 A;  2Z6N B;  1MYZ A;  1CG5 B;  5E6E A;  5C6E B;  1DO7 A;  4YU3 A;  4N7N B;  2Z6S A;  3GKV B;  3WTG B;  3AQ6 A;  2R4W A;  4PQB A;  2D60 A;  1GZX A;  1YE2 A;  3PI9 A;  4TWV A;  2VM0 A;  2NX0 A;  2SPN A;  3GKV A;  3WTG A;  2M6Z B;  1NZ4 A;  1EMY A;  2DXM B;  1GLI B;  1IT3 A;  2BLH A;  1QI8 B;  1K1K B;  2GRH A;  1GCW B;  1YHU B;  1JY7 B;  1ITH A;  5JGG B;  2V1I A;  1LH2 A;  5HLX A;  3GQG B;  3QQR A;  5IKS A;  3AQ9 A;  3HF4 B;  2ZFB A;  1YHU C;  4UZV A;  1DUO A;  1BJE A;  1LH7 A;  4B4Y A;  1DWR A;  1G9V A;  1VXB A;  3K3U A;  1BZZ B;  4M4B B;  2BWH A;  3ECL A;  3S1J A;  3EU1 A;  2VLY A;  2MYA A;  3UHG A;  1DXC A;  3M39 A;  1Y45 B;  5AZR A;  3D7O B;  1Y0D B;  3UHT A;  1GBV B;  2IN4 A;  1YGD A;  1NS6 B;  4G51 A;  4O35 A;  1ECD A;  3QJE B;  4DC8 A;  3HF4 A;  2R4X A;  3WR1 A;  2V1F A;  1HAB B;  1IDR A;  4MQJ A;  2ZFO C;  2W72 C;  1M9P A;  1HBG A;  2QU0 A;  3MYM A;  2NRM A;  2BK9 A;  5CND A;  3WCP A;  1YZI A;  4NI0 A;  2GL3 A;  2RAO B;  2MHB A;  108M A;  1NQP A;  2EKT A;  1Y4G B;  5EOH A;  1RVW A;  1YGF A;  6HBW B;  3ARK A;  3BJ1 B;  3V2Z A;  2MGF A;  3NG6 B;  4U8U B;  3BA2 A;  1X3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...