1V55B

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v55B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v55B02
2XV3A 2B3IA 2GI0A 3ABKB 3SBRA 1JVOA 1JXGA 2IDUA 1AS6A 3WNIA 1ZPUA 2XV2A 3EH4B 2DWTA 2TSBA 4HZ1A 3OMIB 2CBPA 3FSZA 7PAZA 2ZOOA 3FQ2A 5B1JA 4E9YA 1ETJA 2AZAA 4AI7A 1AR1B 1PZAA 4GY4A 3U25A 3WKPA 1YLBB 1NINA 1JZIA 1JVLA 3SBQA 1IC0A 3NP3A 3PPSA 4HCIA 2MRYA 1SNRA 5FC9A 2BWDA 3X1NA 1BYPA 1WS8A 4YSSA 3OD3A 4BWWA 4YSUA 5B7MA 1XB8A 3KW8A 2UXVA 3EH5B 3NJJA 1JXDA 6PAZA 1B3IA 3KW7A 3NJIA 2IWKA 2GC7C 1XMEB 2FWLB 1A65A 2AVFA 4K9JA 2PPAA 3ABGA 1BQKA 4WKXA 4PCYA 3AW5A 2OJ1A 1RKRA 2FTAA 2JFCA 1ILSA 4YSPA 2PPDA 3FSVA 2HRHA 1DYZA 1E5ZA 3NJGA 1J5CA 3FQ1A 1I53A 2BZCA 3ZX1A 3T9WA 4G7SB 1OE1A 1KCWA 1PNCA 3IEAA 3NJHA 5I26A 3UABA 2HX8A 4A67A 1E30A 4AKPA 1ASQA 1AZBA 3PLYA 1GS6X 2XWZA 1CURA 2YAEA 1OE3A 6PCYA 1ID2A 2JXMA 1ADWA 1V55B 2NRDA 3IBOA 4DPAX 3S3BB 4BWUA 4W9ZA 4YSAA 4M4RB 3MX0B 3NSFA 2XUWA 5I6LA 2BO0A 3RYMA 2YXVA 5ANHA 1FA4A 3NJFA 4DP7X 4DP0X 3PAVA 2OCCB 1HAUA 2FQEA 1PLBA 4ENZA 1EZLA 1OF0A 1SDDB 4NERA 1N70A 5AFAA 5I5IA 3TASA 2YARA 5A7EA 1A4BA 3S8FB 2FNWA 1ASOA 1PCSA 5B1KA 1OOWA 2BP0B 2R7EA 2YAQA 4BXSV 3T6ZA 7PCYA 3ZDWA 5AZUA 3SQRA 1PF3A 2XU9A 1M9WA 2MTAA 1NPJA 3CZUB 2P80A 1M56B 2DYRB 4Q8BA 2QPEB 3AG3B 2J56A 1PMYA 4JHVA 4A2DA 1A8ZA 4YSOA 3NT0A 2YXWA 4DP4X 1PLAA 4G70B 3CVDA 1AS8A 5E9NA 3OM3B 5AKRA 3S3DB 3ABMB 2HRGA 2FT6A 2WSDA 2X88A 2PCYA 1J9SA 1E65A 4RH4A 4GXFA 4DP2X 1J9TA 2CAKA 1TEGA 1JZHA 3AG2B 1T5KA 3NJNA 2ZXWB 1PLCA 2HXAA 1MDAA 4YSRA 4KO9A 1IBZA 2VSKB 1J5DA 1WA0X 1OE2A 2BW4A 3DKHA 1SHWA 3ERXA 3FT0A 1AZRA 2UX6A 3QJTB 2XXGA 4BWTA 4WTQA 4P5SA 2PLTA 3HEIB 1QNIA 2FJSA 1BXUA 3FU8A 3MBWB 2UX7A 1W8EA 3UADA 2OV0A 1NIBA 1WAEA 4G72B 1W6LA 1GY2A 3ZIYA 5I5JA 2BP8A 3BQVA 3DIVA 3UAEA 1A4CA 1WA1X 2BZ7A 4Q89A 3TBBA 2BHFA 1OCOB 3S3CB 4E9TA 2J55A 2Q5BA 4HHWA 2YEVB 2VM4A 4KNTA 3ABLB 1NIAA 1AOZA 1N68A 1OCRB 5I6OA 2QT6A 3QJRB 5I28A 1HAWA 4NAJA 2XYBA 4DPCX 1TU2A 2HX7A 4HHGA 2CCWA 5D4IA 2FQDA 3EHBB 1AZCA 5F7AA 4DP8X 1CC3A 1CYWA 3JTBA 2IDFA 1RZQA 1BXVA 2GC4C 1OCCB 1SDDA 2IDTA 5TK2A 4HAKA 1KV7A 1SF5A 2FT7A 3PXLA 1KGYE 4BK5C 1AG0A 1V10A 1RZPA 1NIDA 3BVDB 1QLEB 3CVCA 1BYOA 2CUAA 2YAMA 5D4JA 4G71B 1IBYA 1JZEA 4KO6A 1A3ZA 1BQRA 1KDIA 4DP5X 3WNJA 4UF7C 1E67A 1E5YA 2I85A 2PPEA 2IH9A 1L9QA 5I5MA 1KCBA 2BW5A 1ILUA 3S8GB 4HCGA 1GYCA 4KO5A 4CSZA 2CALA 4GP4B 1HFUA 2E86A 2H47C 1L9OA 2DV6A 3V9EA 3G5WA 4AZUA 4CSPA 1BXAA 2XLLA 3L45A 3X1EA 1F56A 1GR7A 2VSMB 2PP9A 1JZGA 2QPDB 1ZIAA 3QJQB 3ZBMA 3D12B 1PNDA 3SBPA 4YSCA 3HB3B 2WO3B 4UAHA 3T6XA 4A2HA 1WS7A 3GYRA 2IAAC 1ZV2A 2CJ3A 3UACA 1AACA 2EIMB 1FFTB 2BWIA 4N8UA 4E9VA 1BAWA 2X87A 2GHZA 3FYIB 1QHQA 1OV8A 5I6KA 1EHKB 2UXFA 4HCFA 1ET5A 2PPFA 3QJUB 4YSTA 5I6NA 3PCYA 1ZDSA 1X9UA 3X2QB 1JERA 1CUOA 1MZYA 2IDSA 3NJMA 4GP8B 3FPYA 2AZUA 4FA7B 2XV0A 3JT2A 3AZUA 2IDQA 1SHXA 1URIA 4F2EA 4BDVB 3N55A 4P5RA 1SFHA 1UATA 2Q9OA 1BQ5A 2VM3A 1GS7A 4EF3A 2XX0A 4GP5B 2Y69B 3WKQA 4BXVA 1TEFA 5PAZA 4YSDA 4GYBA 5B1JC 4YVNA 4G7QB 2ZWNA 4DP9X 5B1BB 5EHFA 5I6MA 1J9QA 2HX9A 5PCYA 1ZIBA 4QLWA 1JZFA 2AANA 2GIMA 3FSWA 4KNUA 3DTUB 1OCZB 4YSQA 4X4KA 4QKTA 1NICA 3QQXA 2W88A 3T6WA 1GSKA 1NDTA 4A66A 1AG6A 2JKWA 3AY2A 3FSAA 2AFNA 2FT8A 3IN2A 2YQBA 4A2EA 2GBAA 2WO2B 3NJKA 3NYKA 5F7BA 2H3XC 1CYXA 3X1GA 4A2GA 5IY5B 2VN3A 3AG1B 4JHUA 5D4HA 3T71A 2TSAA 2YAHA 3CVBA 2YAPA 2QDWA 1M57B 2VW4A 4E9QA 1XB6A 2PCFA 1KBWA 4M3HA 2Y1AA 3FQYA 3FU7A 3OQRA 3FPXA 3FYEB 1ZDQA 2J5WA 2EINB 1ASPA 1AZNA 3QJVB 1NWPA 1BEXA 1AANA 4ZK8A 5TK4A 1AQ8A 2EIJB 1IKOP 4YSEA 2J57A 4MFHA 2IH8A 4F7KA 2H5UA 2P80D 1MG3C 4YVUA 2XXFA 2UXTA 5I6PA 2DYSB 3H56A 1VLXA 4W1TA 3X1BA 3PAUA 1PAZA 4N4YB 1NIEA 4E9SA 4YL4A 3UGEA 2I7OA 1L9PA 2DY2A 1KYAA 1JOIA 1KDJA 2IWEA 1PZCA 3FU9A 2VW7A 3TA4D 4F2FA 3ASOB 1AZUA 3C75A 4AX3A 1IUZA 1V54B 1W6WA 1A4AA 3IE9A 3UAAA 1KBVA 1RCYA 3WG7B 3T6VA 3AG4B 1SF3A 4E9RA 1SFDA 1JZJA 2FQGA 4A2FA 1X9RA 2FQFA 4G7RB 2N0MA 3H4HA 3NSDA 3NSCA 1PY0A 1R1CA 2YAOA 3WIAA 2PP7A 3ASNB 2UXGA 1JXFA 3EF4A 2DWSA 1AAJA 3FU7B 3OMNB 2W8CA 9PCYA 2LLNA 1L9SA 1XB3A 3OMAB 1L9TA 5B7EA 1AIZA 5LDUA 1FWXA 1MG2C 2YAFA 2VMJA 1NPNA 1GY1A 1GW0A 1J9RA 4KNSA 5B1AB 4E9WA 1WA2X 3CDZB 1ET8A 3PAZA 4PAZA 2IWFA 4L0PB 4AKOA 4DPBX 1GS8A 1SJMA 2GB2A 4KOCA 5B7FA 4E9XA 3WI9A 2A3TA 2EIKB 2I7SA 3NJLA 4JKNA 1NIFA 4DP1X 1NTDA 3NP4A 2B08A 2BP8B 3X1FA 1TKWA 4A68A 2PPCA 3FS9A 2BP0A 2R7EB 4KO7A 3QJSB 5B3SB 3V9CA 4HALA 2GSMB 4HIPA 1DZ0A 4TXVB 3NSYA 2HLEB 4DP6X 3TBCA 2EILB 3IN0A 4AKQA 3GDCA 3TU6A 4FAAB 8PAZA 3EH3B 2XVBA 3QPKA 3CDZA 1MZZA 2PP8A 3GXUB 1ET7A 1NZRA 2ZONA 2XX1A 2VW6A 4UANA 4BDVA 2RACA 4KOBA 3N2JA 1AS7A 1NWOA 3CG8A 1PZBA 2HZHA 2QDVA 1L9RA 3H4FA 4NB7A
chains in the Genus database with same CATH superfamily
3LXCA 3CMOL 3TN0D 4JDTL 2LFRA 1A4KB 2V9UA 3QIWB 2H8PA 1AS6A 1BEYL 1SVZA 1F3DH 3BEWB 1KIPA 2QMJA 3O4LA 1JNNL 4NDMB 3HG2A 5DRZA 5D2LE 3GVMA 2Z8SA 4D7TA 1WFOA 1I1FB 5C0CB 2OMUB 4FA8A 3ICXA 4H8PA 2X70A 4QRRD 4KUZL 3ROOB 4HUVA 5HVHC 3AQDA 2W6IG 3ZE1B 2CDEB 4QY8B 1JZ4A 3MUGB 4JZJA 5J9PB 3WENA 4N90D 4Q52A 3TESA 5AOJA 1XX9C 1BFVH 4XCYB 1HX0A 3OD4A 8FABB 2P24B 3VYPA 3G6AB 4MLSA 3ZS8C 4LFAB 3TT1H 3BA9A 1ZLSH 4RNRB 1CLZH 3GB7B 4JB9L 2AMGA 3KW7A 2XZCH 4APQB 1N6QL 4PA4A 2V2TB 1T7XA 4X8AA 3TN0A 4RFOH 2FWLB 1N6VA 2EEBA 1A6ZB 2C9VA 4TNFA 1U3HC 2YEVA 5I8KL 4EVNB 2XN0A 3VQLA 4JGSA 2PZSA 2YKLH 3Q2LA 2WKOA 1N34O 4HMEA 3C5ZD 5D5MA 4LEBA 1HHKA 3G04B 2IJIA 3IMSA 1O5DT 1ILSA 1PFCA 3MLUH 3M1BB 3NJGA 3SGKC 1HHJB 1P5UB 3AT9A 4LNRA 3K79A 1R24B 3LKSB 5IM7B 1CFTA 5F1NA 2P8MA 3WDHA 4MS2A 5F8QC 3WXVH 5BRZB 4RA3A 2HFEC 4ZBMA 2QKAA 2YUAA 1UOVA 3IEAA 1FS0G 5DLLA 3S5LB 4ABUA 1IM3B 1TT6A 2EIMC 5KJRH 4A67A 3FRUA 3UBXA 3THOA 1AZBA 3PLYA 3MDSA 1R73A 3B7YA 4AMXA 1CT8B 1ZAGA 1KYOF 3L7EB 1R3IC 4WENB 4X8JB 2R2BA 1YY9D 1YYLL 2D0FA 4QI3A 4UIMB 4KRPB 1CO1A 3LVTA 4KHTL 4F33B 2M7WA 1MSPA 2NY4D 1RY7B 3NJFA 4LQFL 1Q8IA 2OYPA 2D0GA 4ODUB 3QEHA 4JFYB 2XG5B 2Q3ZA 3CLFH 1EZLA 1E8WA 5ID1A 3L4XA 3SPIA 3KXFD 3RI5F 3MKKA 3BVVA 3EOAB 5H37G 4AMWA 1UA3A 3JD0A 3P11L 3D07A 4HQQH 2V3EA 1YY8A 5AAMA 2RQ8A 4P3CH 4MXWH 4OVVA 3T6ZA 5CP3A 3MMEA 1AI4A 3FB8A 4NQQA 3AGWA 4QCIB 4AYSA 2A6DA 4LDLB 3CDCA 4YJ3B 3MV8D 4YHLH 4TWKA 4X5WA 5CAYB 3NPSB 4NC1E 5IHHA 2IGFL 2PYEB 3TO2B 4A2DA 5LBSH 4CDHA 5ADPH 2BSSA 3IBEA 5JHLL 3CPUA 4MJJA 4G70B 4UOW0 3EJQA 5C0GB 1RM1C 5I30L 4U6HB 4XNYH 5AKRA 5C07B 5C9JB 3JCUZ 3EXJA 3HE7A 5FNVB 2NY0B 1OM3H 4PSPA 1WAAA 3BPNC 1MHHA 2E76B 4XR8C 2ICWA 4XMXA 4YDVB 5GGTH 2VDLB 3TIEB 3JD4A 4D7PA 1J9TA 4DO5A 4PREA 1OF2A 3TK1A 1J9CT 2W38A 2X6UA 4Y5XA 2L4OA 3KBEA 1I8UA 2FO4B 5TF1H 4HBNA 4G27B 1M2VB 3WJLA 1MH5B 1VJSA 1OTTC 3KPRB 1I8MA 1SQ2N 1DHKA 1E40A 1THZA 2J6WA 3FT0A 2K3TA 4X9YA 2NXZB 2X2UA 4R4FH 1YYML 1AQMA 5EZLB 1EXHA 2YGQA 4WCEV 3W39B 4OFDA 2ZP8A 2IH3C 3MUZ1 1GTNA 2WLJA 3KPOA 4K9EH 1XGPA 3ALPA 1LR1A 1MRDL 3KL0A 1HXKA 2B0SL 5G4OA 4NQCB 1J5IA 3JD1A 4F7CA 1ETZA 1IC4L 3CSXA 2G3ZA 2LHAA 3MOAL 4FFZH 2YBRB 2H32H 2DL2A 1GY2A 2IQAB 2Q7YB 1W0WB 3F6LA 1JXJA 3ZMNA 2IBBA 1AI6A 2Q9LA 2Q76A 2FJGB 4OD1L 3UH8A 2GEEA 5E9DE 1ZGLA 4M61B 5HVWA 4EI0A 2J55A 3LZLA 2FEEI 2YEVB 1SXCA 1W72L 3ZE0B 4B7LA 3ZX6A 5ACZB 3WIHH 2EO9A 2JJWA 4RMTA 4TVPL 3UJIL 3I6SA 1NKRA 3STLC 2Q5ZA 2K1EA 1I8KA 2CK2A 2WIMA 2ZX6A 1DCEA 5D4IA 2WXFA 4M43H 3D0VB 4YXWG 3CSTA 3DPDA 2AW2A 2OTUA 4B27A 1QX1A 1QEWA 1X7QA 2QV4A 5KSBA 4N2LA 1Q9WB 3FB5A 1N26A 3VXUE 1EXUA 1KV7A 1U8LB 3GSUB 4MQXC 4QTIH 5F7EL 3FXIC 1OLZA 4ONGL 4ZMAT 4K7PL 1R3LC 1QLEB 4N2NA 1QVOB 5D2NB 4RISH 3QORC 1IBMO 3L2NA 4HJSA 2BCKA 4IOSA 1SETA 4DP5X 3WNJA 1OAUL 2JJVA 2QTVA 4OJDH 3H7BB 4NQXA 3N27A 2KC0A 4YMPA 1AY1L 1TTFA 5DWUL 1TTGA 4PWIA 5JW4Q 1DGSA 4YHML 2KT6A 4HGWB 4WO0A 1VADB 1VFOA 3TURA 4WHYH 1MCRA 4PJXA 5KS9B 2Q0OC 2HVJB 2R23B 2ZCHL 3LEYL 4LLYB 5IQMA 1T03H 4EEQA 2E6PA 2CPCA 3B9DA 4DGVL 1G84A 5EH1A 5JDSB 1D6EB 1BXAA 5JZ7D 1NSNL 1IEBB 1R3HA 4TUJA 4I2XA 1FG2A 4AGQA 4KV5E 4XXCC 3HKBA 3C08H 1ZIAA 4ICWA 2NZIA 3X11A 1WLEA 1TF4A 3SBPA 1U95A 3NEEA 4C56B 5CD3B 4PA7A 1JI2A 1U8QA 2QFRA 4ZX4A 2DL9A 1XR9A 1HH6B 4WV1C 5DUBB 4M1CC 9CGTA 4TRPH 3JALA 3D25A 3NZ8B 3IGLA 3Q2NA 2WSPA 1UURA 4P5TC 3OKDB 3RWEB 2NY4B 1IT9H 3BP6A 3H9HB 1G7IB 4P4KA 3KYOA 1KXQA 3QUMB 3ZZQA 3EDFA 4GKNB 3SPVB 2C34A 4RQFA 4I89A 3RYFA 2PPFA 3QJUB 1BS3A 5DJCA 1T22B 3WTWA 5C0BB 1J5EB 3VD1A 3NJMA 1G1XB 3F05A 1GJUA 3PUUA 4QRRE 3PDDA 1FGNH 3OTOO 2JB5H 4TOYL 1PZ5B 3QI9A 5DS8B 4F9LA 2G3MA 3S88L 4PJEA 1J1OH 2CH7B 1C5DB 4DW1A 5CHNB 3MV01 4Y1AD 1KKDA 4Y4KB 2AJSL 1NVPB 3TV3L 1N18A 1B6DA 2VM3A 5E95B 1G9NC 1OZTG 3UTQB 4F7MA 5H6RA 3EJRA 3L4UA 2B4CH 4GP5B 1HNWO 3O9WC 2YGNA 3SDDA 1KXQE 5B1JC 1NGZB 1NDGB 1SJVA 2XQ0A 2Y7QB 2Z7WA 4KY1H 3STBA 5BJTA 1XI1A 2FYUH 1N8OE 2X41A 3G6JA 2ENPA 3K80A 1UZ8B 3OAZK 4KK9D 5DLMH 4BW9A 4LLWA 5BVJA 2LU7A 4FLUA 3V0VB 3BABA 3CFJB 3FSWA 1WD8A 3FSOA 1D5IL 4JZOA 5E2VH 3JALB 2J6EH 4JPRA 1INQA 3D25B 4RFOL 3ZMEA 2GTSA 2K9PA 3OZLA 4KKBC 1JBJA 3EO0B 4Y89A 1BJ8A 2WO4A 4WFFA 4P2QE 3TNNB 5FF6A 5I8KH 5DEDA 5LGNA 4HJIA 1A3RH 3ZW3A 1GKEA 4P9ML 1HC1A 4BFKA 5F7BA 3AG4C 4QE9A 2ILLA 5BVPL 2Y22A 4M4RA 2AAAA 5KX5A 2BNRA 4HLJA 3RHWF 4XH2B 3BZ5A 4IRJB 3NSJA 4JY5L 3ZRFC 2YC1B 3WHE0 1N5YL 2Q8AL 4YC2C 3BYYA 2LR4A 1PIFA 4F8OA 3Q2VA 3VXRD 1JGEB 1SXZA 2RMNA 5F9WC 1CL7I 3WFCL 4PDLA 1KGIA 3ALWA 4MCMA 4AVHA 3KD4A 3N43B 1V05A 4N21A 5HDWA 5IK3B 15C8L 1P84K 4FCAA 2VZTA 2ICWJ 5DHYA 2QFPA 3TC9A 4MA3A 5IVZA 2ZIDA 1CB4A 3IT8D 4TUKL 2KBGA 4DVBA 1YEEH 4GT7A 5L4MA 1OAYL 3FO9B 1QTPA 3IXAB 4XMPL 4DR5B 1M71A 2BE3A 1G7MB 1NANH 1ZXKA 3C12A 3S97C 1YN7A 1GGBH 2GUZA 3X13A 2A4ZA 2BNRE 3HC3H 4HIJA 3T1WA 2BRRL 2WA3A 3DETC 4LHUB 3UBXI 1QVFU 2GJ6D 1S7UA 1KWGA 3V0EA 4FNSA 2QSAA 5E2WH 3RE0A 4JRXD 4UDUB 4PJ5D 2X44D 5EOTB 1WVZA 3ABUA 3AS2A 2GJRA 4J1UA 4RDQG 3R8BB 2FX9H 5IHBA 3WN5A 1J05B 1YEKL 2G4EA 4K3JL 2XWXA 1TZGH 5J3HC 5I1JL 5DJDA 1U8CB 4X5QA 4LLMA 5ELIA 4X7TA 3EFDL 3QEUB 5AB0A 1MI5A 4OZHA 3KMDA 4KP4A 4CBCA 2Z91B 4EXKA 1PM9A 2Z64C 1SM3H 4APQC 1NFDE 4XN9A 1K5SA 3OMNB 1JWSA 3TH2T 2O26U 2Q2EB 5E6RB 5I9QB 3S4SG 2FGWL 4U1HA 1FLTX 3SOTA 1Z5HA 4RGNB 3S7GA 2Q7EA 4AEIL 1FWXA 3OHXC 1T1XB 4KH9A 3T2OA 5ISZE 1B4LA 4XMLH 4FHBD 4HAMA 2Y2YA 4MNHB 2YS8A 5EU5B 4ZBJA 1JNLL 2DZEA 5IJ0B 3D39B 3GSQA 2DQUL 5FYJE 4X50A 3MO1B 4R8WL 1EDHA 4NC1C 1E8YA 3ULAB 4IMKC 1KIUA 3H2WA 5IMLB 3AB0B 2F7RA 5GS0H 2R9HD 5GGSA 4O9HL 3KLHC 5DRWB 3V6ZA 1JDAA 1MI5E 3ET9F 1IC5H 3HG1D 3PRZA 4JFSA 4B0MB 2B08A 1RZKH 2P49B 5HGHA 3IGKA 2A9DA 1AHKA 3WTYA 5AUMB 2HSIA 5DQDH 3EADA 1RK1A 3QJSB 1A0QH 1DJWA 3SPVA 2XQBH 4W9GC 4PJBB 2UU9O 3V9CA 2Q7HA 3N1PC 4JAMB 1IJ9A 1ACXA 1KC5L 4MXQD 4XMUA 3US9A 2VSCA 4PS7A 1U4EA 3RTQB 3TU6A 3LRMA 1ZANL 1LP9E 4CDGC 1T89C 5JIDA 1BZ9B 1ET7A 4R97B 1XEUA 3CFDB 3K2MC 1RUPH 2W5PA 2ATAA 4F7TA 5F2VO 1KXVC 1ZTXL 2BSBA 1B9KA 1X5IA 3QS3A 4AW7A 3BWZA 4Y2LA 5HXMA 1JUFB 4B41A 1K73W 4UT7H 5KHHA 3R06B 5HJ3A 5KTEL 3IKCB 1YEHH 1BFOA 4FQPA 1VMGA 4Q58C 1ZLEA 4O4HB 3Q8AA 1I7TB 2WP3T 4C4UA 4KPHL 5HJBA 3RWRD 3DXRB 2WWMD 4DKFL 1BD2E 2IG2H 2X28A 2YUXA 4PJXB 4XMVA 5KS9A 4QRPE 3TS8A 1SJEA 3WNIA 1YJDC 3G6BA 4OIAA 5E2UL 1AKJB 2FYYA 4O02L 1KGJA 3UBXG 4B3EA 4Y19D 4DZBA 2PGGA 2CMRL 5IE9A 4GSRA 4XWOD 5B1JA 1FVEA 2NQ3A 3EBAA 1PZAA 3KPNA 3MJ6A 4QGYA 2QVTA 3PWPE 2XRAH 4KK5D 1N0LB 1X44A 3VFRA 1IGIH 4PDRA 2I26N 4WWKB 3RGBA 2K8MA 1FE8L 3PPSA 3X1NA 2F68X 3HS0C 3REVB 3V0WL 4NXNB 1WS8A 1Z3GL 2QEJA 1WITA 2WXJA 1D6VL 1MWOA 2BHZA 4N28A 4NCC1 4TTDC 3EH5B 3MV9B 5H4YA 2G4GA 1RZ8B 1T0OA 3P4LA 1S3JA 3QS2A 2Q8BH 2YXHA 1X5YA 2AXHA 2V37A 2EEDA 3KYMB 2IAMB 5FLUA 5FGBC 3S35H 1X7QB 4AQAA 1H2NA 2AVFA 5EUOA 4ZI7A 2SEBA 5HHVL 4J9ZB 1VACB 2Y2TA 2MPAH 3PYCA 5D7KD 4UFZA 3Q44A 1JZ3A 1KPRB 4X99B 2KDGA 1IE4A 5FKPB 3D4CA 2NY6D 3K0YA 4LSRH 2I60L 1VFUA 3UYRL 5JJNB 1G1KA 3B77A 5C0AE 3CFEA 3MLXL 1SRYA 4PWJA 4XXCA 1MAML 1TZIA 3BEVA 3ZDZE 2X9ZA 4U3CA 4PJ9D 3PIQB 1IX2A 4OF5A 1H5BA 3MODL 2M83A 4O4IB 1HZHH 1LO2H 3GLDA 4HUXA 4Z7UA 5CU5A 1U8OB 5I26A 4DKDC 4BCYA 2XN9E 5AW4B 5KANI 3FB6B 3H42L 2OS7A 3ZMVA 5EC1A 1BGYH 4FTVA 3M8AA 4QRQB 2G9HA 1IX9A 3KG5A 5L8JB 1A6VL 2GEQA 1K4DC 3HZVA 4PBXA 4Z7VF 5FB8B 4XRCA 2WKLA 4JF3A 4J2QA 2V7HA 3NGBB 4JFTA 4YUEL 4MJIA 1YDPA 1XNQO 4X5PA 5E6UB 2ZSWA 2FQEA 3GMNA 1QLFB 2AJSH 4V2CB 3V7MA 1DQJB 4NERA 2YARA 4PV8A 1M56C 1C7SA 4FQ2L 5DJ0A 1SJHA 5JJEB 5HYQB 4KITB 2KERA 4TQDA 2AJ3B 4OIIH 4F6RB 2VDMH 4PS8A 4PLKD 4H88L 1QR4A 1Z9PA 4Y9FA 3U7AA 4F8LA 4PD4F 3CLEH 3EF7A 1HNXO 4NO0B 5GPRA 1PY9A 3WO4B 3Q01A 2B20A 1NPJA 2CA4A 1DK1A 5GZOA 2HA1A 2W9DH 3HPJA 3UKMA 3K91A 3B43A 3BN9D 5FL7G 4OQTA 2FNBA 3NT0A 1GRJA 4PVLA 4A38A 4B3MO 3I3DA 3V0GA 1MEXH 4XCCH 1F8TH 1U3JA 4LF5O 3IJYB 2GBTA 3RZCB 3F62A 2EDOA 4GKZB 2NR6A 4NSKB 4TNWK 4J6RH 2FT6A 4L4TD 4F9PA 2P43B 1AO7A 4I5SA 4EKXA 4C59B 4L4TB 2WLYA 1WAZA 3PV6B 4FFWC 3K0DA 4OTXH 3RNKA 4NTXA 1EO8L 5FYJD 4DN4L 1O0VA 1HESA 3DA0A 4NNXA 4F2ME 1T5KA 5JZ7C 5JW5A 1VF7A 4MAUH 1D5ZA 2VB5A 4JY5H 4NJAL 1OAQH 4NOBA 4NQCD 5FM5M 5GTHZ 1HU8A 2FEJA 5IT2L 1D2DA 2MIZA 3QO1A 3I6LE 3BW9A 4UB0L 3DTXA 4HIHB 1J48A 4P06A 4Q4EA 3N44B 4ZW5A 2AEQH 3FRPA 3IDIA 3OKLB 4K15A 4KQ4H 2EXYD 1FZMB 4MKTA 3TXQA 1OM9A 3HVNA 2CK0H 4E41D 4ES8A 3MACH 2CDYA 2CM6A 5IEKB 4E0RA 4FG2A 2VZ3A 1WAEA 1U30A 4YN3A 3UM7A 5SWZA 3KR3H 3KDPB 2VQTA 4JHAH 1TQBC 4WJKB 5EBWB 1QA9B 5I19L 5L88L 3FT3A 4LOUD 2CIIA 2P8PB 2Z3FA 5GRUH 1GN6A 1JP5A 1R0AL 1MJ7L 1COBA 1CLVA 1Y6KR 2IFFH 2F58H 2NTFA 3OG6B 4U3HA 3L16A 4G6JH 4S1SH 5MERA 2AQ2A 5FA3A 4L18A 5I5RA 2VQEO 1K8IB 2HN7A 4LCUB 5ESQA 3TO4A 5JQGB 2HJKA 1X9LA 3MHHC 4N0RA 4P5MB 5DS1A 1HHKB 1Y6XA 3G04A 3ETDA 1EJ8A 2NY7L 3H7LA 4J3OG 4N5UA 1WICA 5AOZA 2NYYC 4FQCH 3WOVA 3E8UH 1H2GA 1Q72H 2D3JA 4NXMO 2GUOA 4X1YB 3C87A 3GTVA 4RQQB 4R5XA 4CVZA 3OAUL 1Q3EA 2OW7A 4PJCA 3II3A 5HGAB 5LBQA 35C8H 1NKDA 3V8OA 4O2EB 5DMYA 1NCAL 1SDDA 4FJCC 4X66O 5ERWA 2JKSA 4FNUA 1PEWA 5D1QD 3WDJA 5C0FB 1ZJBA 4OB5H 1ZHLB 1TZHB 3BFRA 5AW9B 2ZPKH 4FTVB 5IMMB 4HBCL 4I55B 4R90H 2CWRA 5DHDA 3VFGH 1JWMA 2GY7B 1X5GA 2DYPB 2HEPA 2FGWH 3SKJH 2X70B 1T7VA 3DECA 2ERJB 3B1TA 1CURA 3UT5A 1I1FA 5C0CA 2X42A 1KCBA 1ZTEA 2BW5A 4PRBA 1C1EH 1R3JC 1KBKA 4ZPTB 3KAAA 3IDUA 4AK2A 5DGQA 1W0JG 3V4PH 4HAFA 2QM7A 1HFUA 1DVTA 2BNQA 4NO5B 4HPYH 2NOYA 4MCYA 3QG5A 2I32A 2PWDA 1FVDB 1FJ1B 3FH7A 3NDYE 3RGVA 3PFQA 4HP5A 1UCTA 3VXMA 3VXUA 5J11B 4DR4B 3DV6B 1NEPA 1JPGA 3TZVC 2BLFA 1KCSL 3L45A 5CKAA 1K8IA 2HN7B 3QDJB 4LCUA 4X7FC 3MHZA 1OSPH 3K9SA 1CICA 3ZT6A 4TT3G 1M1XB 4NYLA 3U0TA 3HB3B 3U7YL 5IESH 3H3BC 5M95B 1HJCA 1WG3A 2ESVB 2EYTA 2WXGA 5DQDL 5EC1C 3MLRL 4I18B 2E7DA 4KGJA 3T6XA 1H2KA 3X3GH 4LASH 3BAXA 3REVA 4DN3L 2Q2LA 1TJHL 1ROWA 4EIZC 4YQXL 4Z3HA 5HPMB 4IM8A 3MROB 4DV0O 4MW8A 4MSWB 2NLJA 4BR6A 4LF7O 4KI5E 5HYJE 1GGCH 3IGUA 4Q56A 3VFSA 3QFJA 4Z0BL 2MNWA 5LCVL 5I9QC 2YWYA 3ZUCA 3RWDB 1M7XA 1U8OA 4JRWA 5CJ8A 3RZCD 4JREB 1EK3A 2P5WB 1TZHA 3WELA 3X2QB 5E79Z 1KEML 4X83A 1E90A 5C0IB 5DD3H 3V5DB 3DOSA 2GJZA 3CQPA 4P49A 4PG2A 4XN8A 2AZUA 5D70H 3U4EB 2MQCA 1JWUB 1T1ZB 4JRXA 3T2NH 1IZKA 1QSEE 3BUDA 2DIJA 3N40P 4J6IA 4HKXA 4L8SA 5FUOH 5T3XL 3ZHQA 4EN3A 4HKJB 5L8LB 4MVMA 4HJ0C 4P2QA 5IROD 1YNKL 1UGNA 1G6RH 1HHHA 2VAAA 3HG1B 3MGTB 4CRPA 4I9WA 3A4AA 4YDLC 5FS5A 2WOBA 4GCZA 4LSTH 4B9GA 4IYKA 4AYDC 2CJUL 1NGXB 2DWEB 2MOVA 5BY1A 1RUKH 1Q8MA 3BDXA 1MFNA 2WNKA 3KCYA 2VDQL 2W9EH 4B3TB 2FATH 2XA8L 5AYUL 1FPTL 3L1OL 4FLTA 3ZL4H 1ZIBA 2HMID 3LRLA 3SE4A 1T5WB 4XCFL 2A4EA 1ND0A 1E6OH 2QADC 2J88L 5B38G 4BZ1H 1ZE3H 3QQXA 5GGVY 4HV8A 4NQCE 4ZT1A 3S35L 2JJSA 3CDGB 5IVNA 3M7OA 1F41A 3EZJB 1KIUB 4OKDA 3UIYA 1QD0A 5IMLA 1ZS2A 2OSXA 1PG7W 3BW9B 3MV7E 3PXJA 2H3XC 3M1OA 4X8GA 3VFPB 3DJZA 2EH8H 3ARVA 1SERA 3ECUA 3ZKMC 3RDJA 1SGKA 4MJIB 1D5ZB 4E9QA 4IOIB 1IU1A 3G08A 4N9GB 2P48B 4QRPB 1EAPB 3LEVL 4MMZB 2OQJB 5FKAA 3F58L 2D2OA 4WTXA 5CEZD 4G6AD 4WGKA 3BHPA 5DRNA 2R69A 4HJ0D 5FYJH 4PVNA 1SMDA 3K04A 4RESB 5A3IC 3K74B 3MRIB 2RHEA 1S7VA 4S10A 3QBTB 4PJFE 3IDYC 4AC2A 3WNKA 4ANKA 1IKOP 5IK3A 3E9UA 1F51A 1OB0A 4K3EL 2J57A 3ZRWA 4P23D 3WLBB 1B6UA 4PRHE 1AQHA 2PI5A 2AEWA 4BZ1A 4PWKA 5CBHA 2DIBA 5D7JC 2FBJL 4Y4FD 4DR1B 3TJTA 2IAMC 3D5OF 3NIGE 4PGEB 5I6PA 4R26L 5F0JB 4CILA 5KVEE 5AZEH 5C8YA 1KUMA 4DK6A 3LN5A 5CCKH 4HWNA 1BFVL 4H8WH 4XZ4A 2X3AA 4DCQA 5LYJA 4GRWF 1WLHA 2V9RA 3V52L 4YDKH 4J11A 1CLZL 2VDML 2XZCL 4QTFA 1N6QH 1G6UA 4KTEH 3AWFA 3APQA 1QLFA 3D3VA 5F7UA 2G9KA 2M2DA 3KBFA 1NAKL 3C3SA 5A40E 3I6KB 3DK2A 4N5ED 4X1IB 3KLAB 5EYPA 5LBVA 3AG4B 3VA2C 1UA7A 2YSSA 4PG2C 5LP6B 5FO9B 3CIAA 1ZWIC 1Z7JA 4QOKE 3GMOA 5JORB 2R0WH 2G75A 2JWYA 1BDYA 3TCUA 5B8CB 1NU1H 3CCHB 3G5VA 2D31B 3P02A 2W59A 4GIPD 2BS8A 2RGSA 4XMTA 4IEFB 4WWKC 4WEEA 5FUZL 4ATWA 1D7CA 4H0IA 3BI9X 4OX9O 5SX5H 3WU2Z 3ARPA 3APDA 5KMGA 1IXBA 2OFQA 4NZFA 4OZHB 1EUTA 1OCWH 3FQNA 2D3VA 2NNUA 3FT2B 9PCYA 1GM9A 5G5DA 3OMAB 1Z66A 4O2AB 2AKRB 4XP5L 5TFSL 4WFGE 2ZKHL 2R4SL 3IU4L 4K3AA 2AK4D 1P4LB 2H7WA 2VMJA 2XDHA 4JDVA 4XVSH 1FORH 4ODWB 1WJ3A 2YPKB 2CO4A 4UB0H 5DHMC 4HWEH 3UAJA 5F9AC 2YGOA 2BVPA 2XXCB 4QHKI 3CCRV 1CL7H 2FL5B 4KK5C 2Z35B 3G9AB 3LTVA 4XODA 1SJMA 2F54A 1AR1C 2EIKB 2ZDIC 2UWEE 4IRSC 1EVTC 4JI2O 4QRSB 3ATEA 4U1IA 3CZKA 3QDGE 1QBZA 1UG9A 4Y4KD 4U3SA 4GUPB 4PY8I 3ZGHA 2BP0A 3CFJA 3LH8A 4X0NA 2AQRA 3VAEA 3OKEB 5GRUL 4G80A 5LGHH 3IYLW 5IJVA 1U8MA 3ZT5A 5D6DC 5IT9N 3SPJA 4TXVB 4W6WB 1N0NA 2F8IA 5AQ0A 1KENL 5K5YA 1QU7A 2WBXA 4CMHC 2EILB 4Q0XH 1XMQO 3WJJC 1FC1A 3CB2A 4M8RA 4MMZC 5DZLA 1WRFA 3C8KA 2ODHA 3M1CA 4EQ3A 4YJ2B 2Q3AA 4LVNB 3FK3A 5DT1L 5GS1C 3RDTB 3HIZA 3FKSG 2WVSA 4HU2A 2AP2A 5IB5A 3RU8L 5I1HH 3MNDA 1OM3L 5CZVL 4WO4B 5F93C 5IVXE 3BCCH 1HNZB 1I8AA 3N42B 2AJZB 1KJMA 2X09A 4XNUL 5DF0A 2NZ9C 1P5VA 1VARA 3KNBA 1OP5H 2NW3A 2OYKA 35C8L 1CFVL 1PZ5A 2VN5A 3NIDB 1T2QL 3BUYA 3SBRA 5A2CA 2L7JA 3FX7A 5TF1L 1XHXA 4E4EA 1XUQA 1XDTT 2IDUA 2JS5A 2JI3A 4TLUA 4MNQB 4R0LB 3LSQA 1SYSA 4JVUA 3ZKSD 2BSTB 2Z4TA 3TT3H 4HBQA 3SDXA 2XV2A 5C7ZA 3V6BR 2A1WH 2DWTA 4I1NB 4DQAA 4NQXB 4R90L 3VFGL 4PCTA 4U31A 2Z3YA 5AVUB 4WU5B 5SWQA 3O6MH 3QQ4B 4GMSL 3SY6A 3MREA 4HIHA 4OLZL 4I18A 1LEGA 4NC2B 3S4SB 2EYTB 4FKKA 5E8NA 4D9QE 4L0ZA 2QPUA 1S7XB 3E6FB 4B9PA 3AXHA 4JMNA 5AG9A 4YSSA 3OD3A 2AEPL 2Y7QA 5MHSD 4FHJA 5F9JB 5FUCE 2DQEL 4JZGA 3BH9B 4AM0B 5DFWH 2WIIB 4RRPM 6PAZA 4JG1H 5CMAB 1QFWH 3PREA 4OUOA 4UTCA 4MDRA 3HG3A 4YJZL 4TMPA 1UXSB 1QQCA 3GI8H 3UAFA 2D3NA 1G9MH 3OGOE 5MHSE 3BPZA 3WIHA 3UP1A 2JQMA 2VC2B 4XO9A 3ZKNC 1IV8A 3HUJB 4U6XB 1PKQB 1UB5A 4JTCB 1FL3A 1DYZA 3L3JB 1XR8A 2X4NA 4RFNB 1KYFA 1EHAA 4FK5C 3PDGA 3WKMH 1WZ1H 1QSED 5AYTA 3RVTD 5FFGA 7FABH 1I3RA 2EDRA 1EEYA 3NJHA 4LARL 1JDDA 1FSKB 3VTAA 4Q14A 4A63A 4AKPA 2GYSA 3AY4C 3GEFA 2YKKA 4DV5O 1DANU 1MFMA 4YHHB 2A9AA 1PSKL 3CZLA 4G8IB 4RISL 1NDMA 4Y16B 1VF6A 1OAXL 4JHWL 4DPAX 3EYOA 5DD3L 1CXZB 4N9OB 3I5DA 3T1YO 5FGSA 1KIRB 1OAUH 1E9PB 1U42A 2YXVA 2P5OA 5D6CA 1N7ML 1BBJA 2XZQH 3MRKB 4DP0X 1MVYA 5KSBB 1WBYB 5D7LA 4EUPH 4QRTB 4JFUA 1HL9A 4YHMH 2V7HB 1CG9B 1FH5L 2XETA 4TSCL 4UTAA 1RJYB 2X2YA 4JFPB 3QGVA 1CQKA 4GPVA 2Q3XA 1HL4A 5BQ7A 1ASOA 3MRCA 4PREB 4XDKA 3DHUA 4DV7B 3KCXA 2I9LA 4M7ZB 1ZKAA 2DLHA 4AYFA 3LXUX 1ZK9A 1FLRL 2B9AA 2VLKE 1SVBA 1J8HE 3N04A 3P77B 4NN6B 1GYUA 2DMBA 3FTGB 1HYRC 2J5LB 5CF3A 2AV7A 3SY0A 2WV3A 3RYCB 4OLVL 1M56B 5H37A 3ZL4L 1C9SA 1S76D 1HEZA 5KMGB 3VOUA 3AG3B 3L2MA 2P1YA 4HWBH 1CDGA 3RKDC 2AEOA 3OB0K 3ARWA 5BW7C 1KLGB 4PB9L 5L9DH 5DJXB 4ZS7H 3HS8A 4X4XA 3F83A 1NEUA 4Y0GA 2F0CA 4JFED 4Z3JA 2BCKB 5FK9B 4TSFG 4WJ5B 3KGTA 4ZI7B 5F7YC 3U0WH 1E65A 3I9PA 3L5WA 3OQ3B 1MFCH 5C07D 1PL0A 4O2BB 1NC4A 4KKBD 5CHNA 4ANXA 1AKPA 4DR5O 1MRCL 3D9AL 1CCZA 4B9ZA 4L8BB 3JAKB 1JCKA 5CBAB 3C5SB 1UD2A 4CAGA 4FL4B 3TPUA 3JV4A 4AV0A 3C5XA 4Z3GA 5ITFA 4YSRA 4UILL 2WLKA 3CYOA 3QXAB 4YDLB 5D7SL 2VSKB 4TS6A 2BW4A 3QDJD 1UB6B 2W0FB 3FB7B 2PWGA 1C16B 4NN7C 1OPGH 5JOFA 2WWMC 1P4BH 4Z78A 3ZZSA 1BXUA 4X8JA 3UTSD 2NX5D 4Z78B 2UXDO 2AK1L 3HRZC 4CKQA 1C16A 1BSMA 3E3QE 3RX7A 1X4TA 4OPHA 5F0PB 2JB6A 4UQAA 3X2QC 1P9MC 2QADB 3DPBA 3I84A 3QSKB 2ZQMA 1D9KB 3OX8A 3E83A 4FNRA 4YIQA 1XR9B 3P2BA 5EU7C 5DMKB 3TEZA 4Q89A 1NFDF 1D5BA 5DS2A 5HHOE 5IMKB 4I50A 4TUUA 3GI9L 4ZTEA 3QO7A 3OR7C 5FO7A 1A8JH 2VAAB 3HI6L 4IHBA 3TFKC 1AOZA 1CMOA 2B1IA 4NZ8A 3GXNA 4N3UA 5EZLA 1UD3A 2WZAA 4J3WA 4N6RA 3ZTNH 4HSQA 1G7JA 3ZN6A 5F7AA 1YI2V 4MJ5A 1WP6A 5D1XE 4DP8X 1CC3A 4FQ1H 1CF8H 1HOEA 4HJJL 2VH5H 5GHWH 4M56A 5KVEL 1EH9A 4HUUA 3BQUA 3FMGL 2GC4C 4M1CD 2G5RA 1JGDA 3T2MA 1E8ZA 4KHXL 2NSMA 3D36C 1AO7D 2L3BA 1NIDA 4JYBA 3QNYB 3WFDH 3ZTJH 3ZLQC 4CMHB 5HHOA 2DN7A 4G71B 4TSBH 2ATKB 4AEHH 2PXYC 4DR3B 1VGKA 1UACL 4TPRH 2X3CA 3VSVA 1E2VA 1A3LH 3UTPE 1IVSA 4GW1A 3JD3A 1KXTB 5DRZB 2ZKHH 3M8OL 4QRSA 1ODUA 1I5XA 2J71A 1QEXA 3UOAB 3STLA 4K0OA 4TNVF 1ILUA 3S8GB 4HCGA 2VSDA 4L9LB 1JFFB 1A4KA 1YECL 5KVDE 4N2FA 2CKBB 2J6EA 3AXLA 4M7KL 1M3JA 2GJJA 4Y9CA 3IMRA 3QEQE 3WEXA 4X6DE 3L1EA 5BRPA 1ID5I 3EKCA 5DMIH 2A7WA 1DVQA 3VD9A 3RX5A 2P5ED 2BRRH 2E7LA 4WHCA 3D0LA 4QRRA 4PRAA 4G8FB 5AD0A 2HRPH 3L7FA 3QRGH 1CFNA 1D7BA 2BNUB 1YPZA 4NQVA 4K5NA 2RMKB 5EMYA 5E2WL 5AW5B 4PJHE 2C9QA 1Z9SB 3IETB 2IU3A 5F1OB 2CIKB 4XAWL 3AG1C 3CC5A 3D3VB 1Y76A 2OR9H 4LPTA 1JHKH 1ZLVK 4B9KC 4D9LL 3VXQA 1OGAA 2WYIA 4TQHA 2EADA 2WUCH 2BY3A 5INCA 1BHBA 1MREH 3G9VA 1ITCA 5EO0A 5CLTA 3VWJB 4PWFA 4N2AA 1I8IA 1LQSR 4RUFA 2PYED 4YGAB 4ZX5A 2LGWA 2OA9A 5DQJA 1JGUL 1KTRL 2FGZA 3QIWA 4R4NC 3U9WA 3QDJA 1S3KH 2HUHA 2XV0A 1R3IH 2WXIA 4J3UA 1S7TB 2EDFA 5HHMD 1YN7B 5L3EA 3L9BA 1N0XH 3WG7C 3RVVC 4PTUA 3B09A 2VWEC 4Y5XB 4P5TB 4ZTOL 2NQCA 3NRFA 4BDVB 4DESA 1TVBA 3RVXD 5EN3A 4RZCA 4B3SO 1GW6A 3FQWA 2YD1A 4HKZA 2BSRB 2EXYC 3L3DA 1QFPA 1ZWIB 2DYRC 3SYQA 1T83A 3GWKC 3CCVV 2B14A 4H7VA 2X05A 2EDDA 2HJLB 4DP9X 1DVFC 1S72V 3B83A 2DQDH 1JGLL 4Q9QH 3FU0A 3OL2A 2CO6A 4MNGE 3EDDA 4LLVA 3SE3C 1NAMB 2H6UA 4OFYA 1NCIA 1LJMA 5C07E 1JZFA 4FFYA 2AANA 3RQ3A 3WHXA 4DHLA 1OCZB 5K9KB 2JI2A 4OD3H 3DSFL 1NICA 5JHMA 1TQBB 2J8UB 3W9EB 4A66A 3T4AC 2R2CA 4QF1B 1KN4L 1MCWW 3HE6C 3L9YA 4PI0A 3MO1A 3NA9L 3A47A 4MRCA 4TUOA 4P2OB 3SODB 2AW9A 3DYOA 3NJKA 2H6PA 2X1XR 2Y5TB 1W0VB 4TV3A 4X4ZA 3BN9C 4DETA 3NABL 2EDKA 2ZE0A 3OKEA 4N26A 4NN6C 1XGUB 4LWSA 3K6DA 4P2RD 5LGJB 3L2LA 1YEHL 1H8SA 2Y06L 1FV1A 4QJ4B 4NBYB 3L7EA 1I1YA 1AZNA 1QP1A 4LGPB 2CDFB 2X4UB 3DXAB 1JYVA 3M6DA 1LK3L 3Q13A 4PRPB 1VKXB 4ECNA 2EIJB 1BQZA 1T4WA 2R29A 5I6XB 1HQ4B 2IH8A 2Y0SA 4F7KA 5KZCD 1KJ3L 2CMRH 3IFOB 3L8QA 3RUGF 4GAGH 4LSSH 5IEKA 4E0RB 3AS3A 4BGLA 3CUPA 5IF0A 4LSQL 3O3AB 3WGVB 4WLCA 5F6HJ 3HG1A 3MGTA 2SEBB 3LRSB 1CD0A 1IBKB 1S5HA 1NFDA 1PAZA 4JQIH 1CD8A 1KB9F 5IKCB 4Z18A 4FG6C 3EYSL 4QOKD 3RPKA 1KDJA 4S1RL 3QJFA 1LILA 3MPCA 4J28A 4ODHH 2ZAGA 1XSKA 3VQYA 3IFLL 3OLIA 4F7EB 2QJ1A 1QW8A 5HPMA 3KJ4B 2VL4A 4PY8J 2GIXA 4JN1H 2MPAL 4L1TA 1YYCA 3CXDH 1XNRB 1VGEL 3FOMB 4XWGL 5G4NA 5GGTA 3SDAB 3FB6A 4MA1C 1P4IH 3UYRH 4LF4B 4Y4HC 2AK4B 2V5YA 2X7LA 2XQYG 5AL8A 3ABTA 4OGXL 1JYNA 3D4YA 4ZI8A 2QSCL 2YQ2A 4C4BA 2RNBA 4BFBD 2VLRB 3GKWL 2XC8A 2HJDA 4M5YL 5E9AA 4XP4L 3O4LB 1V7ML 4P46D 2DTMH 3MODH 3RGHA 4J5VA 4K2UL 2Z0UA 4NNYB 4KBPA 4U2YA 4TTDD 4N20A 1QLNA 3EJYD 2EIZB 5LGKA 4X7SH 1JJ2U 3LVEA 3QHZL 4WAFA 5DWUH 4X99A 4WF7A 1H38A 1UJ3B 2QPFA 4UTBH 3POCA 1ZSPA 1KTDA 4LFCO 5DVNA 5E1IA 1BBDL 2CKBA 3EJCA 1ET8A 4H2CA 5I71B 2IWFA 1BZ9A 3BYTA 2BNQB 4RWYL 2FRGP 1MY7A 5LOVA 1EBAA 3ARXA 1S7VB 3GMNB 3P4NA 4XWOC 3T8MA 1LEIB 1KIRA 5H35B 1GS8A 1FYTA 4PS4L 2GJ6E 3NJLA 4G2KA 2CBQA 1BM3L 3N43F 1NTDA 2GBVA 3IFNL 1ZD6A 3AK1A 4DT2A 2BP8B 4PGDB 3MRFB 3M7MX 1EAJA 3EYUL 3QDMB 2JJTA 1F4XH 1OB1B 2A3QA 2DJMA 1QI4A 4L1DA 4MA7L 2DLGA 4J3BA 4PW3A 1WH0A 4RX4A 1GGIL 3K4ZA 4JGMA 5A2AA 1DZ0A 3L9EA 4ORZC 2AXWA 2LFEA 4HCRA 4P30A 2W9DL 5LKNA 2DWEC 2H9GB 4LSUL 3WBDA 3HG5A 2HTLC 4JI6O 3ARQA 4FLXA 4AKQA 3HI6H 5E6SB 3TM6A 5DC0A 3T1HB 4I3SH 3K58A 2P28B 3D39A 2H3KA 3ARED 4PJCB 5AW6B 3OZ9L 1HHIB 1AD9A 1EZVX 5T1LB 3BPOC 4J6RL 4OAWB 3E8VA 4XB8A 2VC2H 2X0UA 1PZBA 3ZHFA 3FFCB 5L3BA 1EO8H 1XTMA 4DN4H 4WFGD 2CDFA 2X4UA 3B8MA 3ARRA 5CA0B 4XZUA 1ERNA 1I94O 3FZUD 3S88H 1F6FB 1NEZA 5JHDB 2ADFH 4X65B 1RJLA 1V3MA 4D9QD 4GBXD 1MCOL 1RIHH 3R0NA 4GKNA 4WWID 3V4VA 3JBG7 1QO3B 2QELA 4TSBL 1OTTD 1IM9B 3FSZA 2QV2A 4N0UB 3OKLA 2IPUK 1KBGH 1Q5OA 2ZNJA 1RJCA 4HA1A 4PUBL 5AKTA 1HHHB 2B4CL 4L05A 5HDOA 2EDMA 1ETJA 5E4OA 1AR1B 4L8JA 4N2BA 3MLYL 4BCZA 1YLBB 3B4NA 5ITBH 1DVYA 3MACL 1JVLA 1MFBH 3DWTA 4PEEA 3IVKA 4JPQA 1PG7L 2A83A 3SCMB 5GSVA 3AUVA 1O9GA 2V2WB 4P2OA 5JA9A 1AGFA 1AOHA 3CMGA 4JHAL 4BWWA 1UWEL 4WZ9A 1N8ZA 2XWCA 4LDCA 4MYWB 3IMTA 2UXVA 5C70A 1R0AH 2DPKA 4DUYB 1N59A 3TBVA 1D6EA 3D3VD 3QWNA 3VXOB 5J13C 5C8JB 4IGBA 4L3ED 3B40A 4XPBH 5L4FA 3RYHB 2VITB 2L35A 4GKZA 2F4VO 4ODTL 5GZND 3UROR 4X98B 4P23A 3V0AC 3GWOA 4J7RA 4XPHL 3RDTA 4PCYA 1QBML 3MROA 4HYOA 1RKRA 1AE6H 1O7DE 1S7RB 4E5XB 3FSVA 3VU2A 5D9SB 4Y4FA 1E5ZA 1NOAA 5T5FL 3RTLA 1A02N 3CJHA 2MHAA 3SGJC 3CDYA 4YWGL 1I53A 5HYSB 1P53A 3HNTH 4D8PB 2OR9L 1FYHB 5CSBA 1NMBL 5KTEH 5HDBE 4G7SB 5LO7A 2VLKA 3VB8A 2H3NB 4YFLI 5B3SC 3L54A 3T8XA 2JCCE 3VFUB 3DETD 4QE7A 4KX9A 1ID2A 4HULB 4XP1L 3UJTL 4Z7OF 5E6ID 1TO4A 1V55B 2NRDA 3E22A 1K3IA 3CZFA 3O0RH 5ESVA 3CN4A 5A2FA 2CLRA 2YLHA 2UZYB 2OJZH 4LAQL 1MKFA 4C57C 1ZLUH 3PNWB 1R3KB 4RWUA 2O72A 4WY7H 3KYKL 2HVJC 1U3YA 5C0ND 1T80A 1B4TA 3MRDB 1HIML 4G3YL 3EBHA 4L1SA 3WHXB 1IBBA 3OC5A 3MBEA 3TASA 2AJVL 5GGUB 2ZKWA 1RZGB 5I8EB 2B1HL 2FWSA 4FN0A 1T5XA 4IU2A 3CPLB 1LNQA 4HIJB 1EDQA 4JM4L 1CQYA 1NANI 1D5NA 1H5BB 4H8WC 1SF9A 1JFHA 4K7PY 4NPYA 1TPXB 2Z92A 3V0VA 3VGEA 5JXEA 1KCSH 3J27A 2VR4A 3S96A 3C6SA 2HUEA 2ZCKH 3ETBF 3ZO0A 3IF1A 5JIPA 5E6IC 2ICEA 2MCG1 5I6XC 2DWDC 5AW3B 1HHGB 1YEKH 2YR3A 3ESOA 4JTDB 3K8MA 1YNTF 5JORA 1F4WH 3ME0A 4HSAC 2NQDA 4N6QA 2HT4C 3X3GL 2VR5A 4DN3H 4OZIE 3M07A 1XCQA 1XGYL 3ZN0A 4JPKH 3S3DB 4KQ0A 4ELDA 3Q6FB 1P7QD 1QWHA 2PCYA 4HKXB 4RMSA 4EN3B 1D7DA 1MHCB 3O8XD 3NIDF 2CAKA 5DZPA 1TUEB 4DAGL 1DTUA 3ZE2B 1M2VA 1O9WA 1XDCA 5K9QI 4FYSA 4OI9A 3VSQA 1WV7T 4F8PA 2HVKC 5EUKB 3HKDA 4B9JA 2VOTA 4OQTL 4ZD3L 5INCB 4BH7B 3F5WA 3LQAC 3KE0A 3LHPH 5KVDH 2OL3A 3ETTA 3ERXA 3QJTB 2FO1A 1FNGB 2PCPA 4ZFOB 5FUOL 2OYMA 3DX4A 1K5QA 2RFXB 4H20H 4AGPA 2A77H 5D8JH 1CGXA 4YY3B 2XCMC 4W4NA 1KBPA 2V0AA 4Q6IB 3Q5OA 3UADA 1Z6JT 3RJDA 4XPTL 3VYNA 3RB7A 3NA4A 1WAPA 1DJYA 2E9WA 2Z4QA 3ZDXE 1LO5B 2BOBA 1CXLA 4OGAD 4XI5D 4FM0A 4ICXA 3UTTA 2HKOA 4GRWE 3LKRB 4ZUUB 2KLRA 3SO3C 2Q67A 2AJXH 1OT2A 4I2XB 5FYKD 3TVMB 1A6AB 4G8GD 1K4CB 4IMLB 1BHGA 1I3UA 1SJXA 5BMFH 1JF6A 3RN4A 2VQFB 1OK8A 4OCWH 5TPWH 3PHQB 4K5PA 3VH8B 1JZ6A 4OJAA 5F72S 4ALAC 5IB5B 2BIHA 1GK9A 1ZTXH 3ZQWA 4CKVX 2FQDA 5EC2A 4CMMA 1KTBA 1A5FL 1FIGH 3QWRD 4IRJC 3NCWA 2WCPA 3I9GL 3JTBA 4GKOA 3ZDXF 3EFOA 3FCBA 5CFAA 1MY5A 3RHWK 1OSZB 5C6TH 1F7YA 3QJHB 1B0GB 5E0FA 5I73C 2E0PA 5E56A 4PG9B 3TJHC 3LEVH 1PDKB 2JK5A 4X7EC 3MLVH 1NC2B 4XP4H 1X59A 4JKLA 4P5KB 2NZ1A 3Q6GH 1CFTB 3B2MA 1I85C 1QPKA 3HUJE 4P0DA 3FT1A 1HH6A 2I85A 2PPEA 1KGXA 2DH2A 2C26A 1D5XB 2Y23A 4NRXA 5J6GA 1DJZA 1IGIL 4RAHA 1BT8A 1CF1A 3Q8BA 4F8QA 3MUHL 1GYCA 4KO5A 3F7YC 3CFBB 5DFTA 2CALA 4XB7A 5CO1A 4HZLA 4Z8FH 4GP4B 2CCVA 3MNWB 5GS0C 5D2LB 1R3HB 3PN1A 2VXUH 4LL1A 1DBAL 1AR1D 3PHOA 3VSTA 4LFBB 3G6EV 1MOEA 1S9VB 4HH9A 1H0DA 2R29H 2YIDA 3L9DA 1GRWA 4I7ZC 1Y07A 1UYWH 3SY0B 2H1XA 3BWSA 5CEZL 3FT3B 5KN5A 3ZBMA 3ML8A 3ELAT 4F24A 5BXZA 4DV1B 1NCBH 1RUQH 2VXQA 1R9FA 4UAHA 4WBNB 2ENSA 3MUGA 4JZJB 2YPLE 1E9QB 1YTFB 2N7SA 3PE9A 1B4JL 4ZO7A 1AACA 1L7IL 1EZVY 3S8WA 3BKML 3UTOA 3OSKA 3IDIB 3QHTC 4TQPA 4WNQA 5BUGA 2KSDA 1DBKL 2GHZA 4MS8C 3TJEL 4AJWA 4PP2A 5D93C 3CAFA 5EDXA 5I6KA 3BAJA 2JTYA 3EHBC 4L0YA 1EHKB 4PJXE 2WXRA 1ZHNB 4YSTA 4XPAL 2DLFL 1X9UA 4MMXA 3VXME 4HIXH 4I4TA 5D1QA 1GN3A 3QORB 4Z76A 5KA5A 1TOXA 3PWPD 4U1JB 5BS0D 3GHPA 4HK0A 1T04A 5IFJB 3JT2A 1BQLH 5BRZE 3HN5A 1CFNB 1WBZB 1WIUA 2VDKH 3L4WA 4FERA 4NQVB 5SWSD 1LE9B 4GNKB 3HPLC 2IDQA 4YGVA 1CXFA 2FJUB 1RL1A 3ZYZA 3HC4L 1H8EG 2FX8H 1RQ5A 1XF2B 3SDCD 2NY6B 5MP6H 4FG6D 25C8H 2CRZA 2Q9OA 1R17A 3LEXA 5ABZA 5BS0A 1RZ7L 3MV9E 1GTOA 4WWOA 4Y5VA 1KB3A 3T3MB 4UTAL 5GZOD 2XX0A 3QFJE 4OIIL 5KBNC 2BSSB 2VZVA 4L1HA 2PYJA 4O2CB 5FECB 1JGVL 2KPWA 3GS0A 1RV6X 2IJJA 3MJWA 5IEHA 4OV5B 1MWAB 1L5GB 1BG1A 1O9HA 2P5EA 5I1KL 2DW5A 3DIDA 2DQIH 2EVHA 4CU6A 4KNUA 2QWNB 1AI7A 1CFSB 1DBBL 2WZPA 4RGMB 2C1OB 3H53A 3KPQA 4O4YL 3T2QA 2CJTA 4DV5B 4DR6B 3O4LD 4P46B 3FB5B 5DQ9A 4Q0XL 2NX5A 3KWXA 4JGUA 1SHMA 4ISVB 4ODTH 4XH2A 5T1MA 4G6AC 3KPRA 5GGVL 3WIIH 5EULV 2QVMA 4IRSB 2YWZA 4GMTH 4BKSC 1U91A 2YLKA 5I1AA 5I71C 3BQUB 1K92A 1BV8A 2HVKA 2PYEE 2W9LA 4N8VB 4F33A 4JFVA 1PTZA 4JPSA 1LNUA 1J1PH 4ZQKB 2PR4H 1XV8A 4YWGH 3A6CH 2D73A 4DZ8A 1TJMA 2DIEA 3CCMV 5IT2H 4RGNC 5EB9A 3OT7A 2GBUA 4YBHA 4XAKE 5JIHA 2PWHA 5LXTB 2Z31D 2O6CA 3HE7B 2NDGA 5C07A 1S7WB 2XACC 3Q8EA 4HOZA 3L1GA 3AS0A 3GSVB 3DX6B 1MFDL 3NIFB 2E7HA 4JLRB 1EXGA 4YXLL 4PMFA 1FH2A 1R24A 1INEH 4I0PB 5FYLH 1EERB 4ADIA 4JLRA 1WNSA 1DVFD 4WO4A 3KPRE 4BSWA 3AM8A 3QQNA 1YJWV 2AABH 1K4CC 3MZGB 4D2NA 1S77D 1HH9A 4G7YL 1WYJA 3C6LB 5F6IB 1D5BB 4G6JL 4S1SL 3RVXC 2KZBA 3QA3A 4YL4A 2NZ9D 4YX2L 1LMIA 1OCZC 2XG4A 3EZ8A 2DQJL 1EV2E 2D7PA 2DQEH 1U93B 3O81A 1Y0LA 5SX4I 3VJ6B 3OJDA 3TIDA 1LDPH 1SEQL 1TZOA 4P4KC 4AX3A 1OT4A 5LA6A 2IH1B 5DJDB 2BSEA 4AZ8B 4G5ZH 1JTOA 1R19A 1O7DC 4FQIL 1SF3A 5I1GH 4X7CC 1IAII 3IJYA 1SA0B 1B3JA 1XWVA 3TTYA 3EFOB 4Z7VE 2XZAL 4EUPB 4RRPG 1AR2A 5C92A 3UEZA 3X11B 3ZN1A 2QZ5A 3CLWA 1S9XA 2MSPA 3AY4A 3I85A 3ZE1E 1ZJAA 4ASUG 1XGYH 2ZOLA 1KB5B 3RUGE 3X1BA 4IS6A 2GSIA 2XWBB 1YMMD 5EU6A 4XCEB 2OM5A 3I75B 4HBCH 4Y4KC 4UT6H 4Q6YA 5DZAA 1BF8A 2Q86A 3B5TA 2PW1A 3WEAA 3KPTA 1XF5A 4L8DA 4WI0B 5GZNC 4NR1A 2NNAA 1BQHG 1MLBA 1E42A 3CZNA 5BPPA 3SDYH 2OMBA 3IFPB 3GSVA 4X6CE 5LDUA 4X80H 3WMQA 1TLKA 1SY6H 1YMME 2IPTL 4KJWC 4ZUSB 3ESUF 4F5CE 5ALBL 5B3NA 3B8NA 4OFIA 4NZUL 4OGQB 2ZG2A 3K46A 4TNEA 3T3MF 4RMQA 4A04A 3VWJC 3RBSA 4BCXA 1M2OA 4MD4A 4GRLD 1GSMA 1UJWB 4PAZA 3T04D 3GXTA 2CM5A 4LFAO 2P67A 1YDPB 3CDFA 3K1DA 2OCFD 3BEHA 4W4KA 5CINH 1NFKA 4MD5A 5FLXN 5C7XL 3GMOB 2F74A 1VFAA 1MFUA 5DN6G 1R47A 3O3EB 5EUKA 5C0JA 4CH4A 3RYCA 2ORBL 2V7NB 3ECWA 3NQKA 4WI2A 3FU5A 2YA1A 4JKNA 2EZ0C 4EB6A 3BESR 4Y16C 3KEDA 2FZ3B 4BUQA 1TR7A 4G6KH 4K71B 1NGQL 3L4TA 2AXFA 4LLDA 2R2HA 5KS9E 4ACPA 4YIOA 1MWAL 1XH3A 5B1OA 3KJ4C 2GSMB 3C6LD 5GZOC 3MFFB 1TJHH 2BIIA 3MRBB 4NWUH 4NQED 3BEVB 5F7MC 5HHQB 5L7XH 5BMFL 2ENQA 3TF4A 2PN5A 2UU9B 4BFRA 4LOEA 4DR3O 2K4WA 4OCWL 3UZEA 4MAYD 2OCJA 5KVFL 4ATTA 1KPRA 2ZP0T 1T89A 3NAAL 1HN1A 5AZ2L 4IRZH 2ICEC 1G6RA 4F93B 3CBRA 1XGRB 3DJSA 3GXMA 5EWIH 3QIUC 4S1QL 2O5XL 2AK4E 3HMXL 1O9VA 1ESOA 4JUSA 2R4RH 1TFHA 5I16A 2EDYA 2QSVA 3L3GA 4XMKL 1MI5D 4JFWA 1UJ3C 1S2EA 2ZCEA 1SEBB 4LL4A 4GG8B 4O5LL 3VMPA 3GDBA 4G6MH 3I2CH 2VNCA 4M7JH 1NCJA 4AUYA 4U1LA 4N9GA 3O65A 2X0LA 5CA1B 1QNZH 3E3QC 4P9HH 1M57C 2VDMB 3SKOA 1P7QA 2ZOOA 3MJ9A 2FLBT 4GLRH 3OPZH 3OTTA 1TUBB 2LGQA 4H8HA 4PJ5A 4GY4A 3VI4A 1X6NA 1AB3A 1BEYH 5EOTA 4ZPVA 1MSWD 1NINA 1DDHA 2R9AA 4TYUA 2LGNA 4ODSL 4ZMXA 5K9QG 1GXEA 3BVOA 5MI0B 2VZOA 1PDKA 1B04A 4RSYA 1WCBA 4BZ2A 4AIZA 2D7OA 2QSTA 2W0PA 1J0IA 2JE8A 1MNUH 3DGGA 4LLQB 4NO3A 1ZLZA 4AQ8A 1E43A 2E9GA 1UQSB 4N2IA 4NKOA 1D3CA 1E6OL 1E7UA 3WN5C 3WNLA 3NJIA 1O75A 2YUZA 3S98A 2DM3A 2Y07H 1A6UL 1SYSB 5AVYB 3VXTA 1E2WA 3MCYA 1CP9A 1M93A 1YCSA 5L0QC 5B38B 4GS7C 4QYOB 2VIRA 1R6NA 1DJHA 4M00A 1AO7B 4Q97A 2F53D 1IGJA 2FTAA 4QT5A 5H94B 2NXYC 3C60C 3QUYD 4I18C 4CU7A 2PW1B 2IJHA 1P1ZA 3A21A 5C9JA 5EU6B 1YEJL 3Q5TA 3G6DH 2YN3A 4LPYA 5T1DL 3H6AA 4KZEH 3V79C 1EHNA 2BTQB 2JELL 2P45B 5E4AA 4ZUUA 3M46A 4IBYA 4P2OD 4EIGB 2A9MH 4FNLL 5B39A 2LV4A 4NX0A 3LDBC 4WW2C 1P1ZB 43CAB 3MBED 5L2KE 1TSHA 4YIPA 5HGDB 1KJMB 5TD4A 4N23A 4V1DE 3WFDL 4QEGA 5DFVD 4G9FA 5C0IA 4Y9EA 4HWUA 4M4RB 5AWNL 2ZR3A 1KY6A 3NSFA 4PV8B 4YEEA 3FOLB 4DP7X 4HDIB 2VRAA 1ZHKB 1F3DJ 3DLQR 5IROC 3M8OH 2OCCB 3UJJH 4YHYC 3ULUH 4WSKA 1A7NL 1OSZA 3E35A 3FQTA 1FN4A 2FKXA 4IIJB 2R69H 3S8FB 3D36A 1YIJV 1RZ7H 2N1TE 1UKTA 1PCSA 2WVVB 3LQZB 5ICZB 4N0UA 3O9WB 2P4KA 4CJ1A 4JPVH 3KDMB 4KDTC 5DMIL 4OGAC 1ES0A 4XBEL 3ZDWA 3HB3C 3SQRA 3UDWC 2XNAA 3N85H 5GRJH 5IJ9A 4F58L 2H94A 2ZE7A 1XBRA 2F54B 4QTHB 4NQSA 1EFQA 1ZSDB 2UUBB 3T4AA 1KXVA 1U8HB 3ETGA 1DCLA 3SJAC 4MXWL 1HNXB 2M1KA 1AHWB 1GMEA 3U1SH 4D0DA 3RPBA 3UIZA 4GG6B 1IGML 2Y2WA 1J8SA 2Q20A 4FZEL 4O4YH 4FJZA 3RP1A 5LCVA 5FW7A 3BAWA 3PQYA 5DD5H 3L3GB 1QFUL 3RVTC 5ESAA 3HMXA 5ADPL 4I88A 4JY6A 1OCWL 3BWAA 5DSCA 2A6KB 2WUCL 4YPJA 3MRQA 3PXHA 4PGCA 4AQEB 3JWOL 4GBXA 2DYPA 2YSSB 1PLCA 2LT9A 4ABVA 4JO5A 3VBBA 4Q9CA 4ZIBA 1MW1A 3A6CL 4ZFFA 5KBLA 2R8SL 2F1BA 1S3KL 2D31A 3PHAA 4P2YA 3ESMA 4B3RO 5DO2C 4M9PA 6TAAA 3E8HA 1V3LA 1R5IB 2DQ3A 4KVNH 4KRMB 3K6OA 1XH3B 4XTRD 3OKNA 1FYTB 1SXNA 1W16A 3W39A 2UVFA 3RY6A 4M7LL 2JKNA 4G72B 1FFXB 1NFIB 5LOVB 3P4NB 5J57B 4UV9A 5F89A 5LXGL 2D4FA 4CVUA 1YYMH 5LMUB 1SMAA 4YHKL 3LYRA 3DIVA 2R0LH 4RFEA 4KAQL 4ZJ9A 2Y4SA 5KLVH 4BFEA 4WKZA 4Y7OC 1FCGA 5J06A 2BZ7A 4G7YH 4HCRL 3IB4A 3WB2A 1N6UA 1MSDA 1INDH 2WVUA 3MOAH 3LN5B 1HDJA 1YSCA 4E9TA 1TSRA 2Q5BA 2YA2A 3MXWH 4R4ND 4QT5B 2ICCA 5HJ3B 4LLUA 4AE1A 3VW3L 5D1ZD 3QUYA 1BX2B 4UT6A 3JUZA 2O5YH 1Q0XL 2IMMA 1N3NA 4LKCB 1AGEA 3OR6C 3P9WB 3TNNA 1HZKA 4QAMB 4MTFA 2EYRB 3A4FA 5DR5L 4LCCA 4G6FD 2IDFA 4HAGA 1A1NA 2CTQA 2VDOH 2PYLA 3SKNA 3HFFA 2IC2A 4IIQB 1A2YB 3VRIA 1EHLL 2QQNH 3CHPA 3KWVA 5EPMB 1X4ZA 1XL6A 2IANE 4M43L 3ZDYF 2DDQH 1ZVYA 4QIWF 5JH7A 3MYJA 3KXFB 1MCHA 4LF3B 1CXHA 1IZ3A 5KAQF 4U7NA 1E3XA 4UNIA 4QJ5B 1A3ZA 3R0MA 1EBOA 2YZ8A 1ZV5A 5HDRA 1P7QB 1GMGA 3ARGC 3SDYL 5ID1B 4AV5A 1NMAH 4KZDH 1C5BL 4X80L 2XG5A 4GMSH 1NR1A 3NK4A 5T1JA 4IBVA 3D7PA 1ZT1B 4XC1H 3VB9A 4JPWH 2MMXA 2ZUVA 5F0LB 4P57B 2P6JA 3CSGA 2ARWA 3RZCA 3PWVA 4MQ7A 2DM2A 1JZ5A 3BQUC 2VLJE 3KDMA 3DO3A 3UTZA 4MJ4A 2P06A 3MNWA 4G8GE 2CO7A 5EU6D 4X9QA 4N85A 5EZYB 3ZYJA 4BH8B 1DQQA 1GR7A 4EZJA 1MUJB 4W9DC 1P1VA 5F1NB 5BRZA 5FCUH 4DKEL 3QJZA 5I1CL 1G9NL 3HN8A 3SEPA 4AYEC 2BC4A 4KNQA 4BYHA 5IREA 2WLNA 5FA4A 3DTXB 4WF9V 1ZLDA 3QUKA 3K4AA 4RMBA 3FUDA 4E9VA 4I9QA 3DYPA 4IIQA 3MCG1 5E23A 4XNMB 4APQD 1AQDB 2KS0A 3MLSH 5DEGB 4D7SA 5CCJA 2UXFA 2G5UA 2K6WA 3CZSA 4H33A 2YFNA 1W8NA 3DARA 2ZXEB 3DC0A 4PY7A 2JGUA 5JH7B 2F7PA 3IDXL 3MYJB 3V5DA 3GSOB 1JERA 2P9RA 5HTSA 4JGJA 5E5RB 3F65A 5EWIL 5TE6L 1TVDA 2CUMA 4OPAA 1I3GL 3PGFL 1QCEA 3CFMA 1G7HA 4HUCA 5FCSH 3U4BL 5CGBA 4CSTA 3ZMZA 4X7SL 1YPZE 3WUWA 5I76A 5F6HI 5DJ8A 5F1SA 5F7DB 4GI8A 4FMVA 4KWUA 2IH1C 1ZMYA 3PIQA 3N55A 1UFIA 2HTLD 2QEXV 1TTRA 3O4OB 3B2UD 1TGOA 1PNLA 4PBDA 3K7UA 2BK8A 3QIWD 4Y5YB 4K94H 1K5NA 2PYEA 2ZD0A 4JI0O 2JJ2G 2BOBB 1AC0A 4OKVB 5GSRB 3Q48A 5KYXA 4NNYA 2RQEA 2V33A 3L4ZA 2A6IB 5HI3C 4CS4A 1SVCP 1XF4A 5DDHA 3VNZA 4LDOB 3OLGA 1JMXA 1QAWA 1X5JA 3SGIA 3FF7A 3GSNB 1XFPA 4OV6F 4X5RA 2YPLD 3DOHA 4OLEA 1AJPA 1MNUL 3P0VL 5D96B 3VXUD 2Q4PA 2WYTA 4MZRA 4Y5XC 2VUOA 4YE4H 1AGBB 3O8XC 3VG9B 2GHWB 3C2AL 3ZQ9A 4HVBA 1QEWB 3BUIA 3ZBHA 2A2QT 3ARZA 3VGHA 1MA1A 2ZKOA 2G2RA 4J8RA 1AG6A 1DBML 1U96A 5CR1A 1FL5A 1T4KA 1YPZB 4N8CH 4GRMA 4XMZA 5C0CD 2I27N 4OLXL 5DSCB 1CYXA 4A2GA 4Y2NA 2WWWA 2DQGH 5DJZB 2W6JG 1VQ7V 1BD2D 4NKGB 5JYMA 2EDEA 3K5MA 1XB6A 1UFUA 4GAJH 5E1AB 2VXQH 4PP2B 3SDLA 4GG6A 2VCOA 1G6RB 1SESA 1N5AA 5K1JA 3FYEB 4Y4HD 2J5WA 1QW9A 3QJVB 3EGXA 2HLAA 1GO3F 3IAPA 2YPVL 3JV0A 1HINL 2F95B 2FYVA 4PJBE 3WB0A 1SYVB 1ECYA 4NUGL 1P5UA 1Q9OA 4OUUA 4X64B 1ES0B 4NQCA 1JNNH 2B5UA 4Z7VA 2FJFA 4JKMA 2NT0A 3MVSA 4XAKD 4BD4A 5I73B 1ENVA 2VLME 3H85A 1IILE 2DM4A 1WK0A 4AYBA 5D1ZI 1PIGA 3RUGA 2R1WA 4M1GH 3LDDA 3QIUB 5JJJB 1A7NH 3MNVA 4JFFA 5JIQA 1Q9KB 4L3CA 2BSDA 5ISZB 4FI7A 4R4BA 3GI9H 3TYFA 1LP9F 4D0CB 1OGAD 2UZPA 1QRNE 2YK1H 5AENA 1J8RA 1IGYA 4QXGL 4XNXL 4L29B 4LO9A 3J7HA 4FXTA 4LEOB 1LO0H 4TUYB 1PZ2A 4R2GD 1KCKA 4KKLD 4NM4H 2EIBA 4XNMA 2EH7H 3FW6A 3GBEA 3QUKB 4LF3A 4DOHE 3BP7A 5AOLA 1XGQB 3AXIA 4FQ1L 5ECGA 3V4UL 1X9RA 4MJID 4A7VA 1YXBA 2L7EA 5IFAH 4TLTA 1LUVA 2JKXA 4YY3O 4D8PA 1T1WB 4ZYKB 2WW8A 1WUZA 2EJ7A 3OKKA 2I69A 2VDQB 3CE1A 4FEIA 1KB5A 3VYOA 4B7IA 1BE3H 4ERSH 1SMOA 3E6HB 3ZO9A 1N3NB 3LNHA 5E00B 4FFKA 3B9KB 1JPFA 1L9TA 1LP9B 1AIZA 3JWOH 3GC3A 1HQRA 5B7EA 3L3HB 2PABA 2F2HA 5E24E 1N0JA 2I9TB 1CTOA 5DI8A 4PJDF 1BYNA 1GA2A 5H94A 5BOZG 4OZGF 4MVUA 4ENEC 4ZO8A 5I0WA 1BQHA 2VQFO 2MH4A 2IV8A 4P2RE 4KVNL 3LIZL 4QIRA 3CLFL 4R7NA 4IDJL 3LOWA 5GS2H 3N41F 4WI7A 5HHNB 2PR9A 5JNYB 4L4TE 2VWEE 5E8EA 3IXTA 2MW2B 4L37A 3MLWH 2OP4H 4LCWB 3S5YA 3X1FA 2YMTA 4DR2O 3HS0B 2BJMH 3FZUC 4KH2A 1LYQA 3RG1C 2D9QB 1QYGL 1R5IA 1SJHB 4PIBA 4NJ9H 3BP4B 5HYQA 3F7VB 1H9VA 3ZU8A 2XZZA 4Z5RA 1U8LA 3GSUA 1QO3A 4OZGB 4XDJA 5IBLC 4F5CA 2MOGA 1GZPB 1P69B 3X14A 4DQOL 4L2LA 3VW3H 1QUNA 4FAAB 4K23L 1MF2H 1PPIA 4ZUWB 5JHLH 1DQLL 1BQSA 1DJIA 3OAYK 1L1FA 3THML 4OM1H 5CFHA 5AOKA 2BY1A 4GKLA 2G60H 1ONQB 4PJAF 1CK0L 3UTSA 2C9XA 1W72B 2XN1A 2PTTA 3RBGA 1B0RB 3L1FA 4MTMA 4A6YH 4KOBA 4P3WA 3N9GL 4HK3N 5DR5H 4DZ8B 3CMEV 4HT1L 5JXEC 1ITBB 3BD5A 3R4RA 1A6WH 4K3HA 3B3IA 2UXDB 2B3IA 3CHOA 4FJYA 1DN2A 3BISA 1ZY9A 4PJ8B 4UZGA 5IG7A 3ULUE 1ZX3A 4JK0D 2ZXQA 1WBYA 2LVEA 5D7LB 1ZPUA 3ME0B 4QDGA 3O6FD 4UT7L 4Y1AB 2Y0IA 4NRXB 5K9JL 3ZDZB 4X6CF 3O11A 4IRSD 1I08A 2WY3B 2XT1B 1P4UA 1VQMV 2ROXA 3MI6A 1C5BH 3JWNE 1HI6B 4DKFH 4K9EL 1PZUB 2EVFA 3SBQA 2A79B 4NPYB 5BZXA 4L1BA 1I7UA 4LCWA 4HG4K 4NZTH 1G0YR 2D0HA 4WWKA 3BGMA 1RZ8A 1WD9A 5K39B 2WMPB 3GF8A 5I8CA 5BO0D 1QVGU 1EO5A 1QNMA 3W7TA 1E27A 5CSZB 1B3IA 4FTVE 1FNFA 4V1DA 4LF5B 2X1WL 2YIHA 2X4RA 3T2LA 2ATPA 2B5IB 3DUSA 1P7HL 1PKQA 2AJXL 3ECVA 2CKNA 5DD6B 1HYSD 1TYEB 4K9JA 4DGUA 5FDWA 5TDOA 3DI2B 4OFVA 4WHDA 2OZ4A 5CIPH 1NGZA 1SQMA 3HLAA 4PBVC 5I1CH 3PJSB 1Y66A 4NAMA 5HHXH 1UGKA 5KBMA 2VS0A 3RIAK 3ZKXC 3NABH 5F96L 3EXAA 4FJ6A 2PXYD 2YZ1A 3GSNA 2OZNA 4G82A 2OBGA 2BERA 3GSXA 3SOBH 4C4KO 3ARTA 2A5UA 3HC2A 3IJEB 3IDJA 3D51A 4D7BA 1XF5B 5IQNA 2E7BA 4PBWD 3IDMA 2EO1A 4ETYA 1MELA 1AXTL 4M7ZC 4M3JA 4Y5YA 4Y9GA 5DUPH 3JD2A 3UXFA 1IEAA 3IU3A 4HJ1A 2VQ1B 1HKLL 4FQHB 3UP6A 5IJKA 5HDQH 3L3OC 3FUHA 2OW6A 3CZEA 3O0LA 3JZ7A 4KUCD 3TWCL 4GAGL 4LSSL 5A6IA 4OSUL 4OZIA 1HVXA 3VTMA 5MI0C 3CXHF 3BP5A 3RWCB 1RZJC 4DUZB 4HUWA 1KIQA 2RCVA 2DE0X 1XD0A 3NRPA 4GQ9H 2FNWA 2Y6SC 5KSVA 1UA6L 2F1EA 4YUEH 5FW8A 3MRHB 5J9PC 3D06A 3OJMB 2EDHA 3GSRA 4ZPVB 4BXSV 5KS9F 2A83B 2BVQB 1F18A 2GW5A 4ZOLB 3O45B 4Y2DC 5L6YH 1ECZA 1BVNT 3ARGB 3P3YA 2VR3A 6CGTA 5CEYA 2V8LA 1BECA 4PP1D 4TUJB 1A66A 1QBAA 1A7PH 4HW6A 1UD4A 5FGCB 5AAWC 4LEEA 5CZXC 3MAWA 2KYIA 4PV1C 4LF9O 1DUZA 4G80B 3ABMB 1S46A 1UH4A 4GW5A 2RJZA 2JK5B 2WWKT 4R96A 5JIKA 3IMBA 4N8CL 3H2PA 3VA6A 1EPFA 4OR1A 3H9SB 1VPOH 1NBQA 5C0RH 2NY6C 1VQKV 1JVMA 4K3DL 4LGRB 4EJ1C 2CGOA 1GPOH 3HHSB 3QUYC 4LSPH 3QHZH 4NWTL 1KB9K 2GKIA 1J8HA 3QNXB 2HMIC 5FLVA 1JPTH 5DRXA 5ADOH 1LMKA 3AWEA 5I74B 4UCVA 3ZHRA 2AQPA 2XXGA 3JV6B 4WTQA 3FT4B 3OKOB 3NFSH 3MU3A 3N5AA 3HN3A 5T3ZE 3Q7JA 3L3OB 4Z1PA 1TUBA 4I1RA 4NRYA 4PS4H 3VQMA 4HHAA 3MCLH 2E27H 4JKPH 5IBTL 5G5DB 2QLYA 2EIJC 3PQYE 4JS7A 3P4OA 2WTOA 3BQVA 4IDLA 2V7NA 1JK9A 1WZLA 4AT6B 3DC5A 4XHJD 1H15A 1TZAA 3OG4B 4XNAA 5C0DB 1A4CA 2Y72A 4J7JA 1SZXA 4F2MA 1IVLA 1S7SB 1CFQA 2DYPD 2D03H 4MA3B 3LKOA 5FDWB 3CCHA 3G5VB 1OOAA 5IYBO 1F13A 4LSUH 1R34A 3O6FC 3G3LA 5DD6A 1B2YA 4KNTA 2QGCA 3ABLB 1NIAA 4QYOA 4ZUVA 1GGTA 2BXYA 1DBBH 1CBVH 1OCRB 1PZSA 3G5YA 1TU2A 3FFCE 4ZFGH 2ZXCA 5CU9A 5E1AC 1BLNB 3ZRVA 3VXOA 3NCYS 1RZFH 4R84A 1XIWA 1UPGA 1TA8A 4PPTA 1T04B 5LYJB 3CCQV 2WWOA 2F08A 1R6KA 2ZOLB 4GMTL 3MUJA 5CILL 5DVPA 1RZQA 5D1ZA 3SQBB 2ZX7A 1RJYA 1IAOA 3V5HA 1SF5A 3HNSL 3SGEH 5KOVC 1N34B 3FQXA 3Q0HA 3J07A 4ZRGA 5C3TA 5C09D 4MXQC 2EBOA 1RPRA 4Y1AA 3IM1A 4G43A 4Z0XB 1UCBL 3TEWA 3FTVA 5FOJA 4WCYH 4U7SA 1L8DA 1KIQB 1KGWA 2FR4B 1LO4L 4OB5L 4CS2A 3B2XA 4PB0L 4MT8A 3TCLA 1J0ZA 2P52A 3CRRA 1MFBL 4LVOC 1Z32X 1PZ3A 1XL4A 1KKCA 1F58H 1INEL 1XHHA 2C2AA 3X3FL 1DF4A 1VRSA 1KCRH 4JR9L 3KLHD 5B4MD 1RFDH 1S5JA 2AQTA 5L2KB 4KMTL 3B9KA 4GX1A 4NNPL 3NCBB 4AQOA 5JOPE 5DC2A 1A14H 3LRSA 1IIKA 2IGTA 4IDJH 2LQRA 2LTQB 5KYUA 2PUQT 2CZNA 3U6XA 2GAZB 3GBLA 4XPBL 4GOSA 1IFRA 1F56A 3C2SA 4Z23A 3IMWA 4H13C 2ITFA 2QPDB 1T7ZA 4FMKA 3L5HA 1FNSL 3MNZA 1FJGO 4YSCA 2G38A 3IDYB 4LFHG 3QE5A 4D0DB 1ZA3A 3SZ6A 4IK7A 1AE6L 4XOCA 1MXGA 3PL6C 5FV1L 4ES9A 2B1AH 2WZ6A 3HR0A 1EZUA 4G5ZL 4FABH 2ZOKA 3JV5A 1SA0A 3ES6B 4TUYA 1AI5A 4DQOH 3TWYA 3P3SA 4AYID 5LGJA 2LP7A 4RX4D 3ISRA 4FFBA 3PGCA 5EBLA 1PLGH 3CC1A 4PDMA 3V7AE 2Z7ZA 4ZOAA 5I6NA 5BUPA 3PCYA 1H3GA 4WU5A 3K81A 1E4XL 1ORSA 5HD8D 4NXMB 2N4IA 3N9GH 4ZNEA 2X6AA 4QNHB 5BNXD 3RYFB 5DJCB 5D9SA 2HWZH 4EN3C 2XPZA 4NXSA 3EO9L 3Q4HB 2C1OA 3EG9B 4JQVA 2H2PD 4K8RC 3KYKH 4DR1O 5L4JA 4MKMA 4P4KD 3E6HA 5ALBH 5IW1A 3APMA 4XMLL 2AQSA 4HKJA 4P5RA 4DRXA 1LK2B 4JAAA 5DYFA 5K9JH