1V55B

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v55B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v55B02
4P5SA 1M57B 1A4AA 1NPNA 2N0MA 3NJJA 2PCFA 3S3DB 1L9QA 2MRYA 1X9UA 1A3ZA 1NINA 1JVOA 2CBPA 2HLEB 1V54B 4YSDA 2BWIA 5F7AA 1AZRA 2XU9A 3HEIB 1GY1A 3MX0B 1AQ8A 2ZWNA 1BXUA 3S8GB 1PNDA 1J9TA 5D4IA 1RKRA 3C75A 1BQKA 2J57A 4F2EA 4A2DA 1NICA 2R7EB 4W9ZA 1UATA 3EH3B 1E30A 5I6NA 3UGEA 3AW5A 4YSTA 2BZ7A 2XVBA 4AI7A 5A7EA 3ZIYA 2XLLA 3NP3A 3IE9A 2FNWA 4HIPA 1PLAA 2DV6A 2BHFA 1HAWA 1MDAA 1BQRA 1OE2A 4BWUA 1AACA 1QHQA 2LLNA 2YAOA 1L9PA 3H4HA 5I5IA 3BQVA 5E9NA 4JKNA 1NWOA 1XB8A 1R1CA 4E9YA 3X2QB 1VLXA 2VN3A 1OCRB 1EZLA 1L9TA 2QPDB 2UXVA 2BO0A 2WSDA 1IC0A 2PCYA 2PPFA 2AZUA 4ENZA 5I5JA 3T6ZA 1KCBA 3EH4B 2X88A 2JFCA 5I6OA 3FS9A 2HX7A 1I53A 1OF0A 2IH8A 3WKQA 4BK5C 4BWTA 4G70B 1KV7A 3MBWB 1ZDSA 1ID2A 4KO9A 1QNIA 1YLBB 5B7FA 4UANA 1ZDQA 2XXGA 4BWWA 2IDUA 2OV0A 1CC3A 1MZZA 3IN2A 1ILUA 1NWPA 5I6LA 4DPBX 4E9TA 1ET5A 2DYRB 3T6XA 4YSQA 1AS6A 4KOCA 1A4CA 3AG3B 1AZUA 2W8CA 4E9VA 5F7BA 4GY4A 3PXLA 2XXFA 1RZPA 3UAAA 1WA2X 2BWDA 4E9WA 4QLWA 4DP5X 4N4YB 4GYBA 1AS7A 4YSOA 1PY0A 1XMEB 2Q9OA 2EIMB 4AKQA 3GYRA 2X87A 5AKRA 1TU2A 2Y1AA 2WO3B 3X1EA 5PAZA 2EIJB 1FWXA 1NTDA 1E65A 1PNCA 4BDVB 4KNUA 1X9RA 2IAAC 1BAWA 1A65A 2J56A 1WA0X 1SFDA 1QLEB 3FU8A 1KBWA 1BYPA 3NSDA 1GSKA 5TK2A 1KYAA 1KGYE 1CYWA 2XV2A 1EHKB 3GDCA 4WKXA 3FU9A 2FWLB 2PP8A 2JXMA 1PLCA 2DWSA 2VM4A 2YQBA 3EF4A 3QJSB 3U25A 1ZIAA 4CSPA 5AFAA 1OOWA 2GC7C 1IUZA 3JTBA 4KO5A 3HB3B 4HHWA 2J55A 2XUWA 4KOBA 3NJFA 1DZ0A 2Y69B 2OCCB 2HXAA 6PAZA 2XYBA 3OMNB 2IDQA 2VM3A 2A3TA 1ASOA 4HALA 4JHVA 4YSAA 3CG8A 2QT6A 1NIFA 6PCYA 3TBCA 1NDTA 2CCWA 1M56B 1GY2A 3NJHA 2YAFA 4Q89A 1GS6X 3FPXA 4F2FA 2CUAA 2VSMB 3QJTB 3ABMB 3X1NA 1NIDA 3IBOA 2OJ1A 2EILB 5ANHA 3V9EA 5I28A 2BP8B 3PPSA 1PF3A 3X1GA 4A66A 2YAPA 4N8UA 2B08A 2EINB 1BEXA 2I7SA 3WNIA 2BW4A 3EH5B 5IY5B 3SBQA 2MTAA 4E9QA 3TBBA 5B1KA 3QQXA 1GS7A 1WA1X 4KNTA 1RCYA 2CJ3A 4QKTA 7PAZA 3FYIB 4DP7X 1FFTB 2GBAA 3L45A 4GP4B 4NERA 1AZNA 9PCYA 2DY2A 2H5UA 1GR7A 2IDFA 1JERA 1TKWA 2XV0A 4AKOA 1FA4A 4UAHA 4RH4A 3FYEB 1AANA 1ILSA 3NSYA 3SBPA 3NJKA 3N55A 3AZUA 1OE3A 2PPDA 1OCZB 2HRHA 4PCYA 1NIAA 3FSAA 4HZ1A 2CAKA 1ET8A 4W1TA 1SDDA 3UAEA 3FU7A 1B3IA 1SFHA 3S3BB 1ET7A 2PLTA 5B7EA 4DP9X 3D12B 3FSVA 1WAEA 1SHWA 4YL4A 2TSAA 4GP5B 3GXUB 1OCOB 3QJQB 1JZGA 4BDVA 2PPCA 1J9SA 1KDJA 3AG2B 2BZCA 4HCFA 1XB6A 4GXFA 3NJNA 2CALA 2E86A 2VW6A 2HX8A 1J9QA 3KW8A 4CSZA 2BP8A 1ASQA 4G7RB 2FT6A 1BXVA 3V9CA 1JOIA 1JVLA 4G7SB 3NP4A 1SF5A 3ASOB 1CYXA 4HAKA 2UX6A 2YAEA 2H47C 5D4HA 1N68A 1E67A 3NJGA 1JXGA 3X1BA 3T6WA 1JXFA 1BXAA 3QJUB 2FTAA 1SNRA 2XX0A 3H4FA 4E9SA 3NSCA 4G72B 3OD3A 2DYSB 2P80A 3DKHA 4UF7C 2J5WA 4HCIA 2YAHA 1M9WA 1OV8A 3CVDA 5I6PA 4KO7A 1V10A 4A68A 1GW0A 4GP8B 3T9WA 7PCYA 1N70A 1MZYA 1NIEA 1AZCA 2WO2B 3CZUB 2IDSA 2XWZA 5I6MA 4F7KA 2VW4A 3EHBB 2AFNA 2R7EA 3PAZA 3PAVA 4A2GA 5FC9A 4DPCX 5LDUA 4A67A 4DP4X 1OCCB 1MG2C 4NB7A 4WTQA 4X4KA 4AZUA 1A8ZA 2NRDA 2YAMA 3AG1B 4FAAB 2BW5A 2GI0A 3WKPA 2DWTA 1BYOA 1PZBA 1ZPUA 2ZOOA 3NSFA 4JHUA 4M3HA 1AOZA 3PAUA 5TK4A 2IWFA 4YVUA 1RZQA 4HHGA 3ASNB 2XV3A 3OMIB 1ASPA 3FSZA 1PCSA 2UXFA 4YSPA 3PCYA 4MFHA 1CUOA 1SHXA 1KBVA 3WIAA 1J5CA 3QJRB 1AAJA 1OE1A 3FPYA 4BXSV 3WI9A 2FT7A 2TSBA 3FT0A 4YSEA 5AZUA 2IWKA 4YSRA 1V55B 3H56A 3NJIA 1L9RA 5B1BB 2ZONA 4YSUA 2QDWA 1MG3C 3ZBMA 3RYMA 2JKWA 1W6LA 2P80D 3DTUB 2FQEA 1CURA 2IWEA 3UACA 1XB3A 1PZAA 2VMJA 2GC4C 3IN0A 1TEGA 4PAZA 2FT8A 1A4BA 2GB2A 3CDZA 4A2FA 1F56A 4DPAX 1AIZA 1JZHA 1J9RA 4EF3A 1BQ5A 3WG7B 2FQDA 2IH9A 4M4RB 3T71A 4YSSA 3QJVB 3TU6A 1JZJA 1PAZA 2GHZA 2HZHA 2FJSA 2RACA 1ADWA 2H3XC 3PLYA 4KO6A 5B1JC 1JZEA 2PP9A 1ZIBA 5B1JA 2B3IA 2GIMA 1AG0A 1WS7A 4DP0X 3S8FB 3X1FA 2UXTA 8PAZA 2AZAA 4DP6X 4AKPA 1AS8A 3T6VA 4BXVA 3ERXA 3FQYA 2BP0B 4E9XA 1DYZA 5B7MA 3NT0A 1ZV2A 1IBYA 4G7QB 3CVCA 3BVDB 1IBZA 1NIBA 3ABLB 2YXVA 3TASA 3CVBA 2HRGA 2IDTA 3OQRA 1E5ZA 3ZX1A 2GSMB 3OM3B 5EHFA 3OMAB 1E5YA 4YVNA 1IKOP 3AY2A 5PCYA 2UXGA 2FQGA 1J5DA 4Q8BA 4A2HA 5I6KA 1SF3A 2FQFA 2VW7A 3S3CB 3WNJA 2ZXWB 2PP7A 4L0PB 2YARA 4AX3A 1JZFA 1GS8A 4NAJA 3G5WA 5I5MA 3FQ2A 2AANA 2Q5BA 1WS8A 4DP8X 2BP0A 2HX9A 2QDVA 3ABKB 3SQRA 4TXVB 4ZK8A 1L9OA 4DP2X 2PPAA 1NZRA 1KCWA 4FA7B 4YSCA 3ZDWA 1URIA 1T5KA 1TEFA 2YEVB 3DIVA 4E9RA 5D4JA 1KDIA 2YAQA 3SBRA 1HFUA 1PZCA 4A2EA 1JXDA 2AVFA 1GYCA 3QPKA 1AR1B 2I85A 1ETJA 5B1AB 1AZBA 3NJMA 1PMYA 2XX1A 3KW7A 3ABGA 4HCGA 2VSKB 3CDZB 1AG6A 1SJMA 4P5RA 1HAUA 3N2JA 3IEAA 3UADA 4DP1X 5I26A 2QPEB 1NPJA 1SDDB 2YXWA 4G71B 2PPEA 3AG4B 1W6WA 4KNSA 1JZIA 1W8EA 1L9SA 3FQ1A 3NYKA 5B3SB 3FU7B 3TA4D 1PLBA 2UX7A 3UABA 2W88A 3FSWA 4K9JA 2I7OA 3NJLA 3JT2A 2EIKB
chains in the Genus database with same CATH superfamily
5K33A 4UNIA 1MCKA 4K55A 4U1MA 1T66D 2QTVA 5F7EH 3FN0H 1TA8A 3GK8H 4JY5L 1N67A 3UPCA 1NJ9B 1RLWA 1OT4A 4BCYA 4NTWA 3ZE0F 2DLTA 4GG6E 3RWFB 4N90E 4DPCX 3FCSB 1AZRA 3CFBB 5GS0H 4UQDA 3T08A 3VW3L 3BAWA 4FIPC 4FNTA 1JNLL 3PWPB 2ZWNA 3O4OB 4MA3B 4KQ4H 1X5FA 5C6WH 2YA0A 1ADQH 1BSMA 2W6JG 1UZ8A 1VERA 3ES6B 4PV1B 1HK6A 1S9XA 3OKKB 1NSNL 1EN4A 1T89C 1ZJAA 4Y1AD 1B0RA 1QLEH 4JBSA 5DUJA 4LL9A 3UGEA 1JOYA 4MX7A 3ZHVA 3GS4A 4WTXA 4B0MB 1IQWH 1NI8A 4Z0XA 1JTOA 4HCRH 3EUUA 2C26A 3GRGA 2LQTA 5IEKB 5H4ZA 1DZBA 5FO7A 5SWZB 4YHZH 4FZEL 3JWNH 5DHDA 1TZHA 4X4YA 4WIQA 4CVZB 2O6PA 1KNOA 5EC2A 2BNUB 3EJZC 3O6FC 1L9PA 2P8MB 1KYOF 5E9NA 2DYSC 4CVUA 3FU6A 1UA3A 1OGAA 3A4EA 3HFMH 5LMUB 4UQ3B 1GM9A 4B9IA 5BRPA 5IB2A 4KHPO 5IEHB 2CLVB 1TETL 3RVXC 3HFFA 5C0AA 1SJHB 4JI4B 1DUZA 4G59C 2BCMA 1FAFA 3G67A 4R8WL 3PHQB 2ZSWA 3OAAG 2AJ3A 3DHMA 5CBAB 1T22A 1C16A 4FMFA 3ZE1B 1YUHA 3VXRE 3LH2L 5KVDL 1NQBA 3FS9A 4FQCH 1GRJA 3I3DA 3BT0A 1MFAL 4CADA 4KO9A 5GJSH 1JV5B 4KTEH 2NNUA 4CMMA 2YPLB 1CC3A 5ALBL 4MD0B 5TDNB 3ZLQC 4U1HB 1BJ8A 1MWOA 4XI5D 1QAWA 3LRGA 4JI6O 2HN7A 4PRPD 1F13A 5JO5B 3VNYA 3KH4A 4YFLF 4FHJA 2OW7A 3OTFA 1O6TA 4WW1A 3MV8B 3NRFA 1X3DA 2P6JA 3C5SA 4W4OA 5HDBF 1LJMA 4I0PA 4ETQA 4XCYB 4HPYL 2WYTA 4F7MB 1UCTA 3LKOB 3O2WH 2YXMA 1QFUL 4DZ8B 4JAVA 4NO0B 1OCCC 4N4YB 3T2QA 2VT0A 1CLYL 2LW1A 3STLA 4NZFA 2WD0A 3U9UB 5LNGA 3JSLA 1JV2A 1NL0H 2VR6A 5ABAA 4FLZA 2UY7B 4RSVA 4MVRA 4NJAL 3ZHRA 1WWCA 1KJVA 2HG5A 4NQEA 3T2PA 5LP6B 4X8JB 2M7WA 4KJQC 5I6XB 3V0WH 1DBAH 2B5UA 1HINH 3KCPA 4WWKB 1J1XL 2E7BA 1SHMA 2YPLA 4HJSA 5TDNA 1BHGA 1FRGH 3FU8A 4ZDHA 3BAEH 5AEAA 3OKEB 3TM6A 2X89D 5DJ2B 3F5TA 1TVBA 1OKEA 3BSZA 4I9WD 1NLBL 2VB5A 5J89A 2J6EL 4ERSH 3UTZB 2EXSA 2UZXA 3K2UH 1J5EB 1BFOA 4UT6A 1OALA 5FHAL 1BA9A 4ZW6A 4UCSA 1K8DA 4X6DA 1TSRA 2CZNA 4I0XA 4G9FD 4ASUG 4EI6B 5LXVA 4DR1O 3TJEL 1X59A 3HRZA 4XNUH 3CJJA 3WLWC 2GKIA 2QL1A 4LARL 3DX9A 4KX7A 3HG5A 1H0DB 1BCIA 1FC2D 4JAMA 2JJTC 3DUSA 1XSIA 3VCLB 5IQOA 2WOYA 4QR7A 2HLFC 1N9PA 1JDCA 3BFOA 3KEHA 4NPKA 1AH1A 4V2BA 4Z7QB 1UPGA 4G9FA 4JG1H 3ZMRA 1B06A 1XZ0B 2MOVA 3FRPG 3BGFB 3M1OA 4CGTA 5IQ7H 4UTBH 1H9VA 1BFVL 2JKNA 1T83C 1BOYA 5LHGA 1G6RA 1F4HA 2YAFA 1G9ML 3I6KB 3FPXA 3HOGA 2YSUB 4JKPH 5I74B 3SIKA 2E5LO 3D07A 3P3UA 3QJTB 5JXED 1G9NH 2OQJB 3B2VH 1VF5B 2JK5B 5EMYA 3HG0A 1J0JA 4PJBB 4FG4A 5C0RL 5L2JA 2VXVL 5GRYA 5ICZA 2BP8B 1R73A 4MTGA 1SBSL 5IT9N 5JUEH 2F68X 4AZ8A 2XQYK 3QFJE 1EJOL 1BEXA 3U48A 3WHE1 2I7SA 1GMGA 4MB1A 3W9DB 4QRRD 1TENA 5J56B 2BY1A 4MA1B 4ZQKB 4MAUL 5D7KE 5B1KA 2IPTH 4PJ9B 5HDOA 2CM6A 3FU0A 4FTVA 4E2OA 4XPFL 5AW5B 1SMAA 4UU9B 2QWRB 4P5TB 5LAXA 4CC6A 4GQQA 2EDLA 5DZOA 4XHQA 5I8CB 1RZJH 5KJRH 2BTQB 2H5UA 4ANWA 2PWEA 2HJLA 4N0FA 3T8XA 2N05A 2BOCC 2LHAA 1WG3A 2X4QB 3OXSB 2ZUWA 3P1VA 3N55A 1OE3A 3OLDA 1FJGB 1P7QB 4XDLA 3P4OB 3OAZK 4PREB 3BZEA 2Y4UA 4L1LA 4X99B 1FXKC 1NH2D 3LDEA 2XFXA 1V7NH 1U8NA 1R3JC 2XKSA 3FF8A 3U2SB 2YD1A 2BHZA 2AJXL 2HFEA 2GFBB 3ZN6A 4U2ZA 3OXRB 1UXLA 4Z2WA 1WAEA 2R0WH 3THOA 5LMUO 5K9KB 5ISZD 4GP5B 1FYJA 3CK0H 4LKCB 2J2ZA 3C6LD 3MV11 4FQIH 4HK3N 3U7YH 3VRJA 3ZYZA 4ZW3A 2LLLA 4I89A 5C0BD 4K23H 4DAGL 3MXWH 3CX5J 1CDYA 3I3EA 2JB5L 3CZKA 4JDTH 3RUGB 2OL3L 5I15L 5I1CH 2ZAGA 2F0CA 3QCUL 3L3HB 3QYNA 1VHPA 2UXXA 4LBEC 5B1BC 4B3RB 5IHLB 4W9EC 2FUQA 3BO8B 4GINA 1BFTA 2XIDA 2ZUVA 1FFOA 3EH1A 4PJ9D 2VDLH 3RVUD 5IMOB 4PR5B 1KGCE 3JV6A 4G7VH 2WBJC 2C4XA 4G82A 1J9QA 5HJDA 4LSPH 2EUWA 5MP6L 5KHGA 4DZ8A 1NDGB 1Y0LB 1YY9D 3EYUH 3UTPD 3JALB 3KJ4C 3DV6B 3L72H 1MI5B 4TQEL 4L0YA 3MBXL 2A1WL 2XC8A 1G7LB 1I75A 1XGQA 4FFVC 5KYUA 3M88A 5TDPA 4IGBC 2WN2A 5T1DH 4X5WB 2R8SH 1LP9E 5D2LF 4PJ5D 3OAYH 3DGCR 4YXHL 4MMZB 3HMWH 4WI4A 1YYLH 4XN9A 3A5VA 2HLFD 5I8OH 3BA9A 1Q81W 3OD3A 4LF5O 4DW2L 1SQXH 5I24A 3GRBA 4ZRGA 5JPNC 1OV8A 2YGVA 3TA3A 3U36A 4HWNA 5I8CA 4P9PA 3G5YB 4B95C 1H5BA 2D3NA 3HI5L 3AITA 3Q8EA 3O45A 3P0YH 3QIUD 4MQXD 5TE7L 5JIPA 3ARFC 3BY6A 5FDWB 2EXYC 1R3HB 5JIIA 1KD1W 1QNMA 1RSOA 5LMNB 3H0TA 2E3VA 4CH6A 4MCZB 4PBWD 4U6XA 5IT2H 4EEQA 4A67A 3WB2A 1XDTT 4AZ8B 4JFWA 1MG2C 2E5EA 2IOIA 3V6ZB 5A2IH 3UPRA 2MNWA 2HVKC 5D5PA 4GIOA 4TUOA 3BDBA 1TU2B 5ECJE 4L87A 2F1EA 5DC2A 2J43A 1U95B 1LO0L 2YS4A 2FJGA 4OUUA 2CJUH 4HBQA 5JORB 2IQ9L 3QZBA 2IWFA 2EIEA 2CO2A 3A2FA 6CGTA 1IGIH 1PKQE 2VLJB 2GBTA 5D1ZC 5IHHA 4HLZH 1WD8A 4TN9A 1OK8A 3M8OH 3N0PB 5EEYA 2GIXA 5BXZA 4KXZI 5KANI 3JD2A 5MI0B 1GMEA 3IKCB 4R4FH 2A06H 1OP5H 1XBLA 1KXQA 1TTCA 1V3MA 2DBLH 2BK8A 4GSRA 4GXUM 3V4PL 4OZIA 2G3XA 4YJ3A 1IL1B 2KC0A 3L2MA 3N3EA 5DR5H 5AOZA 5EORL 3SPVB 2ITCA 4G6AC 3T4YB 2HVJC 5AZUA 5J9PA 2CKBB 3QIUB 4QXTB 3LDBB 3DROA 4IIZA 3GSQA 1DN0A 3NJIA 3LSQA 5FHBH 3GSRA 3ABKC 2PYEA 2VLRD 3ET9F 3EUDA 4YSUA 4ELMB 2WCPA 5GPRA 5L88L 1INDL 1LHZA 3IAPA 1KIQA 3O9WD 1U91A 3VXPA 1UFIA 5C2BL 1JZ4A 5SWZE 1YO4A 3M1BB 3ZDZB 5T1MA 3L6FA 5D1QC 2QQQA 4JPKL 3W2DL 3IE4A 5C9JA 3KLKA 4C56E 1ZRUA 2AAAA 1FFNB 3AREC 3FUJA 1TYJA 3P11L 2I32A 1U8IB 2V8LA 2VXTH 3RGVD 5HPMB 5E8NA 1YXBA 1MREH 2Z92A 5AOMA 1A32A 25C8H 4M1CD 4XP1L 4LVEA 3PXJA 1HQRB 3TO4C 1EAPB 1T0MB 2JS3A 1RFDH 3E2HC 4N2LA 3N27A 4NO0A 5EPMA 3VSVA 1A9VA 4HOWA 1KUQA 5FB8B 3QORB 2CO7A 1RM1C 2CK0H 5L4JA 5E6ID 3Q06A 3CMGA 5DJ8B 2FIRT 3MRFB 4LPXA 4WEMB 3SGKC 3MJ9L 3T8VA 1I7UB 3NH7L 3BCCH 2ETNA 4JMXA 1RM1B 5D7EA 1SEQL 1T03L 3RI5K 2HN7B 2BP0B 5F21B 5GS2D 4K94C 1EDYA 1ZV2A 1YEFL 2F7OA 4NVPA 1E90A 1WAAE 1BBJA 4WNSA 2EINC 2DLFH 2P43B 2VDRB 1VDGA 1IM9D 3AUWB 4YDKH 2YXVA 1AZVA 3MUGA 1IBHA 4HXBL 3SKOB 1ADQA 5ERWA 2CTWA 2JJWA 4WJKB 4X4XB 2DM3A 4AH2A 2DBJA 3TEUA 3CFCL 4GOSA 3A6BH 2OYKA 3JWNC 3HI1B 3DIDA 1UOVA 2XG5A 1Z5LB 3IDGA 4FXGB 4N0RA 5KBKA 3B2DC 1N7ML 4JFUA 4OY9A 5F8RC 1I8UA 3ZL4H 4GUOA 1UB6B 2EDTA 4DO5A 2OZ4A 2DMGA 3WNJA 1BW8A 2ZXWB 3H9HA 4PJGF 5ANMB 3T3MB 2FJHB 3ZHQA 2VXSL 2V6HA 3CDYA 5ITZA 5C71A 3IGAC 2CO1A 3FMGL 1QUNA 2BDNH 5INCA 1S9WB 4KX9A 3KPLB 5EV7A 3JV4B 5ALCL 5F7LB 2WTOA 2Y06H 3QEQA 3CYOA 5EZJB 1N8ZA 5D8JH 1WFTA 3AT9A 3BQUC 3VFWB 3FT1A 1L9OA 2LJ2A 1MLBB 1KCWA 1GGIL 3CH1B 5E4IA 4ZAKC 2MH4A 4R97C 1IGTB 3UEQA 3IGKA 1OAKL 5DSCA 4NRXA 4AEIL 2OL3B 3DYOA 4NQEE 5IVZB 5I1DB 2QPFA 3H8NA 1PZCA 2IM9A 1KCKA 1XR8A 3CFUA 4J7KA 1VGKB 1PG7W 3APNA 1JXKA 1J11A 5B1AB 5C0EA 3QJFA 4ODUB 2YHGA 3MMEA 3ROOB 3QR1A 4RMBA 4AV0A 2MKLC 5KJ7E 4UNVA 4E2LA 1FL3B 5J12C 3ZZLA 2LT9A 1LUWA 1SJMA 4GX2A 1H2NA 2XN9D 3FXIC 4KK6C 5BZDA 4GRWB 3NIGE 1XMWA 4UOW1 1EV2E 2IW5A 3ZIAG 4NQQA 4XCNB 1V3JA 3Q05A 4OD3H 1BQLL 1WTGT 1RD6A 1JF6A 4G71B 3QZNA 3S5LA 3AG4B 1ICTA 1MQ8A 1NEZB 1CTMA 1RJYA 4GIPD 1W8EA 4WO0A 1L9SA 1OAUL 2CDGB 3ASWA 4P57A 2H4EA 2UX7A 1ORQB 4LF4O 4NI3A 3ZE1F 3D51A 4QRBA 1ZE3H 5AW1B 5FA4A 2WLLA 5LO7A 2TRHA 2CDYA 3GBDA 4HUKB 4ZUWA 1C16B 5AAPA 1UWGH 3T0AA 5JDJA 1XSJA 1NINA 3KDMB 2W0XA 1FZMB 5HVFB 1GZPA 2DYPA 1PYWB 2CBPA 4ZMNA 4L3EB 3ULUL 4PA9A 4G6MH 1FLRL 3GMPB 5C0JA 5JR1L 1XD0A 1YMME 2WVTA 2IADB 1KJ3H 1GM7A 1J9TA 4AQYB 1NOAA 3CVHL 3N44F 1FYTA 3NCJH 4PS4L 1DK1A 5DWPA 3IMBA 1XIWC 1BLNB 1TCMA 3QO0A 4GKZA 3L9EA 4M6ML 4WSGA 1JGIA 2OCFD 4LLMA 2E8YA 2XVBA 4GRMB 3WN5B 3K57A 3GD1C 1SM3H 1ROPA 3RYFA 4S1RL 2Y5TA 5J6SA 1GH7A 3CDGA 3EDEA 4LLWB 1OP5K 4E5XG 2VDNB 2ZPKH 4FLOA 2LFEA 3SBWA 1VFAB 3UBFA 4BZ1L 2PYLA 1HCYA 4NO3B 5B39G 5CGYC 4H1LH 1NWOA 4NUGH 4X4XA 2WXNA 1MCRA 1EPFA 4NDMA 2C7UA 3T1YB 1Q9KB 1V54C 5BQ7B 4N24A 2VN3A 1ORSA 3CFMA 3CLWA 3L54A 1HSBB 4L5FH 3JWOC 1MI5E 4U1GC 4WUUA 2ADGA 3RL1B 1QFWM 1KN4L 1Q0XL 2JGDA 5FUZH 5HFMA 3U0ZA 1R1BA 2PCYA 5FF6A 1FXHA 3S37H 1QLEL 3E8FA 4HKJA 4U1SB 4BFBD 2TRYA 4N68A 1HHJA 4W9IC 2DWDB 3BH4A 1D7CA 2OSYA 3BKMH 5E08H 3NMEA 1GAFH 1KV7A 2R1YA 3MBWB 4I2XE 2OTUA 1O5PA 2GJ6B 1S7VB 3PQYB 1RULL 4FZEH 3IN2A 1ILUA 3O6FD 1PIGA 4NQSA 3SZKC 2UUCB 3ZX6A 4NQSB 3JD0A 4Y19B 4G43B 4GJTB 1A4JA 3SE3A 2K4WA 1A4CA 4HKZA 4MA8H 4ZUTB 2Q6AA 1SBBA 3U30B 1BF2A 3D39D 2UZIL 1BJ1J 4JFPB 3G5XB 1OARH 3QUYA 1LP9F 4OGXH 4IL6Z 1N59B 3L3IA 1W0WA 2ICWA 3BKJL 4I88A 1LP9A 2ZE6A 2MJWA 4D0BA 2Q3AA 1G84A 3UERA 4QHMB 3JD3A 3EG9B 1GCYA 1UZGA 1JA8A 1MCPL 3DROB 3PDOA 4BSVB 2P5PA 2UUBB 1RMFH 2D31A 2G38A 2X87A 5FXCH 4APQD 2X1PA 3R4DA 4WTZA 1KCRH 5I1GL 1NTDA 1E65A 4HEMA 1CFNA 1XEDA 4PY7B 1I9JH 1FAKT 3CLEL 2ZINA 2EKJA 4KKLD 4BH7A 4PJEE 2ZYIA 2ZUXA 1Z3RA 3VYPA 4ZS7L 4PJXE 1QU7A 1HHKB 1AJPA 2Y2WA 4KH2A 1ZVSA 1KGYE 4MCYB 4WKXA 4G1EB 4WUKL 1IM9B 4JRXE 3DWTA 2WINA 4YDLC 1DUZB 3GSXA 3OJ2C 3QJSB 1E3XA 4XB7A 2BNRE 3JWNG 1QFUH 4NBYB 4Z7QE 1MNGA 1RZIB 2X6MA 4OFPA 1KB9F 5AFAA 3SD2A 1NBVL 1JF5A 5LGJB 4YIPA 1E7VA 1KPRA 3SGDH 5GISL 4E68A 1YN6B 3QUXC 2R39A 1UXMA 1QFWL 3GBNH 5F9AC 5GHWH 5SWZA 5JZ7D 1DBAL 3NA4A 1XCTA 4R7XA 4PGCA 3U2JA 4KUCD 1QBZA 5DLML 4NZRL 1M56B 1GY2A 1KIRB 3DOSB 3HVDA 3NDZE 5H94B 3FCBA 5LN8A 3QO5A 3TEXA 1HR0B 2Y7QA 3PABA 1NGXB 4DH2A 4F2FA 5DEZA 4Y8DC 2ATAA 4M8QB 3WFHB 1WFNA 5DWUH 5KYXB 3FOMB 4JRXD 2J6EH 1JPST 4X0NA 3L4ZA 1W59A 2YAPA 5D7SL 4WK0B 4N8UA 1DQDH 1E43A 4HK0A 4FL4B 3BJLA 2QQKL 3D52A 1VQ9V 2X7LB 3MV7E 4KRPD 3IF1B 4Y16A 2J4WL 3CJHB 1CGWA 4YXWG 5GS1B 3BP6B 1RCYA 5I17A 3EFFA 4ZUUA 3QVAA 4OCWL 3L45A 1O9ZA 2APXA 1EHLH 3OPZH 5F8QC 4JG1L 5IZ7A 1ORQC 2DY2A 4XE0A 3UAFA 5I1AA 5DYFA 1TKWA 4NFBA 5IQ7L 1FA4A 2EDBA 1PP9H 3K74B 1VCAA 5IESL 1R0AH 1AANA 5T1LB 1ODUA 1G9MH 1GC1C 5AAMA 4J28A 4WGWB 5J6HB 5EBWC 3APFA 3O6LL 4Z7UA 2EE2A 3BKCL 2OMTA 2UUBO 3FSAA 4GO6B 3RDJA 3BD3A 4TOYL 4XXCC 1RP8A 4J27A 1SDDA 5KVGH 5L4MA 1S9KC 2WQ8A 1MFNA 3NCCB 4FNLL 4FE9A 4HT1L 1HNZO 4QHKI 1XR8B 1EJOH 4N6RB 3U0TB 2WNGA 4OFIA 2BVPB 4PMFA 2JV6A 1WGOA 2ENPA 3KGTA 2FTKA 4B3VA 5A16A 1BG1A 3HE6A 2W07B 2Q7HA 1FUNA 1KXQE 2FX9L 3IJ9A 3PY9A 1XF3A 4KY1L 4HS6B 4XPGH 3TIEB 1J0KA 1FAIH 2W59A 1XL6A 3SKNB 2C7FA 3HG1E 5DJ0A 3S5ZA 5KAQF 1VP7A 2OMWB 4P2CG 3HFML 5HYJA 1MY5A 1YAIA 3D8CA 4F92B 2E9JA 4DKEH 3WTSA 2AQQA 5FYLD 5J13B 4AK1A 1SLXA 2XWEA 4OGAD 3K59A 1PAMA 3ILPB 2R29H 5EBLA 2NY7L 3K5OA 4O4JA 4LF5B 3L1EA 3P4LA 2OK0L 5JQGA 5I1IL 4HSQA 5JDSB 1D2OA 5DFVC 3T4ZA 2J8UF 4PGDA 3GXIA 4J8RB 4FLTA 1OM9A 5IROC 4R7VA 3UO1H 3KWTA 1NQTA 2WXKA 4AYSA 1BXAA 3QJUB 3TA3D 1U6AL 3O6KH 2K9PA 2FGWH 3U7YL 1P53A 4P07A 1KU9A 1BZ7B 1UM6L 3NZHH 1UENA 5I1LB 3I02B 2Q3XA 4YDVB 3JATB 3HG1D 2CO6A 3TC9A 5I73B 5LXGL 4Y2DC 2FYYB 3VB9A 4DO4A 5I15H 4IU3A 3FUIA 4U1JB 3UTSA 5B4MC 1TLKA 1Z5WA 4PG2C 5H37A 5DHVB 3ZHLA 4JPSA 3BH8B 5D2LB 4LHUG 4J3BA 1ID5I 1FHGA 3O2WL 3D4GA 4WFGA 2WO2B 2Q6WB 5LL6Y 1F8TL 1G94A 2ZOUA 3EYUL 5HY9A 5JQ6L 2VW4A 5TDOB 1D5BB 2C9XA 2XAQA 4OIBA 5DI8B 4X5RA 2YUXA 3HZKA 1XEQA 4I13B 4Q6KA 4FTVD 1E0OB 4X4KA 2AW2A 3ZOAA 2F61A 1KJ2L 4JZJC 4PJ5E 4X7TA 2CK3G 4D0DB 1MIML 4QNPF 4Q0XL 1Y74B 4MVMA 2GI0A 4U2YA 4QY8A 1K92A 1FO0B 5GZND 5C0AE 4EUPG 2K7PA 2WZ6A 4XO8A 3RU8L 2HKFL 5JQHC 1MCSA 4HMCA 4I1RA 4MNQD 1KPUB 3GHPA 4HHGA 5DRNB 5KX5B 4MAYA 1RSYA 3TA3B 3U36B 4AIXA 1HP8A 1AHWC 1M7IB 2H1XA 2WXQA 3DRQB 35C8H 5BRZB 1F3DJ 4HC1A 1LE9A 2VWEC 3R06A 2DIAA 4GRWH 3IJ7A 4RESB 1F4WL 3PCYA 1YEJH 5L8KB 3NN8B 1IEAA 4JI6B 4KMLB 4OZGE 3MJ9A 5TDPB 3KS0H 3IRCA 3GS0A 1UEYA 3LNHA 4HUWA 3PNWB 3VFVB 3KPMA 1V3LA 2NUPA 3CWGA 4P3CL 1D6EB 2QDWA 1BFVH 4ICGA 4XBEH 3RYMA 3ETEA 4IOFC 1MHHB 4POZD 3NPZB 1NDMA 4P5TA 5LAXB 3UACA 4I3GA 3OKDB 5TF1H 2B0SH 2VMJA 1FFOB 5J0BA 1GVIA 4PAZA 1ZE3C 3I9PA 3OKMB 2P8LB 4NZTL 3O3BB 4DFIA 1IGIL 1JPSL 4DPAX 1HE8A 5EIVA 2IJIA 3VXMB 1X4YA 5BOJA 4KUCF 2GIYA 3JV0A 4HFWB 4Y5YA 2GHZA 2X4UB 1ACYL 5I30H 4MAUH 4LLUA 1A7PL 4NRXB 4F9LC 5IE9A 4BV1A 3CDCA 2Q68A 2JE8A 2GQHA 1KY6A 1JBJA 4W68A 2Z35A 3CV5A 2GJ6E 5AW6B 1VQKV 2MNUA 5IWAB 3BAIA 4K3HA 4FQHA 1PKXA 1F6LL 1XGYH 1HH6A 3SR2C 5BCAA 1F1AA 1CU4L 1ZWIB 2NLJC 2JTDA 1TQSA 4GSDH 4GI8A 4ODTH 2ZCEA 4ALAH 5T3ZD 2ZKMX 3ARUA 2N74A 3D4ZA 2CPCA 4OZGB 1CDGA 1I3RA 4N1CA 4N0FB 2VITA 2JDIG 2D8KA 1U33A 2ITCC 1YEGL 3WJLA 4TNVF 3BKYL 4IDJL 1SLVA 2AJXH 4FADA 2ADJA 1E4XH 3DX3A 3V4VL 3TVMA 3ARED 4QXWA 1HXMA 3K8LA 4PJ8D 4JRXB 4HWBL 5CEZL 2FYUH 3QF7A 2YIDA 2R0WL 4G8EA 1JGVL 3W39B 5GZOC 3CRRA 2XWRA 4HV8B 3DV6A 3B9VA 4AJ0A 4K23L 5LUMA 4M4PA 3MXWL 1BAFL 4K3EL 2IPKB 4JDTL 4KRPB 2CWRA 1P1VA 2I5YL 5DJYB 5E9AA 1FF5A 2DD8L 5GZNA 4U1JA 1FNSH 3OF6A 2CCVA 2BP0A 2YGPA 3PHOA 4KXBA 4Y5XC 5AWNH 3GRWL 3RTQA 4FQXD 1YF2A 4PJBA 2P5OA 4KRMB 3ELAT 1DSYA 2HFGL 3Q2WA 1H6UA 3HR5A 4TV8A 4BFOA 3MNWB 2YBRA 4IIQC 2R9RB 1FI8C 4CS3A 1QLRA 1EFXB 2DI8A 2OTWB 4OCMC 4TV3A 1X4TA 4X80H 1MCOL 4ZFZB 4L4VB 2WWMC 4W4KA 2XBDA 4PVBA 2MCAA 5IB5A 4F57L 2EULA 1YZZA 2MPVA 2VWJA 2AKRA 4WGKA 1Q0YH 1YYLL 1AZBA 2XTLA 3QQDB 4DKDC 5FFLA 2ETWA 3E2HB 4FM1A 2C9AA 1USZA 4G8IB 5IW6B 4MD0A 3MBEB 1OPGL 5IVXE 1KOAA 1KTBA 4HWEL 4LCCC 3UH8A 3X3FH 4Q58C 4F8LA 2L6LA 3DRQA 1WBZA 5TE7H 1NDGA 3IFOA 5F96L 4MTOA 1CS6A 1LDSA 1XF4B 1IJNA 1R24B 2E75C 4Y19E 3QT2A 4OQTL 4FP8L 5B38B 2Y6SC 2WK2A 3QIUC 5LDSA 1T0PB 3OUFA 2VUOA 4WSKA 4NT6A 2XZAL 5JW4N 3NACH 1SJHA 2FWOA 2IJJA 3E22A 2JIXD 3MJ8B 4JHAH 2HUHA 3EIFA 2QGCA 4HXAL 1A7RL 1KBHA 1QTPA 4J11A 1F58H 3WFVA 1CICA 1LO0H 3ECVA 3NJJA 4PRDA 2N4IA 4JFDD 3WHE0 4NQCA 1QRND 4XMVA 4KQ0A 2UV3A 3CX5F 1U8CA 5I1AB 5IROA 3MLWL 1MFCL 1V54B 1T04A 4MVQA 4OUUB 4Q9QL 3MODL 1Y1UA 5JHDE 3D33A 4WHDA 1AQ8A 3ZQWA 3DVGB 3L9RB 3EH2A 3GPSA 4TUKL 1KB5H 3VMPA 4OD3L 4F7EB 4XBFA 2DBLL 1AQDB 1G87A 1U4EA 2XTAA 3AEIA 4U6XB 1KB5A 3QULB 3R4RA 5EO0A 1S7WB 4JFED 2YUZA 5AVRB 4TV9A 2PW1B 3DX9B 3PREA 3JWNE 3AU0A 3MLRL 4U3JA 3US9A 2ILMA 3ZMZA 1KTDB 1UJ3C 2QSQA 5IM7A 3PHQA 2BNRA 4FTVB 5CN0A 2HP8A 1UWGL 1DL7H 3U6RB 2OI9B 4PTUB 2LLNA 3O8XC 3LIZA 4F8PA 5IR1A 2A74A 3MV9E 4WJ5B 4BFKA 5JHDD 4R26H 1FLRH 5E6RB 2B4CC 2P48B 1T7VA 1PBYA 3VGGA 1MREL 3N40F 5IWAO 2XIIA 3KXFE 4DEPC 4HOMA 4XBMA 3K46A 1V27A 1AGFB 3CVHH 2QVKA 1F3JA 2E6QA 5IG7B 5CLYA 3KL0A 3DXRB 2Q6WA 1ZHKB 4N8CL 1M6UA 4F8OA 3MREA 2XI9A 4CUCA 4W4LA 4KJWD 5CAYB 1FNLA 4I0CC 4Y1AB 4YNYA 3EH4B 4OT1H 5JMRA 2LGWA 4BK5C 5CBGA 3DX6A 3RWJB 2ITFA 2WNKA 3JATA 1YLBB 3DUSB 3UZVB 2VLKA 2FZ3B 4YHYC 3FCGA 4A7GA 6FABH 4ONGH 1WBYA 3CSYB 5BJTA 4BELD 4LCUA 4QKXB 3TO2A 1QCEA 3L7EB 4U1HA 4UZGA 2NX5B 3D0LB 3CFCH 1FN4B 3I50L 3A6BL 1I94O 1XEUA 2H8PA 2V0AA 4AIEA 5T1LA 1FZKB 2HG5C 4NN5B 2QKAA 2E7LC 4GY4A 2PWHA 4BK4A 5DJ2A 1N7MH 4JYAO 1CL7H 1PX4A 2PYEE 3FB5C 5EC1C 5CBAA 3NIFB 1CE1L 1AS7A 2RQ8A 5FUZL 1PY9A 2AV7A 5MEPB 3U30C 1YMMB 3IETA 3D1MC 3T1FA 3ZYJA 1H15A 4PYHA 5IK3B 3D25A 3BMVA 4DUYB 1TOXA 5D1XA 2NLJA 1KJVB 1NGYB 3WFEL 2ODIA 4FNQA 3LDBC 2Q76B 3HUJB 2FECI 4X9YA 2ESVE 1XV8A 1C7SA 3P3PA 4N2KA 3RRQA 5GGTA 1GSKA 4KV5F 2XV2A 1YNTF 2A83B 4QYOB 1GA2A 1FZOB 1OAKH 3LS5L 2OIGA 4JI8O 3LZFL 3MHSC 4JZNA 2UZIH 4PGZA 5FUCC 5I0ZA 4ZBMA 5TISZ 1BGXH 1AP5A 2DWDC 1MLBA 2YQBA 1IBLO 5AG2A 5A2FA 1IEAB 3SE4C 2EIZA 1B0RB 4HHWA 1DZ0A 2A77H 4X9FA 4WY7H 3TH2T 1IC7L 3GIZL 4EZLA 3MN8A 2DIBA 2X3BA 1KWKA 2OYPA 3K3QA 2P42B 2WLHA 2NR6C 4FJZA 2JGUA 3D48R 2BINA 2J1KA 2JKRM 5HPOA 3V6OE 1ZLUH 4AQ1A 4I7ZB 1I9JL 3CLEH 4NN5C 5D7IE 3VWKB 2HT4D 2WUCL 3WUWA 6TAAA 3QDGE 4TUYA 1KEML 3VXTB 4OZGF 4N21A 3WN5C 1HHKA 4CBCA 3HI1A 2HMIC 1NIDA 3ZW3A 4U05A 4WKZA 4UV4L 3IDNB 2RDCA 4PRAA 2JVDA 4MSWB 1BGYH 4KXDA 4ZBJA 1X9LA 1KBGH 1MN4A 2LE9A 2QM7A 4OGQC 1S77D 1DSFH 3JV5A 3SD5A 2MTAA 5ACMA 3VVVA 5DCCA 1SOSA 3QS2A 3Q2VA 4LBAA 4EEEA 2CJ3A 5E1AC 1J5EO 3HMXH 4HJEA 1J8HD 5DMKA 4K9EH 4BFFA 2F74B 1QQDB 1FL5B 1OGTB 4RWUA 3G9AB 3MV7B 5KAFZ 4M5TA 2AC0A 2EH7L 4DTGH 2YMXL 4JZOA 1N0LB 4GKOA 2ZWZA 2CO6B 1QSEE 2OMXA 4HKXB 3VAEA 2KZWA 1K72A 2WMPA 4QT5B 4OCLC 1FXVA 5GSVA 1NEZG 4QRRB 1AVMA 2CCLA 2HRLA 1JHKL 2WQUA 5KZCB 4IBWA 3WDJA 4EXPX 2BS9A 2WINB 1B3IA 3ILQC 4JRYD 5CBEB 5F3HB 1MFUA 5FCUH 1ZGLB 5DD0H 3T6QC 3IDJA 1PG7X 3BW9A 1GPOH 3V4UH 3QWRD 1B0GA 2JIXA 3TO4A 4JPQA 2JIXB 2CBTA 4Z3JA 3TYGL 4LL4A 4FTDA 5LCVA 2IH3C 1F97A 5DD5L 4UM8A 5CCGE 1PVHA 3F64A 2Z7UA 2NX5A 3A3YB 1ES0B 5E8EB 1Q72L 2CHXA 4HUNB 1E40A 1GJWA 4Z7UF 5J7CC 4YBQC 1NCCL 2WXOA 5I0VA 2A6JA 5KX5A 4P4RA 3O0RL 4TOYH 1JPTL 1R3IL 5JR1H 5EIBD 4PJEB 2VRQA 4E41B 1G4MA 1CWVA 3ISWA 4JFPA 1G6RL 3FTUA 5GIRB 1MHPH 3BUBA 3H1ZA 5JVDB 4HAKA 4LKXB 3GC3A 1KECA 5E1QA 1GAFL 2BCCH 4EFBA 2YKLL 2FEDD 1P49A 2V17L 3S96B 4Q56A 1M71B 1S7UB 2XVGA 3CZNA 1CGYA 3IDIB 5CN3A 1YN6A 2W0PA 5J1AB 1FDLL 4QHLB 5AG8A 1RUQH 1BM3L 3V0VB 3TFKC 3B9EA 3QUZD 3LEYL 3LQZA 4LU5L 1CD0A 2DYSB 2QTSA 4XC1H 2WSSG 5CZRA 5H6QA 3A67L 3T3PE 2EIDA 3QIWA 1OSPH 5DS1A 3VRLE 2E7MA 4G80B 3CTTA 3EHBC 5EUOF 1OTTC 2VRKA 2F8IA 3HNTL 5J6GB 2GK2A 3KPQB 3OF6D 5D93C 3QNYA 2LO1A 5EOTB 2A38A 4PRPA 4P9ML 1JS4A 3FFCE 5LA6A 3T04D 3JCZA 1VFBB 1WAAF 1BZ8A 3HZMB 3RX5A 5AVVB 1GZHC 3BZ5A 4J3OF 1QYGH 1U6AH 4NO2A 1AXTL 2FGWL 4JFSA 4Z7OE 1WRFA 2H3NA 5SV3A 1YMHA 4GW1B 5FK9A 5LXGH 3MX0A 1NGZB 2VAAB 1F1GA 1J8SA 4M3HA 1PU0A 2EAEA 4P5MA 4Z3GA 3V4PA 1YEIH 3CN1A 5TK4A 1VB9A 4MVBC 1HXYA 4ELDA 3D9AL 2DKSA 4MASA 4ZUSB 3CZGA 4PW3A 3QUYB 5E94B 1H8HG 1ENVA 1WV7T 3FB5A 3HCVA 3P9LB 5EC1A 3T3PF 1K5QA 3BPCB 5H2BA 3E8GA 4FZ8L 4JFFE 4QTHB 1F8TH 3TPUA 1K5NA 3GXPA 3FCTA 4JKWA 1W72H 3BGMA 5AUMA 3FH8A 4WFGD 4UQAA 2KKQA 3VFNB 1YIJV 1MHEA 5GISH 4MXQC 1QFWH 1VGKA 3CCQV 4GKJB 1V55B 1N0XL 2P28B 2WIIA 1K7DA 4OZFG 2YXFA 5GHWL 4C54A 4Q6IA 2BIMA 1BQHG 3VWJB 2VC2B 3ULVL 1CFMA 2RN9A 5I2IA 1AQKL 3MUJA 3KDMA 1MIMH 2LTQC 1QD0A 4IKJA 5KTEL 2OXHB 5CINH 3MXVH 3Q4HA 3BZFA 8FABA 2X42A 4Y2LA 2BFVL 1AKJA 1BMZA 1RUMH 3WTUA 3C5JB 2EEDA 4TQFA 3EJCA 1K73W 3QEUA 5LGUA 3KYNB 1P7HL 3MNZA 3D0LA 2VDKB 4EF3A 1DQDL 2FHFA 4ZODA 5E2WH 3WSQL 1BQ5A 4ZX6A 4OZIB 1LEIA 5LN4A 3VD2A 1ZT1B 4JRWA 2D2CC 1QHPA 5J11C 2J4WH 2WXFA 5KSUA 3CHXA 2W65A 3GSWB 1E27A 4X5XB 2X38A 1MOEA 4KHPB 4OCWH 3PJSA 1SOXA 4WWID 1ZTXH 1RFYA 1XQ8A 4B7EA 3GI8H 4JFYB 4MXQD 4K4KA 4KZEL 4BHUI 4P3CH 2ID5A 2EDQA 4G6FD 1B90A 2EABA 1N6QH 5IYBO 1ZSHA 2FBRA 3FQYA 2UXNA 4LNRB 1O7SA 1ULVA 1IAOB 3QHFL 5F3BB 2JK5C 1OAZH 3BKCH 5CILH 4P30A 4U6YB 3ZKND 5TF0A 1NOFA 3ZMSA 3FOMA 3QS3A 4TNVK 3CVHB 3A4DA 4GKKB 3AROA 1P84F 4ADJA 3N1PC 3AS1A 2Q3ZA 4J4PD 4BEIA 1EXUB 2P46B 3GSVA 4K8RH 4P4KB 2WNXA 3SJBC 3H0TB 4ODHH 5EZOL 3F84A 2JKSA 5F1SA 1EJ6A 2VTFA 5EEZA 3AS3A 1R9FA 5HHVH 4DEUA 43C9B 5DJ8A 4ILDA 4MKTA 3ULUF 1U92B 4NWTL 5TTRA 1NFIA 1R33A 5CD3A 4L0PB 2CA3A 4XPGL 4JYBA 4MYWB 4X9BA 4UCUA 43CAA 4N25A 1GS8A 3PPEA 3QBTB 5DEFA 2CG9X 5CB4B 4I0PD 3CVIL 1GKFA 2UXBB 2Q73A 4LNRA 3TL5A 5KN5B 1A6AB 4KJPD 3T5WA 4ODTL 3NFPA 4NQDA 5HPMA 4ALAL 3DIFB 1VQOV 4W93A 5BRQA 4TUYB 4UVAA 4XDKA 2CR0A 4LOUD 4IKLA 4Q52A 1L8DA 2P24A 1K8DB 2IF7A 1WZLA 5HDQH 2JXMB 2OK0H 1Z5LA 1YEGH 1HQ4A 2APTA 2RFXB 3BVNB 3CBRA 3K79A 1SYSB 5I9QB 2BSBA 3QDJB 4XOBA 4D9QD 5C0FA 4UTBA 3NIFF 3V4VH 5D4JA 3W1ZA 1ACZA 5I75C 2YXHA 3SBRA 3ZDZE 3QJOA 1BLNA 3L17A 3QO0B 4GKZB 4HSCX 4ODSH 4AE0A 1JWSA 3GUFA 1LWHA 3CUPB 3QA3B 2J8UA 4QTFA 1DVFC 4DZBA 1YTFB 5EBMA 5C0EB 1I1AB 1N36B 4FN0A 1SQBH 5BY1A 5DD6A 2EIKC 4LFCB 1HNZB 2K0RA 4O2FA 3IU3A 4HEME 2Y1YA 3GRWH 2OXHA 2K4AA 2VLJA 1F42A 3HNVL 2XA8H 5BV7B 4M1GH 1QBMH 4ZUTA 2ZUQC 5I71B 3MD0A 2R4RL 1NPJA 4XCYA 3ABTA 5CZVL 3NEOA 4B3MB 3PIQA 2FEEL 3PHAA 1ZLVH 2QPSA 3MRBB 4X80L 1KKCA 1F3JB 3ESMA 3C90A 2WTRB 1NEZA 1YUKB 4K9JA 3T2OA 5JW3L 1P5UC 4OGYH 3KVPA 3JT2A 1SXSA 1BV8A 4RMRA 3IAYA 1NGPH 3BPLB 4LLYA 5ID1B 2ARWA 2Q86B 2BJMH 4F4LA 1P7KB 4UI2A 1UFUA 2WAMA 4P5MB 4X83A 1HJBC 3SJVB 4L8CB 4DV6O 2DQTH 3DARA 1Z7JA 2VDPH 4RAIA 4APXA 5F89B 4HWEH 4ETYA 1TQVA 2BFGA 1W72B 3ENEA 4WTWA 2P5WA 5A2JH 2BIOA 2X6BA 4PHZA 1DE4A 3HEIB 4P2QB 1B88A 1MIEL 1S7SB 4HJTA 2WN3A 4AM0Q 4X6CA 4BAYA 3K0GA 4O02L 4DGWC 4L8SC 1U8MB 1MI5D 2P44B 4PV9A 5I6NA 2A9DA 5ESQB 4F93B 2BSKB 3FKUS 4LHJB 1VF5C 3GMRB 4M48L 2AQTA 3B7RL 1MLCA 5A2LH 4TNWF 4NOFA 4CKQA 3ZCCA 2XA3A 4E42B 4JHAL 2ZX5A 3VGEA 3B3IB 1M1KW 1A7RH 4MMXB 2YPKA 4XBEL 3V5HB 3IRPX 1JDAA 2EO7A 4I7ZC 4JI5B 3MRFA 1EBOA 4NQTA 1BQRA 4JAAA 1UGKA 4KJPC 3EXJA 5J4MA 3FF7A 3BH8A 3L9DA 4MQ7A 3LQZB 1G1OA 1MFCH 3BUQA 5I5IA 3K08A 1HSAB 4OCSL 1PZ5A 3MODH 1NMBL 2X40A 3NZ8B 4JQVA 1FYTB 1VPOH 1FNHA 1SLWA 4ATTA 2C1PA 4DN3L 5IYZA 2QKIA 5ESAA 4O5LL 3ETBF 1YEEL 4HOXA 4IHBA 1I4FA 4TUKH 4FYTA 5AVWB 1TQUA 5AW8B 3SJVD 1A7PH 4Q9RH 4K3DL 4PJ7E 4X6DB 2QJDA 2WVVA 2N1KA 1IEBA 8CGTA 3MLRH 4IGBA 1KP2A 4P2QD 1LGVA 4N8VB 1OSEA 2V7NB 1O7DC 1U8HB 2IWGA 1SXCA 4AXWA 1CU4H 3ETTA 2CGOA 3LVTA 1QNIA 2YRZA 1OEZW 3H42H 4NNPH 3S36X 3MLUH 4L8BB 4ZX4A 4L3CA 3QZPA 5I9QC 2MWCA 2YKKA 4WVRA 4OLYH 2DTSA 4G5ZL 3ZT6A 4ZMPA 3DTXA 1M1SA 2DDQH 4R26L 4FKKA 4XAKE 5B5EZ 5DT1L 4GBXD 3BZDA 4XCNA 3TWYA 3AG3B 2D3LA 2W8CA 4H44B 3V0HA 4YR6A 1MJJB 1QTSA 2G2RB 4A5UB 2Y3NA 4DUVA 5CEZH 2OMYA 4MYPA 3UC0H 1JGVH 2XVLA 4TTDC 3HB3C 4L8JA 2BWDA 4QOKA 1OLLA 1QVOA 2IGTA 4U3XA 5K39A 1ZPLA 2BRRH 3CFNA 1QLRB 1L0YA 2QM4A 1ZWIC 5F9DC 5GGTL 2XQBH 2I5YH 2OMUA 4RNRA 2P7TB 4K3AA 2W6IG 4JI8B 1SQQH 5DEDA 2AEOA 2FL4A 1AYRA 3CMEV 3FT2B 2G9KA 2NZIA 4KUMA 1Z1WA 3WL9A 1YEDA 1MF2H 5FA4B 2NXZD 4L8BA 5KS9A 1G7QA 4AC2A 3RE0A 4IRSC 3UZQA 4KZDL 5D1ZB 3GSNB 1CI3M 1U91B 3MRJB 4PCKA 5A1AA 1JYVA 1BYPA 5L2JB 5TQ2L 4WEUD 1OJHA 1YZBA 1F18A 4LEEA 2HLAA 4NAQA 4Y4HD 3T0EC 3TWCH 4IKIA 1H8EG 2HT3D 1YVLA 3BEWB 1S3RA 2EC9U 4FL4C 5AVTB 5KYWB 3AGVA 4HNAA 3ILEA 2N1TE 3UYRH 1FL6A 2ZP9A 3D39B 2CUGA 3T4YA 1JK9B 1OZUA 2V2XB 4HIHA 5CD5D 2VL5B 4MMYA 1CE1H 4U7MA 4JK0D 1JVKA 1ZLSH 3CZSA 2ED9A 3SDCD 4K7PY 2FATL 1HXKA 4K8ZA 5DHMC 2QSVA 1YEKL 2JJSC 4CA4A 1DF5A 1OCWL 2KPWA 5ID1A 5F72S 2B39A 2YXLA 5GRUH 2P8MA 1QWHA 3WFEH 1OP3K 3ZO9A 1UXWB 4APQA 3ULSA 3EO0B 1KB9K 4HJ0C 4EI5B 2NQCA 4HIIB 3FT3A 1J5OH 3H7LA 3ZRSA 4P23B 1KIRA 3DOSA 5FYKE 5ILTH 5T1JA 3S3XA 3RZCA 1NKRA 4U1LB 3CBJB 4I9WE 4FFTA 1BVOA 3QEHA 4Z6AT 3R7RA 3WS6C 4P4KA 4N26A 3X1GA 5I1EH 3D8MA 4FQLL 3I6GA 1Q5OA 1CFSB 2A9NH 5E23A 3FQNA 4JN1H 1DP0A 4JDZB 3RLSA 3VH8A 4ZSOA 4FRWA 2BW4A 3LN9A 4HIXL 3RVVC 3LNEA 4XTRD 4JYYA 3UQ8A 1TJIH 2A77L 3UO2A 1WA1X 4F91B 4FNSA 1A1OB 5T5NG 4LQFH 4PGDB 3MLWH 3PGDB 1TEYA 1W91A 1RXLA 2ERJC 3X12A 4QRUA 4DGYH 3RWFA 3SDYL 4MJ5A 3W7WA 4JG0L 4D6TH 1KTJA 1B6QA 3VBBA 2XWJB 4GBXA 3ABUA 2Z92B 2EDHA 4CW1B 4NYLA 5GGVY 2HMID 5F0LB 1ZL8B 3FFCA 1MCCA 4O58L 5T1KA 3JYCA 4EI6A 4WV1A 3KLLA 3KGUA 2FLRT 4QHKJ 1SFHA 4ELKA 2CR6A 3KYNA 5B7EA 1XI1A 2BZDA 2AHZA 5HHNA 4UDUB 3SY0B 4AM0B 1CZ8L 2WOBA 4D0BB 1KLGB 3VU2A 3VX0A 5TE4L 1KLGA 2G2PA 2ED8A 2HJKB 4N2CA 4BUGA 3AABA 3F8UB 4D8OA 4LIQH 4IRZH 4ZTPL 4ZMWA 4BDVA 3L5IA 5IQ9B 3ESNA 4YHML 5DDHB 2KB1A 4XP6H 3EHBD 1OF2A 1PKQA 1RLBA 2YMXH 2DW4A 4TUUA 4AMKH 2O6FA 2X2YA 2VLKB 4HCFA 5ESAB 3UDWA 1OGAB 4Y9FA 4W9GC 2ZXDA 4RX4A 2K78A 5EA0H 4ZTOH 4PJHF 5A43C 2GY5A 4IHOB 3DVNB 1QVOB 5K39B 1HEZA 3KS0J 3UBXG 4G7SB 2AQSA 2OCCC 1S7XA 4AIZA 4Y9CA 4FCHA 5IB4A 1CYXA 5AZ2L 4I55A 1A7NH 4AEHH 2OZNA 5EZPA 4FYQA 5ISZE 5D7HA 3FN0L 1G4YB 3BE1L 4KQ3L 1YMHB 3MA9L 4GW1A 3TJPA 2BSRB 2ADYA 1BT8A 4L3CB 1JZ8A 4ONGL 4OGZA 1AXSB 4C4UA 2FYYA 2NY4B 3MKGA 3OGCB 4P04A 4NQVB 1JYNA 1BZ7A 1A7QH 2G3NA 4F6EA 1QA9B 3C5ZD 3H3BC 1F4XH 3CVDA 5DEFB 4BZ2H 1JNLH 1B4RA 2VLRA 3BPOB 4N2OA 5ISZB 4HUXB 3EDJA 3V4VA 3PN1A 1VFAA 4K71B 4OJEH 1H3PL 4P2QA 2VO5A 3H85A 2A99A 1U41A 3S3PA 3VE0A 3LUTB 1CL7L 3UTQA 2K70A 2X0LA 2QQLH 5CM1A 3CZUB 1QFHA 5J2UA 2VN7A 4XN4A 5DZNA 4Z7OB 1XX9C 3KG2A 3D4YA 3K6SA 5HGAB 4UB0H 1U3HA 3WIFA 5CGTA 2UWEA 4LLYB 4KY2A 5DRWB 3JSNA 2DICA 4M29A 4Z1MG 4RAVB 4M93C 1DQVA 3CFEB 4PJ7A 5CSGA 2B5IB 1JK8A 2G4GA 2R0ZH 3BSHA 5HJBA 2XV6B 4YHKL 4NM4H 5H8DA 1OAYH 4ZO6A 2HLAB 3K5SA 1KG0B 2NY1C 2Y4SA 2GG1A 3QUKA 4JHWL 3LZFH 3BPNB 4LF3B 5E2UH 2O30A 4WFHE 2GITB 4MCYA 2X3CA 5SV4A 1I1FB 3WIIH 2NR5A 3UTSD 1M2VA 3VGAC 4X50A 3C5SB 1BXXA 1UACL 3S34L 2YIHA 4P9HH 3II1A 1MDTA 3HI6L 4R8WH 4OU3A 4EIZC 4JM0A 3IKKA 3ZN0A 3WIAA 2QELA 1OL0A 2YOAA 5CLWA 5E7FA 2GJ6D 4KKBC 3WDIA 3DO7B 5D70L 4KKZA 2O5XL 3DMMC 5B1BB 5GSRA 1NGQL 4UCFA 3K71B 2JI2A 2TAAA 1R3IC 1QYGL 1UHVA 3NCXA 1MG3C 5BRZD 1AXTH 3CZFA 2I27N 3JYBA 4X20A 2WUCH 3ZRWA 2H7WA 1NTMH 4OZHB 3L3DB 3IXAA 2WLIB 1Q1PA 5H6RA 3DTXB 3U2IA 4LF7O 1A5FH 4JFQB 1DJWA 2VJXA 3NCWA 1CMOA 2CRZA 2FDBP 4HPYH 1J9RA 1P9MC 5KHHA 1F4AA 2HTLD 1FG2B 1KBGL 1XF1A 2J44A 4KROD 5JCOA 5E5MA 4YE4H 3CFJA 3ROLB 2D7OA 1L1FA 2X1WL 3FB6B 3H9SB 2YC1A 1U96A 1DSFL 3FCTB 2GTAA 4FZ8H 4ES9A 1NL0L 1ADWA 2FLMA 5ADOH 4NJAH 3O3UN 4RO2A 1OWWA 2O5YH 2X0WA 2IXQA 1JZEA 3AU1B 3EJUA 1HIMH 3LMJL 2PP9A 3QW9A 2CBOA 4K9EL 4KXZH 1BZKA 3F7VB 3VSUA 4PJ9A 2BVQB 2G4EA 2UXTA 2D2CB 3GEWB 3K4ZA 3Q9QA 4N0UB 1IGYA 1CK0L 3L3OB 2MKWA 3O9OA 1IBLB 1EX0A 3W0WB 3GNMH 1DUYB 5FK9B 2AVGA 1BBDL 1UJTA 4K0KO 4OFYA 4TULH 4JFXB 4PRHB 3H1HH 1T3FB 4LVHC 4PJ7F 4KXRA 1JHKH 1R5IB 1SY6A 3TASA 1N2RA 3C5ZC 4FFYL 1NLBH 4LP5A 1AJ7L 2R29A 4LRIC 3GZKA 4MSWA 1DO5A 2W60A 4P23D 2GSMB 4AQZA 4XBPA 4MAZA 2WZPD 2B1GA 3I6LE 2VDRH 3P0VL 1RJCA 2UXGA 4PD4K 2W0LA 2XAJA 3WKNA 4Z7IA 2GJZA 3OT7A 3GJFK 4HH9B 2VW7A 4K73A 3TYGH 4LMQI 4GT7A 5ESQA 3RYFB 3V8CA 5KN5A 1ZTXL 3GI8L 2XJLA 1OV9A 1QR4A 3TNMA 5I5MA 1Q72H 2X70A 3QFDA 4H8PA 2HX9A 1CGTA 5C2UB 3ARFA 4QHLA 4WHCA 1T3FA 3B2VL 5F7DA 1R17A 5C0RH 1THAA 3L08A 1D6VL 3GBMH 1RP9A 2VUKA 4JQVC 4ODXB 3CB2A 2FIKB 3BQUD 4CNIB 4FA7B 5IFAH 1LP9B 4JZNB 4IMLB 4WU7A 5LYJA 4JI5O 1MHPL 5HHPB 5JUEL 1G5GA 3EOBA 2BP3A 5DURB 1EXUA 3DIVA 1RZ8A 3AQYA 2R9HC 4NKIL 4J7RA 3MGTB 1FNAA 4OKVB 5HHVL 4Z7NF 4NWTH 3QPKA 1FV1A 4HU2A 2LVCA 4WO4C 3JQOB 4XPFH 1BM3H 1U58B 2QTEA 4U6TA 1CLOH 5D1QB 4LU5H 3NJMA 3P73B 3V0EA 1FBIL 4W9LC 4YAQA 3RHWF 5IROD 1G7MA 5DXWA 3RIKA 2P47B 3T3PB 2R4SH 1RL1A 2ZXGA 4I18C 3ARDD 1IVSA 4MTFA 3T4DA 3RWEA 1K4DB 1BMWA 1HAUA 1AJNA 4ETQB 4GSQA 4DV3B 4P2RA 1JHLL 3D2UA 3ZXAC 4BGLA 2G60H 4K71C 1ZGLA 5FA3A 2JGDB 3F12B 4K35A 1RI8A 3JVGC 2X4OB 2ADGB 3CEIA 3QIUA 2VDQL 1HCVA 3FQ1A 1FCCA 4R9HA 1KYOK 4W6XB 1OQXA 1R5WB 4MD4B 1FPTL 1BJ1H 1V8HA 5HVWA 1I1RA 3ME0A 3AQDA 3PRZA 3N1QC 4DAGH 3ZHUA 2VKWA 3F7YA 2JB5H 4NO5A 3T0EB 2YMTA 2ZNWA 3CS5A 3N41B 1NFDB 1X9UA 1MG1A 2V3FA 2CKNA 1YEIL 4IRSD 1II4E 5BQDA 1E1RG 2O26U 1GY1A 4AITA 4DXWA 3CH1A 4X2UA 5DC0A 4LSPL 3VM7A 3RZCD 1A3QA 2VH5L 2XA8L 3TESA 4ONHA 3RYCB 3C60C 1WHOA 5E0QA 3EFDL 4JFDB 1UUSA 2FO4B 1R5VA 1BP3B 1TQCC 1AR1D 3ARBC 5HY9B 4CRPA 1EEZB 3ZIYA 3AWFA 4Y5VC 1E8XA 4PP1C 1F6AB 5EO1B 2XRAL 3RWDA 5IEKA 3Q6GL 4GX5A 5KTEH 1YG9A 4J5VA 3HG1B 4KKBD 5CINL 1ZSDB 4KV5E 4AW4A 5I8KH 1HAWA 2HG0A 4L2LA 7FABL 4S10A 2FHCA 5C09D 1MZFA 4JM2D 5F9OH 5HTSA 1WSST 3AS2A 3STZA 2BFVH 3THML 3FDWA 5GTIZ 4ZOCA 4G9DA 5KYNA 3ABZA 4LGSB 3OX8B 3I02A 4YDVA 2B4CL 3B2UC 2G30A 4BIKA 1LWJA 2DQ0A 4BQ6A 3G6BA 1Q9OB 4OCYH 1UM4H 5AB1A 2AGJL 2EDDA 1PTZA 1SESA 2BSSA 5F2VO 1AFVL 4UQ2B 4BKTC 2UXVA 1QUPA 3H1LH 4BR6A 3QXDB 4L0ZA 4YXLL 5JYLA 5M95B 1AI5A 2DE0X 1RIVH 2E5LB 3RY6C 1QFWI 4RFNB 3U0PB 5M94B 4P2RD 1KN2L 1NMCB 4IKNA 4LLMB 2V4DA 5AW3B 1I53A 3RY5A 3MHZA 1AP2A 4YHIB 2EUZA 1NCIA 2CJUL 1E5UI 3ARZA 3V0VA 1LVEA 3ORJA 2IDUA 3JVGA 1OAZL 5IFJB 3EJZD 1G7MB 2DI7A 4DPBX 2JCCB 1ETA1 2NXYD 1XAUA 4KKCD 4TQHA 4EKJA 4QRRA 4GKJO 1U8IA 5C0ND 1AS6A 2JSFA 2WMPB 4XI5C 3M8OL 5T3ZL 4X4ME 2ARJB 2CO4A 5B38A 3U1SH 1YEEH 5F7NC 4PJEA 1ROWA 1WA2X 3V4PH 3U9PH 4RWYL 2OMVB 4K3DH 1MRDL 2LGQA 2ZR3A 2WIIB 3EYQC 2NTSP 3HKEA 3CSBA 1KEGL 1J5IA 2WYZA 1WUNT 1XGUB 4P2QE 5LCVL 4PLNC 5GZOD 4UYPA 3WTXA 4JCWA 4ACPA 4R2GB 4B50A 1SOQA 1V3KA 5D5MF 2ATPA 1MJ8H 2NX5D 4G8IA 4IGBD 4AL8L 1C8QA 3VG0H 1INDH 3C2AH 4LCUB 4F1SA 1PZSA 4QRSA 3H42L 1MNNA 3FUFA 2P5EB 2X4PA 1A65A 3W2DH 1P5VB 1DHKA 5FFOA 4YXKH 3QI9B 3ZSTA 4Z8FL 4WFHA 3QDGD 1H8SA 5JJNB 2EEXA 3B2MA 1B3JA 2OULB 2HLDG 1BD2B 5FKAB 4G28B 3VXMD 2VXTL 2DDQL 3BSGA 1D5MA 3IS0X 5EIIA 4MNGA 1RAMA 4HP5A 2H94A 2QA4V 2OXGB 25C8L 3EYOA 2BNQD 3ZK0A 2JKLA 4JRYA 1PLCA 2ADIA 1CE6B 4O4YL 1N36O 1ZANL 5CMAB 1OZTG 2IGFH 4HK0B 5AVXB 1KGWA 2YIAA 4LH7A 4F6RB 3JTBA 4OF3A 2CK0L 3TH4T 3BH9A 2J55A 1HC1A 2WPGA 5D96B 5GONB 4DV3O 4MNQA 1E1QG 3BLKA 4Y1SA 4ZI7B 4PS7A 3BABA 2YPLD 4WCEV 2X6CA 2HFFA 2WXGA 4PS8A 4U3FH 2AI0H 2CIIA 2EECA 2N01B 1Y4MA 5CMUA 1SEQH 2R69A 1T03H 1KXHA 4JHVA 3VYOA 1MF2L 2EEAA 3TCTA 4MJ6A 3HNVH 3VQWA 2DLFL 2WBJA 1Y6NR 3VXME 3O2VH 2B15A 3QEQB 5EZJA 1RZKL 5K1PA 3PWLB 5CZVH 1DVFA 2Z4QB 3EBHA 4HZLB 4WCYH 2E7DA 3IBOA 3TWCL 2AMGA 5IIEA 4RUFA 4LF6O 3FB6A 1RUKH 4F9LA 4R0LA 2Q67A 3AM8C 1FNEA 2OR7A 2XHNA 3FH5A 2NLJB 4XZ4A 1AHWB 4LCCB 1AVAA 5IOPA 4MMYB 3H6AA 4HH9A 2VR4A 1PG7H 5GIRA 3PJSB 3K8KA 5DO2C 4YHNB 4J3SA 4QKTA 3IJSB 2WBKA 2DQTL 3FMGH 2FL5B 1UA7A 2DOCA 4BH8B 1AY1L 3L5HA 1JERA 3UIZA 4JI3O 2H2SD 2NY6D 3LKPA 3RVTC 4M03A 5E4EB 3A6CL 3QEGL 3PFUA 4MXVF 1UJ3A 2KS0A 3UJTL 3WFDH 4O02A 2UVEA 5SX4I 3BT2H 4UV9A 1XD1A 2LU7A 3ZDXE 5DYOA 3UAEA 2AJZA 5DRZA 1J05B 2R2EB 2WYIA 5FCSH 1JN6B 1LO3H 2X4SB 3MV7D 2R0KH 1AE6H 1B0GB 5DM6V 3BP4B 4MRBA 4OLUL 1NA8A 1SHWA 2G5UA 1YNTB 4E4EA 1JZGA 2JCCA 3TGXA 2A6DA 2A9ML 1Z0NA 3CFIC 4L8DB 1D5AA 1OP3H 1XB6A 2WBWB 2ZKHL 5DK0B 2VW6A 1P7QA 2OMZB 4LOFA 1JCVA 1I85C 4Q9RL 4GG6A 1LQBC 3UBGA 4GG6B 4UB6Z 4IMLA 4CH3A 5C6PB 3L9YA 1LILA 1MCDA 5BVPH 3L70H 1EDHA 3S9DB 2DQIH 3VD9A 1DVFD 2WVVB 1PQZB 4LNUA 1RHHB 1KP3A 4BINA 3DSNB 4R4ND 3RJDA 4G8AC 4Z3HA 1N34O 1VFBA 3N41F 4D0DA 2N04A 4FNPA 5K9JH 1IJ9A 2FZ3A 4ODBD 1MH5B 4V1DD 3ULUH 1HL8A 3SGDI 2WZAA 2PKDA 1P7QD 1ZS2A 2HT2D 5C09B 5DT1H 4J4PA 1R3JB 3CFDA 3SYOA 1QZ1A 4A68A 1JQ0A 3R0MA 3T9WA 3UP6A 3VVWA 3HPLC 1CD1A 3NCJL 5KSVB 3BIAX 3P9MA 1JAEA 1NIEA 4KL1A 4X6DE 1QR8A 1H2MA 2X53A 3MVSA 5MEOB 1MFEH 3LRLA 4R83A 1S7XB 4AIZB 4XT1C 1E4KC 1RIHL 1B6UA 2GI7A 4F9PC 2FO4A 3WB1A 4LR3A 4EN3B 4OLVL 3CQFA 3WXWH 5EC2C 1BZOA 3DXAE 4AEHL 4ZQTA 4X0KB 4L48A 4PJCA 5HHQA 4FLYA 3MA9H 1IB5A 3AG1B 5E9DB 4X66O 1X7SA 4HUUA 5JHMA 3SGEI 4BZ1H 1SPDA 4N0UA 1H3UA 1UG9A 2OSLB 3RVTD 4BFRA 1VKXA 5DJCA 4MSWC 1F86A 4OAWA 4TNWK 4J9YB 4JPWL 5IHUH 3K0WA 3GBLA 3QZLA 5D2NB 3VTMA 4FPPA 3NAAH 3RTLA 4HG4K 2YC1B 1DBKH 3TXAA 4D7BA 2CNZA 2DM7A 1I7RB 3L9BA 1BEYH 5I1JH 1XFPA 5FYJL 2NNFA 1ZLSL 3AVEA 1UA6L 3OUSA 1SHXA 1T1WA 4JM2A 4UIMA 1C08A 4BXSV 1YSOA 3WI9A 4FTVE 3WGUB 3FOLA 4FFKA 5DJZB 2EYSA 5DZJA 1PZ2A 4PIBA 4OZHA 2ITDA 2Z7WA 4WO4A 3K81A 3QHZH 4DEPB 4IJ3B 3SGIA 1S9VA 2APFA 4NKOA 4F5CE 4I4WB 2P4VA 5LGHH 4LWSB 1F4YH 3PDGA 1E6OH 4NM4L 4WHYH 4MNQE 2CHZA 5KLVH 1NMAH 2KLTA 4TV8B 4PB9L 3TBWA 3M7OA 2DRUA 1AGBB 1HKLL 4X6BA 3UTSE 4A7QA 1FKAO 1AGBA 2A9NL 4JHZA 1A21A 4X6BB 3FQXA 4RAUA 3RTQD 4NAMA 4WEBH 1S3KH 4XRCB 3EKCA 3TU6A 1FJ1B 3PWNB 1HOCA 1K2DA 2EDRA 3P2BA 4K0KB 3FN3A 2V7QG 1UCBL 3PU7A 2VRZA 1F4MA 4HOZA 5AYQA 5H9CA 5CKAA 1HX0A 1MSWD 4LHUB 4LKCA 2QVMA 3IDYB 3LB6C 1TVKA 3KCYA 3LRMA 1ZXQA 4M43L 5E99H 1L6ZA 1RMFL 2B3IA 2P5WE 3ECBB 3VMOA 3WYRA 2QTOA 5I73C 5D6DC 3U4AA 2CUHA 2ITDB 3F5WA 4GXUN 5AKSA 5DVNA 1IX2A 4B6ZA 1NGQH 5E5RB 3SDYH 1TZAA 3VO0A 3NFSL 2UUAB 2ZUQB 4E9XA 4I4TA 3B83A 4URKA 3C08H 5F6IC 2QLVB 2ADQB 4O58H 5EUOA 1IBZA 1QABA 4U0QB 2HT2C 2NZ1A 4GAGL 3T0WA 1YHPA 4M8RA 4K7PH 4OJAA 2GJZB 3ARDA 3FTZA 1IKOP 2YLHA 3DV4B 3C60A 3OR7A 5DVMA 4UOW0 1IAMA 3IDGB 1T4KA 4JKMA 2BOCA 1BECA 3O6FB 1C1EL 2VYRE 2KG7A 2FQFA 1WAAA 2O5YL 3S3CB 3VFGH 4OZIE 3GBNL 2WUBL 2EDOA 4TPRL 2PCFB 4NAJA 3HPLB 2V9QA 4TS6A 2I69A 5C8YA 2K6WA 3TNNA 3KCPB 4Z7VE 1IZJA 1KY7A 4F3FB 3RDTD 1T2JA 5KVGE 2VXUL 1BBDH 5T3ZE 1WA8A 2DWEA 3NIDB 5DQ9B 4AQ1C 2ADPA 3D36A 4UILH 1MW3A 2EXWD 5DWUL 2ZP0T 2C2AA 3IMTA 4AG4H 5BS0B 2NY6B 2PO6A 3E86A 3HAEH 3X3GL 5AZ2H 5EF1A 1VQLV 3ARDB 4NZJA 3EGDB 4IHOA 2XICA 3RZWA 3T77B 1WIUA 2JKXA 4O4JB 4GRLA 2ZQMA 1CYGA 3U10A 4I0PB 3L4XA 5EBWA 4QYAA 3BE1H 1JXDA 4KQ3H 3MV8D 4XWGH 4DESA 1NGYA 4S0HA 4M1DH 5L0QC 2DH3A 3IK2A 3LSUA 4PLKC 4H2CA 3JTSA 1LM8V 1WP7A 2VC2H 4TVPD 4H8HA 3WV0A 1ZWIA 5AB0A 2OX5A 2RH0A 3ABGA 4XOAA 2O6EA 1Q6IA 4XNDA 2OMWA 2ZOTA 2WSKA 3E8VA 4DR3O 3WHXB 3CDZB 2PO6D 4CADB 3HPJA 3LKPB 4QF1B 4FCAA 1LE9B 1CBVL 1FIGH 3G08A 4QRPA 5CA0A 5HHOB 5EDXA 3D3VD 4M6OH 3WIHA 3OC8A 1JHTB 1NH6A 2WZ5A 1X5XA 2XWTA 4F2ME 2YXWA 2OCJA 1EEYA 4FNLH 1NAKH 2DQHH 3F7QA 1JUFB 5F0PB 2BOBB 4KNSA 2R1XB 2UUCO 1CQYA 1TUPA 1Q6UA 5B3SB 4JY6A 4JV5O 4GQRA 3JWDH 4FOMA 2I9LB 4K3JH 4ZNEE 1EXGA 5F1IB 2XBTA 3C6LC 3SGKA 4M9OA 3LIZH 4MZIA 2FX9H 4O00A 4HBCH 3S3DB 5A2KH 1YNTA 2GEEA 3D85D 3DI2B 1NCJA 5E6IC 4N2MA 1RZ7L 4ZFOA 3PGDA 4U3CA 5BPPA 4TM9A 4J80A 4JHWH 1YTFD 2NQDA 5J5EA 5E2UL 5CJ5A 2HLEB 4DRXA 2W94A 1QO3B 1TGOA 2DF3A 4NQCE 3W9EA 3CC4V 3V4PB 1FNFA 1UWXK 3HG4A 4PMEA 3A0RA 1NBMG 3RWCB 3S8GB 4E41D 1JHLH 3U46A 4XMUA 1YY9C 4ZMOA 5B3NA 4RGND 1LMIA 1RKRA 4EQ2A 4P49A 4C58B 3ELQA 4P23C 4MGXA 5FGCB 3I5DA 1IKFH 1BLIA 5KSBB 1U8MA 1NBZB 2PXYA 3DPBA 4OF0A 2DJMA 1I8MB 3LEVL 2O5XH 3D3VB 2OI9C 3D36C 4X6DF 3EF7A 2FJFA 3D09A 1PCXA 2DV6A 3NGBB 1E4KA 4Y2OB 5DC4B 4I85A 1UM6H 5FM5M 5TH2A 3P0GB 5CEZD 5KSAC 2N3JA 4ZMZA 4NPYB 2VMCA 5ICXA 4DR4O 1A5FL 4O51B 4XPTL 4YGAB 2C34A 5IEHA 1INQB 3NGBC 3SKUD 3TCUA 4JKNA 2X4PB 2OMZA 4I48A 1R1CA 5IHWA 4E9YA 5DK0A 4A7UA 4R7DA 4RRPG 1T89A 2VH5H 1UXSB 2ICEC 4L4TA 4MW3A 4GLRI 3M86A 4WK4B 1I5YA 1R6TA 5ADOL 3RX9A 2UY6A 1OAXL 3PJNA 1P2CA 4DOHB 3EFDH 4WO4D 1EN6A 2C9QA 5T3XH 3CLFH 3TT1L 3GSNH 3N2KA 5LXTA 1R47A 2Q1EA 5I5JA 1SY6H 4FD0A 5AQ0A 4KC3B 4M56A 4NQCB 4PCSA 1I08A 2DQGL 4S0TD 4RFOL 1VESA 4RGNB 4BWTA 2CRYA 3LKSA 3BVTA 7FABH 3REWB 5CGYD 1RU9L 1U8QA 5KOVC 2EZ0C 5F9OL 3FT2A 1OF2B 4WF9V 1I1AA 2HKFH 2B5IC 3HTLX 5EU7E 5AALA 4B9JA 4QTIH 3MV9D 1WQVT 4F37K 5I1KL 2B4CH 4PJAA 3OKDA 4HWZA 2X0VA 3A24A 3BWAA 1WPBA 3MC0A 35C8L 3HBQA 3GWKC 2IQAB 5FFGA 3V0DA 2PCPA 2Z8SA 4QRPB 4PYGA 1XWVA 1KB3A 2LV4A 3BX7C 3O65A 2Q8BL 3GZOA 2MQGA 5KS9E 4YR6B 3ZTNL 1VEMA 2B14A 3QDJA 4JFZL 2AABL 4OQ1A 2Y25A 1RSFA 1X5JA 4PBXA 5EEWA 2WAHA 4LF7B 1U8NB 4YSOA 1OW0C 1XMEB 4NI6A 1C08B 3KPSA 1K8AW 4PV1C 3L1FA 4KJWC 4JR9H 4ONFH 1E9QB 4KHTH 2DWYA 4DKFH 1EUTA 2KUTA 2QR0B 4LCCA 4N8PA 4ZX5A 3VI3E 3EO1A 5IOPB 5HSFA 5I74C 1JD9A 2DQ6A 3U4EB 2ZKOA 3X1EA 3L4VA 2EIJB 4CMHC 4P9HC 2GV9A 3SJQC 2APVA 4GUPA 4PJHB 2WWOA 3MZTA 1XGTA 2ZE5A 5DJCB 5L4IA 2AQRA 5FPIA 4DF9A 3IAQA 1F1DA 1JPSH 3VJ6B 2AEWA 2VIRA 3DBXA 3Q5OA 1ZV9A 4MBRA 4K5LA 3HR5B 4YHOL 2Q69A 2EXYD 2VISB 3U1SL 2D03H 3BUIA 1CXLA 4MQXC 2VM4A 1CJYA 1IZ3A 1ACYH 5LG1A 1WHPA 4HIEB 3U25A 5I30L 1DQJA 3SDXB 3MV9B 3HC2A 3EYSH 4GLXA 1ML0A 4RISL 5B8CC 1IUZA 1KLUA 2NT1A 3IB4A 5DD3L 5DMIH 4DVBA 1KEGH 1CLOL 2XUWA 3B1TA 5C3TA 5I76B 1FBIH 3PQYD 3OB8A 5KA5A 2AEPH 2UWEE 4YHIA 3H54A 4G1MA 1XCQA 2EIBA 4YO0B 1I7FA 2HRPL 5BZWA 1EHAA 2QDOA 4QXGH 2BVEA 1PSKH 4FZ0A 3EYFB 2FCBA 2QT6A 3CG8A 4P5KA 3I9AA 5LHIA 1NDTA 4UDTA 3PXHA 5D2LA 3P69A 1WAZA 3B1UA 1W80A 4H20H 1YCSA 4NLAA 2KQMA 3LHAA 3UMTA 4H8WH 3EOTH 3BKYH 4IDJH 5I28A 5ANHA 5DEGA 1CFVH 4AH2B 2OP4L 1EZVH 1GSMA 4FG6C 1MJUL 2ZSVB 4HWBH 1F90L 4HS3A 1S7RA 5D7JA 5E1AB 5ID0A 2Z93A 3A0BZ 4WI8A 2MOGA 3P77B 4OZ4A 3OMZA 3FFDA 1F2XK 3WNIA 4WAFA 3W7TA 3X14B 1S7TA 1BAFH 5E8OB 4H0LB 3UXFA 5IQNA 4A6YB 2YPLE 3BAJA 3DDGA 4Y4KB 3VSTA 2DD8H 1Z66A 1FNSL 1A14H 2VMEA 3MRJA 4CSTA 3NCBB 2W81C 2VZTA 2ZXCA 4GP4B 5D5MA 3N04A 5IJCC 4BUHA 4W9JC 4ZD3L 3CMAV 3VD7A 1CB4A 4LPVA 3TYFA 1WZ1L 2AEQH 3F3HA 2DQ3A 2PPDA 3D50A 1SYVB 1GTOA 3ZE2B 1JFQH 2ZT9C 1CE6A 1KGUA 3FU7A 4XHJC 2O93L 4NRZA 4WV1C 3TPUB 4M3JA 5I0XA 1UOWA 4B96A 4OJDH 3M6DA 5FO8B 2JWYA 2IAMA 3E8BA 4FLWA 4LLQB 1Q0YL 2HFTA 2ADFL 4IHJA 4JI7O 3R1GL 1B0WA 3H9ZA 3P4MB 1F3RB 3ZYOA 1JIBA 3U1QA 4OZIF 4P3DB 1DDHB 3SEPA 1DTOA 3QWQB 3BWAB 5AOJA 1AY1H 4AYDC 2X10A 3ARFB 3HAEA 3ILDA 4PLJD 1Q9KA 1UM4L 5CZKA 2PY5A 1T1YA 3NEXA 2QVTA 1JJ2U 5AVQB 1T2QL 5GRXG 2QE7G 3K72B 4JO4L 5CJBA 1AFVH 5TFSL 2RCSH 4CSZA 1M6OB 4LSUH 4FP8H 5EU4A 3W5MA 4YXLH 2DEYX 3LEXA 4X9IA 3V9CA 5BS0E 3G6JE 3RL2B 2UXBO 3AJ7A 5IVZA 1P7GA 2XZAH 1I1FA 5F88B 4UM9B 3ZMUA 5SWSB 3OB0K 3HUJF 1H2SB 4DV6B 2W5PA 5HHMB 3ZKSD 3S35X 3MGOA 5K69A 4R3SB 1AE6L 4OFVA 3H1IH 2MHAB 3DRTA 5A9GA 3C12A 1TMCB 1P6AB 1NAMB 3AY4C 5AVYB 1GYWA 2FTAA 5DN6G 4IU2B 3QO7A 3N06B 1FQ9C 5AAWC 1CT8B 4YHPA 3FTGB 4YWGH 3WLBA 2A9MH 4FX5A 4PRBA 2YAHA 2C4FU 3O9WC 4ANKA 2IADA 4KXCA 2ZKHH 5DJ6B 4GP8B 3IGLA 1KB5L 2FIKA 2H26B 5AAMC 4CDGC 3AMLA 1MZYA 2V3EA 3LN4B 1ETZA 2DLIA 4RWYH 3U9PL 4RIRB 3GSVB 4Y8AA 4MX7B 4JFTA 1NCNA 4GSUA 1OB0A 1UOLA 3LDCA 3QC5X 1SETA 5LLIC 3Q8CA 2Z0AA 1I8MA 3GTNA 3WXVH 2DQIL 2ATKB 4PGEB 4U7SA 3VG0L 1CXZB 4XP5H 4WTQA 1ZUQA 4P8QA 2YLKA 4NQVA 5HDWA 1A9BA 5HGGS 3FU5A 3RIAK 4NP4L 5E00A 3ZR6A 5LQBH 3EO9L 4L05A 3B9AA 3CDGB 4PJ5B 4ORGA 4Q6IC 5JPMC