1V55B

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v55B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v55B02
1MZYA 2VW4A 1ZV2A 1IBZA 3FQ1A 2DYRB 1GS6X 3EH3B 3RYMA 3H4FA 4KNSA 4GP8B 3NP4A 3EH4B 1WA0X 1NIDA 1RCYA 1TU2A 4DP7X 1MG3C 1BAWA 2ZXWB 5I6PA 4GY4A 2XLLA 4WKXA 1OE1A 1OE2A 1ASOA 1WS8A 4A2EA 2J5WA 2OCCB 4HALA 4FA7B 4HAKA 3T6WA 4HZ1A 5AZUA 4A66A 1CUOA 3FQ2A 2PPAA 4YL4A 4YSQA 1OF0A 2XXGA 3ABMB 5B1AB 1NTDA 1I53A 4M4RB 5B1JA 3FPYA 1QLEB 2Y1AA 3DTUB 2PP8A 3H56A 8PAZA 2FQDA 1JXFA 5PCYA 3IE9A 2XX1A 4JKNA 2EIKB 3SBPA 3NJNA 7PCYA 1XB6A 2GHZA 3UGEA 4BXVA 4F2EA 2XVBA 1NPJA 4FAAB 1QNIA 3PCYA 4KOBA 4N4YB 1JZFA 1OOWA 2IWEA 6PCYA 4KO9A 1J5DA 3PAVA 1NWOA 3SBQA 4E9SA 3ZIYA 4BWUA 3NJJA 4A2GA 4UF7C 3CVBA 3TBBA 2GC4C 2VM3A 3NJGA 1IC0A 1AS7A 3AY2A 2BO0A 1OV8A 3NSDA 1MG2C 1BQ5A 1QHQA 1XB3A 2HX9A 3ASOB 2HLEB 1L9SA 2I7SA 4AI7A 5D4IA 2H47C 2IDFA 1CYXA 4KO5A 1AR1B 1B3IA 1AOZA 3FYIB 2XUWA 4AZUA 2FT8A 3GDCA 1M9WA 1A4AA 1ZIAA 4HCGA 4AKPA 3OMIB 2ZWNA 2N0MA 3NJMA 1ASQA 1SJMA 4YSDA 2R7EB 3UAEA 4CSPA 1NINA 3FT0A 2IAAC 2W8CA 4A2HA 4KO7A 4TXVB 1RZPA 1ETJA 1NIEA 1ZIBA 3AG2B 3BQVA 4HHWA 3AG3B 2UXTA 3GXUB 5AFAA 2VN3A 3HEIB 4PCYA 4DP1X 2EILB 4HHGA 3X1GA 1A4CA 2YAHA 2XV0A 4YSSA 1W6LA 3AG1B 3H4HA 1AQ8A 1PLBA 5A7EA 1R1CA 3T6XA 1HAUA 2P80A 1AZRA 3SQRA 2Y69B 4KOCA 3NJIA 5TK4A 1HAWA 3C75A 1RZQA 4YSUA 3OD3A 1KDIA 1AZNA 3V9CA 1SNRA 2PPFA 1JXDA 4A67A 4NB7A 3AZUA 1ADWA 2VSMB 2LLNA 4GXFA 4AKQA 1AZUA 3AG4B 3FSZA 4JHUA 2WO3B 2BWDA 2CCWA 4A68A 4BDVB 3WNJA 4DP0X 4AX3A 3T71A 1JZJA 2BP8B 4E9QA 4KO6A 4E9VA 4DPCX 3X1FA 2AZAA 3WG7B 1PY0A 2YAPA 2R7EA 2HRGA 3QJSB 1OCZB 1XB8A 2BHFA 2GIMA 1WA2X 3T6VA 5IY5B 2FQFA 1OCCB 1SFDA 4G7RB 2BWIA 5I5MA 4GP5B 3WIAA 3TU6A 1GW0A 3UAAA 2YEVB 2CJ3A 4A2FA 1PLCA 3IN0A 2CBPA 9PCYA 3ABLB 1SFHA 2VSKB 3G5WA 1E65A 2P80D 3FSVA 1GSKA 2YAOA 5I6MA 3ZX1A 1ILSA 4DPBX 1CURA 1A3ZA 1W6WA 5I6NA 4F7KA 2NRDA 3NT0A 1IBYA 3NJLA 4KNUA 3ABGA 3FU9A 4CSZA 2FWLB 3GYRA 4KNTA 1NIBA 3QJTB 4E9RA 1KYAA 1J9SA 1AG6A 3DIVA 4YSPA 3N55A 2W88A 4BDVA 1AIZA 3X1EA 1FFTB 1JZHA 4G71B 2BP8A 2OJ1A 3QQXA 4YSCA 2X88A 4L0PB 5E9NA 4ENZA 2CAKA 2CUAA 3V9EA 4M3HA 4UAHA 2PPDA 1UATA 1ID2A 1SDDB 1T5KA 2AFNA 3KW7A 3HB3B 2HZHA 1JVOA 3OMAB 3FU8A 3IEAA 1E30A 2HX8A 3JT2A 2YXWA 5I5JA 1AZBA 2VW6A 1KCBA 4DP8X 3D12B 1EHKB 1URIA 1IUZA 1AANA 2MRYA 1PLAA 2J57A 3UADA 4K9JA 1PNCA 3ABKB 1VLXA 1TKWA 2IDTA 3QJVB 4E9TA 1PF3A 1F56A 1WAEA 2BZCA 4YVNA 3FSWA 1A4BA 3FYEB 2QT6A 2AVFA 4HCIA 3MBWB 1OCRB 1AAJA 1PZAA 4BK5C 2YAMA 4YSAA 4YVUA 1BXVA 2E86A 3QJUB 3ERXA 2XX0A 1MZZA 5I28A 4F2FA 4HCFA 4NAJA 2JXMA 2ZONA 3KW8A 5B7MA 1KDJA 1X9RA 2IDQA 5FC9A 2H5UA 1BXUA 1NZRA 1FA4A 5B3SB 1KBVA 1L9PA 3X2QB 3CDZB 1BYOA 4BWTA 1J9RA 4DP4X 1IKOP 4G7QB 2PP7A 1SDDA 4E9WA 2DWTA 1AACA 2MTAA 1BEXA 1GR7A 5F7BA 1YLBB 2DYSB 3EH5B 2BW5A 4DP9X 2A3TA 5AKRA 4DP2X 2FT6A 2QPEB 4RH4A 1OCOB 2XYBA 2IWKA 3OM3B 2OV0A 3DKHA 4WTQA 5I5IA 1ILUA 1DYZA 2IH8A 3S3BB 2UXVA 3EF4A 4PAZA 3S3DB 3WKPA 3CVDA 6PAZA 3NJKA 2BZ7A 3NYKA 5B7FA 2GC7C 2I85A 1GY1A 2XV2A 1ZPUA 1PAZA 5F7AA 3BVDB 4P5SA 1JXGA 4E9XA 3NJFA 3PAUA 4YSOA 5B7EA 2EINB 2FJSA 4QLWA 1PMYA 1RKRA 4BXSV 1WA1X 1NIFA 1KV7A 2PPCA 3ZDWA 2HRHA 2XU9A 3OMNB 4G7SB 1X9UA 2IWFA 3FS9A 1ASPA 2QDVA 2TSAA 4YSRA 3NP3A 3ASNB 1BQRA 1E5ZA 3CDZA 2PCFA 4P5RA 2B08A 1GS8A 2VM4A 5PAZA 1ZDSA 2VMJA 2I7OA 2WO2B 1KCWA 2GB2A 1JZEA 2GI0A 4G72B 1PNDA 1BQKA 1XMEB 2PLTA 1V55B 1J9TA 2EIMB 1JZGA 1SF3A 1AS8A 2FQEA 5B1JC 1A65A 3X1NA 3X1BA 2J55A 2IDSA 1KBWA 4NERA 1ET8A 2DWSA 2BP0B 5ANHA 1SF5A 1EZLA 2GBAA 1N68A 5LDUA 4YSTA 2YAEA 1CYWA 3UABA 4Q8BA 7PAZA 3FQYA 3S8GB 5EHFA 1FWXA 4AKOA 2YAFA 5D4HA 4GP4B 5I6OA 3SBRA 3PPSA 4MFHA 2PP9A 4N8UA 1JOIA 5I6LA 4YSEA 3L45A 3FPXA 3FSAA 3T6ZA 2XXFA 4EF3A 3EHBB 1HFUA 3QJRB 2B3IA 1AS6A 1NPNA 3IN2A 4Q89A 5B1KA 1NDTA 3CZUB 1GYCA 2DY2A 3NJHA 2PPEA 3WKQA 3QPKA 1J5CA 2QDWA 1AZCA 4X4KA 2AANA 2XWZA 3FU7B 2J56A 2QPDB 3MX0B 3UACA 4A2DA 1A8ZA 2VW7A 1KGYE 4HIPA 3WI9A 2X87A 1L9TA 1WS7A 1L9OA 2JFCA 2UX6A 5I26A 1BYPA 1SHWA 2UXGA 1JERA 4QKTA 4ZK8A 2H3XC 4JHVA 2IDUA 3WNIA 5B1BB 1E5YA 2PCYA 1DZ0A 2CALA 3IBOA 3JTBA 1BXAA 1J9QA 4UANA 5I6KA 1V10A 1PZCA 2FNWA 4DP5X 3NSCA 2HX7A 3QJQB 1CC3A 1NICA 4DPAX 1NIAA 2AZUA 2BW4A 1TEGA 2WSDA 1L9RA 4W9ZA 1TEFA 2YAQA 2YQBA 5TK2A 1MDAA 2BP0A 2GSMB 2IH9A 3N2JA 1GY2A 1JZIA 3U25A 2YXVA 1L9QA 3PAZA 3ZBMA 3OQRA 2FT7A 1GS7A 4W1TA 1AG0A 3PLYA 3CVCA 5D4JA 3S3CB 3S8FB 2RACA 2ZOOA 1PZBA 1W8EA 4GYBA 1OE3A 1SHXA 2TSBA 2XV3A 2YARA 3CG8A 1NWPA 3TASA 1PCSA 2JKWA 1ZDQA 1M56B 2FQGA 4G70B 2EIJB 3AW5A 4DP6X 2Q9OA 2FTAA 3NSFA 3PXLA 1ET5A 4E9YA 3TBCA 1E67A 3FU7A 2DV6A 2UX7A 1JVLA 2Q5BA 2HXAA 1ET7A 3NSYA 4BWWA 1N70A 3TA4D 3T9WA 1M57B 1V54B 2UXFA
chains in the Genus database with same CATH superfamily
1OEZW 3GSXA 4KUZL 5GS0D 1YEHH 3MCKA 4P3DB 5EC1B 4YHLL 3W11C 2WPDG 3GMQA 2ITDA 3AG2C 2OMNA 3M46A 4WU5B 3ZHVA 2I27N 2B1OA 3WFCH 3JZ7A 1SJHB 3S3WA 1WA0X 3IJSA 2YPLE 3PWLB 3RTQA 3P3YA 2FEDC 2VZOA 5T3XH 3CFJA 5I1CH 4NYLB 4NUGL 1NCWL 2VDLB 3CWGA 4N2IA 3CCJV 1QQDB 3BD3A 4N3TA 2Y4UA 3CDCA 3LZRA 1CT8A 5IYCO 5L3GA 4NHUB 4KKAC 3RUGF 3VD4A 3WNPA 2VC2H 3X2QC 3CZEA 4QHLB 4A66A 1UWEH 4PY8I 1EAPA 3BIKA 2WINA 3E35A 2UUDK 5KANG 2PPAA 2P46B 1FZJB 4HJ1A 1IBGH 2WMPB 4PPTA 4XMUA 3QG6B 3EJUA 3WB1A 3E22A 4GO6B 4KY1L 4F6RB 1NKGA 1A7QH 2L4OA 3BDYH 3GBNH 3MRRB 3CXHJ 3H56A 1ES0A 1HH6B 1FL6B 4XMZA 2XN1A 4OIFA 2CRMA 2CRZA 3C6SA 3MUGB 1U8PB 1PLGL 1VFBA 2DM2A 3QJFA 4HOZA 5EPMB 2UWEA 3NPSC 3PJSB 1AP5A 1JFFB 4YNYB 5K69A 2HWZH 3F7VB 4YDVB 5DJAA 4QRQA 2EZOA 2RHEA 3VYPA 3QZBA 4LCUB 3QI9C 4POZC 1T03L 4A37A 5KYXA 1E9PA 4XE5B 3ARQA 2HMID 5CB4A 4RFEA 4HJUA 2JJTA 5EOQH 5HJ3A 1AO7A 3CSYB 1SXZA 3K79A 3JT0A 5IB5A 3BAEH 4LIQL 5E8DL 3LJ3A 4NXMO 3TONA 4WUUA 3N2KA 4N9OB 1B0RA 2P3YA 3A8TA 3GS7A 3AY2A 2BO0A 1JNLL 1MG2C 4M02A 4MDRA 1J0YA 5D1QD 2AGJL 2HX9A 3J7AU 5CLYA 3LKOB 5B38A 2HRPH 1TQTA 3CQQA 2BMKB 5AUMA 4N8VA 3KWXA 4FLTA 4XXDB 5G4NA 5BRZB 4A6YA 1HXYB 4NQED 3BIAX 1VCBC 4NXKA 5AKSA 4GQPH 5IW1B 3AK3A 4ODSH 5L9DL 1NGXB 4M5TA 3OQ3B 1GAFL 4Z1PA 4ELKA 1LWHA 4PGCA 2XN9D 3VQXA 4HKZA 3ZUCA 5C0FA 3QP3A 1VQNV 2W8CA 5EF1A 5D2LB 2AK4E 4HUWB 1BHGA 1XGRB 2OTPA 5I0XA 2B1AL 3ULVD 3AG3B 1FNEA 3MZTA 3BPNC 4QXTB 1JSYA 5DRNB 3UG5A 1CDYA 2HKAA 1OGTB 2QKCA 3IETA 2X2JA 5DWUH 4DK0A 1MXDA 1RPUA 1FXKC 3QIWA 1W6LA 3P32A 4M5YH 4OUUB 2CDEA 2WZPA 3BP7B 2V5RA 3MLTB 1DVFB 3LHAA 3QYMA 2BP3A 4JG0H 1HAUA 3MODH 4JAMB 1EHNA 2VXTL 4Z95H 3MZGB 3Q8AA 2MHAB 2ZSWA 5HVFB 1OAUH 2YWZA 4K71C 5T8IA 2YI9A 3O4LE 3F65A 3QFDB 4DW1A 4JM4H 1UVQB 3VB9A 5IESH 3MV9A 5LGKA 5B3JF 3LRLA 2EH7L 2AXTZ 3LKNA 3THMH 2QR0A 4P9MH 2DQIH 3VYNA 2LLNA 3L3OA 3ZQWA 5E24E 3CUPB 1OHQA 3S5ZA 1Z5LA 1PZ2A 1N19A 5IFHL 4X65B 4HS6A 5GRXG 1MJJB 4A68A 4L1DA 4GCZA 5IOPB 1T2JA 2DQUH 4AMKH 4CC5A 3GMMA 4GQ9L 5T3ZH 4LR3A 5JW3L 3PGDA 4DPCX 4LOUD 2EDBA 2EC9U 3V6OA 3DX9A 1QLRB 1QR1A 5KZCB 3EZJB 1PY0A 2G2RB 3L4VA 3AB0B 2BIIA 1GMEA 3N44B 4PI0A 2B9AA 4YWGH 3DV4A 4G8GA 2A77H 4QRTB 3BAIA 1CU4H 1TJHH 4J3VA 3VRIA 3TN0C 4WAFA 1THAA 3V5KB 5JOPD 3KGSA 1JUFA 5E8OA 5BZXA 3EJRA 4RGOH 1S5LZ 3T65A 4ZSOA 1QABA 2ZIMA 4H44C 5AYUL 3LDEA 1M4KA 5IJVB 3ZBHA 4UILL 1VF5B 5E1AC 2NY2B 1VIWA 1TCMA 1OSPH 4FADA 2N7BA 2R0LL 1E4XI 3AQXA 4KFMA 1FJ1A 2ED7A 4K7PH 4TUJA 3K06A 2X0LA 1GSKA 1WAAF 2B59A 1KU9A 2EC9T 2FX7H 3C6EA 3S88H 3GXPA 4P2OC 1KTLB 4LLDB 3W9EB 5JHLL 3KXFE 2G5UA 1DBJH 1N0XH 1TQWA 3WXVH 1KEGH 5DJDA 1S7WB 2SODB 2D03L 2ZJSL 1XBDA 5CF3A 1R73A 1QAWA 5FOJA 3SDDB 4Q9BA 3SGJA 3L4WA 3ABGA 1X5IA 1JZ3A 1PKXA 2EZPA 2F1AA 5F8QC 4ZTPL 3LD8B 4E9LA 5C6PB 3MRBB 4KP4A 4GG6B 3BAJA 4XVJH 4HD9A 5EF2A 3PNWB 4BDVA 3S3JA 3B37A 2BP8A 1MJ8L 2B2XH 2OJ1A 2Y9RT 4MD5A 5F89A 5ICXB 1LP9F 1TFHA 1UXSA 5I19L 1ZAUA 2LGWA 4IKJA 1AGCB 1AGEB 2JIZG 1E0OB 2XKSA 1XH1A 4H26B 4PJ7A 1KF9B 1HWWA 2J72A 4PBVC 4WFGE 5AWNH 1VFAB 4FEMA 5CD3A 5CKGA 2Q73A 2A5UA 4MLIA 2YEZA 1Q9OB 2W60B 4EFEA 3DWTA 1ZS2A 4TQEH 3D85A 1VF6A 4RX4A 4MAUH 2QQNH 4XB8A 2BP5M 4K9JA 4L2LA 3FDWA 2ZG3A 4V1DB 3A0HZ 4PV9A 4BIZA 2NY6D 3HI6H 4OJYA 4AC4A 4AQOA 4PRBA 1RZFL 3AACA 3Q3GA 4JG5A 4KX7A 4Y89A 4DAGL 2W0FB 3JWNH 2MOVA 4EDXA 1L7TH 4FTVB 1TJIL 1TVBB 1I9IL 3ZKQD 3QJHA 3HMXL 3IFNL 4HCIA 1XI1A 4C54A 5CCKL 4CVXA 3O45B 2NUPA 4Y2LA 1I8MB 1V55C 4XWOC 2FIRT 3E3QE 4LDLB 5MP6H 5BO0D 2YAMA 3FT4A 3MQIA 1F3RB 4XN7A 2EDHA 3ERXA 5EUOE 5BOZG 1HK6A 2APVA 1Z5VA 4MVBD 1R6KA 1D2PA 3CX5K 3KW8A 1MPAL 5DD5L 4QT5B 4X99A 1T7ZA 4HJEA 4P5MB 3TBYB 3CSXA 4U1GC 1QFWL 4V2CB 4WZ9A 3RGHA 2NR5A 1KT2A 1IAKA 3VH8A 2WXHA 1WAZA 3F7VC 3QA3A 5H37H 4NQCA 3AU1B 5C08B 3ARTA 4C4KT 1A22B 5BV7L 1AJNA 2P5WD 4RSYA 1XHHA 4OCRH 1ND0B 4IOFD 4PJIB 2IEPA 3RZCB 5TE4L 4AYFB 1BEXA 3DNKA 4Z1VA 1BX2B 1IAII 3CHSA 3L95A 3MD0A 4OZ4A 3QIBC 5KAQF 3CC5A 2DKMA 1T2QL 2L7QA 4Z7UF 3Q4HA 4UCUA 1KJ3H 3RFZB 2H4EA 3D9AH 1GZPB 3ZTCC 2VDOL 1INDL 1FC2D 2GJPA 1U0QA 4IYKA 1MEXL 2IV8A 2MK3A 5J8OA 4C7UA 4HUMB 2ATKC 1PP9H 3A0RA 4O51A 4MRCA 4N5UA 5E0FA 1UH4A 3Q8FA 4X6CA 5FL7G 1LO0L 4BYHA 2EKJA 3B1TA 2ORBH 3ZE2B 5MEQB 2LE9A 2MQ0A 5AG9A 3C9NA 3C60D 2WBJA 2D3VA 2G9HA 1XCQA 3CZKA 1BPLB 3IU3B 3P11H 1R5IB 5G4OA 3LIZH 1ZPLA 1XZ0A 3GMLB 3N9GL 3TBVB 1G9ML 1MCQA 3N40P 1ML0A 3S37H 3AM8A 2V37A 2W9DH 4LHUD 4TT3G 3H2WA 4NO3A 4QHNA 3ZYOA 4R7VA 3Q0HA 1TETL 3B9KD 5FLUA 2UUBB 3LRMA 3MRDA 3SCMA 5CBAA 3JSSA 3OKMA 4PI2A 2QDVA 4AG4L 1Y76A 4DV3B 1TCRA 1A6WH 4OT1L 3QAQA 3CK0H 4PRPD 5L0QB 3AWEA 2LU5A 1ZDSA 4C4KO 4K55A 2AEIT 1DBAL 2VDRH 1S5HA 1D3CA 2GB2A 4A7UA 4P2QB 1IFGA 1U41A 3HKDB 4PGBB 5J9PB 4YDJA 5HI4C 3P9LA 2LVCA 3HB3D 3S35H 5DVOA 5EU4B 1MNGA 5GSVB 2Q8AL 4CS3A 5E08H 4NTYA 4APXA 2XFGB 4PGEA 2BOBA 3U4AA 3U0WL 1T89C 1YN6A 3TESA 4DV7B 2ZPKH 1CYWA 4PJHF 4Q8BA 1FFXA 2B0SH 5M7QA 3PWPA 3VWKA 1N6UA 1HNXO 2A0LD 1VEMA 1I8LC 5I6OA 3DC5A 4R6ZA 5KAIZ 3IS0X 1H8SA 3MLPA 3BOVA 4G27B 3NCMA 1RK1B 2PYJA 4RFNC 5GIRA 3KPRE 4F2MA 4UDTB 4CVWA 2ITCC 5IYZA 1KCSH 1OARH 2BS71 1ITCA 4Y8AA 4X2UA 3UGXA 5LCVL 2NN4A 3SPHA 3ARBD 3FCBA 3ECQA 2M83A 2QTOA 4ZFOB 5I8KH 4NNPL 4YY3B 3KPMA 6CGTA 1NDTA 1H38A 25C8H 3BVTA 3W7SA 3HMWL 1HQRB 5GRWA 1GYCA 3PGFH 1P7BA 3LKRB 1YEFL 3VI3F 2WQWA 4WW2C 4X0NA 4FXKA 5E5UB 2JS3A 2P24B 4BRVA 4GAYA 2WQUA 4YFLI 4TKWA 5EMYA 5I15H 5CA1B 2X9WA 1BJ1H 1BVKA 3L4YA 1WFNA 5JVDB 4K8RL 4KVNH 2FSEA 4JHVA 1UH2A 3D69A 5D6CB 5T5FL 4UIKH 5FNVB 2J20A 2NY0B 4LOEA 1LM8V 2E4TA 3FN0L 2UY7B 2AZUA 3X3FL 4JJ5A 4PJDF 4G83A 1GKOA 4MZRA 2L6LA 4OKVB 4NENB 4KK9D 1AYOA 4WFHD 3UP6A 2DM3A 1ZUQA 3OGOE 1N59B 3N91A 4LSPH 2VQUA 1I4FA 5DVNA 4JO5A 4NQXA 4XVOA 2M26A 3PS6A 4I85A 1WQVT 2VH5H 4FD0A 2VLKE 4RGND 3LS5H 4ZS7H 3ARZA 1NAKH 4QUOA 1XBRA 1S7SA 3OF6D 1J18A 1FE8H 5I1DB 3NA9L 5EU3A 3OLDA 3U0TA 2FR4A 3ARGB 5DRXA 4YBQC 1FH5L 4XDKA 1QBML 1PZ5A 1JK8A 2JJSA 1N8ZB 4MNGA 4I0CC 1JZ8A 1ZDQA 3KYOA 8CGTA 4JG9A 3TJHD 4G70B 5JNYA 3MLWL 2VE6B 1YNTA 3MLVL 3PV6B 3QJXA 3MLYL 4B7KA 5CLWA 2FTAA 2CO2A 4HUKB 2AV1A 3VBBA 5GGQH 4CBPA 2UX7A 2EE0A 5KN5B 1HHJB 3QXWA 5E1IA 4PJEE 1MHCA 3JALB 4HK0A 1WTLA 5F1IB 2QM8A 2WXQA 5JHAA 3H9VA 1N8OE 2NLJC 3L48A 3MJGX 4WGVB 5JQHC 4AE0A 3FTWA 4R7CA 3RYIB 1CGUA 5HI3D 3HS0A 5HJGA 3WL9B 2Z8VC 5JO5A 1BGXH 4PA6A 1CFQB 4IRZA 1WFUA 4DQOL 3BW9B 2AK1H 1A4JB 2CUIA 1S3RA 4JRXD 1IM9A 1DFBH 1RZJL 4X6DA 15C8H 2Y69C 5A43C 1PZDA 2KMWA 5HDQL 2OI9C 1Q0XH 2EDTA 4EI5D 2EDQA 4BH7B 4PLKC 1IGCL 1LVEA 1N5AB 3HG4A 5ACZB 4NFCA 2P26A 4P46A 2NNAB 3HHSA 5HDRA 2OMXB 4U6VL 4EB6A 1H2SB 3DXRB 1OF0A 4XAWL 3QCVL 3BVNB 4MZ2A 1RV6X 3K7UA 3D50A 3R7QA 3HR0A 2C3HA 2WA4A 2X4PB 2YEQA 4FQ1L 1I8UA 1YEIL 5KSAA 2RGSA 2VLLB 3P0VH 5MI0C 1RUQL 2PP8A 1T4KB 5KYWA 3K46A 3KVDD 2YIBD 2H7WA 2SEBB 1AILA 3V7AG 3W7XA 3WLBA 3R0NA 5ESVA 1A7BA 4Z7OB 4ILDA 4D0DB 4P59H 4XNMB 1QNMA 2VB5A 2EDWA 4Z3IA 3LUTB 1FVEB 4ODTL 4DT2A 3QUKA 2A6JB 4JFDA 4UF7C 5AZ2H 3SDAD 3W39A 3RIAF 3P4NB 4PJCA 1ZHNB 3K9SA 1J1XL 2BVEA 4P3DA 5EC1A 3U82B 3QPQC 3L5HA 5TDNA 3B5GA 4TVPL 5HHNA 3NSDA 4WU5A 3UTPD 4PRIE 1T6BX 5H2BB 4OGYH 4R3SB 1SJHA 1XB3A 3UROR 3N1MC 4NP4L 4AQAB 2IBGA 4YHKH 2DL9A 4NYLA 2CAZC 2ICEC 2YKLH 4OCLC 1BCIA 2V3EA 3NK4A 1QQDA 3LH9A 3L9RB 3QIUC 2A6DA 4HCGA 3IMVA 4JFEE 3A0BZ 3QNXB 4OGXH 1ED3B 4NSKB 4P3CL 5D1QB 3QTCA 4NHUA 4FP8H 2ADFH 4QHLA 1W91A 2YUVA 1SEBA 1GYAA 1CF8L 4FFYA 3LS4H 2D0HA 3CVIL 4MWFB 2C4FU 3QG6A 5SWZE 4NQEB 4P9HC 3L2NA 4WQOA 2CKBH 3I9GH 4F6RA 5GGTA 3ARFB 5ABZA 5F7EL 4HHGA 4N0UE 2CO6B 1HH6A 1FL6A 1IGFH 4JO1L 3U1PA 2EYTB 3UQ8A 3MUGA 5ICYB 1FYTD 3IM1A 2UYLB 5H5NA 3O6KL 4S11A 3PJSA 4WWID 5EPMA 1MWOA 4GINA 1JFFA 3RA7L 4YNYA 4YHYB 1ZVHA 4LHQB 5CNHA 4YDVA 3LVEA 1MCIA 4LCUA 3N0PB 4YLCA 4BKLB 4XC3H 3B4SA 3LEVH 1SJVA 1JPTL 43CAA 1DLFH 1XHXA 1GOGA 5D7IA 3CSYA 1KDIA 3RHWK 2DMXA 1SRDA 1AZZC 4LPUA 4R26H 4UCVA 3EADA 4A67A 1H5BB 1MZFA 1MW1A 1ADWA 3T4DA 2LGQA 5GISH 1QW9A 2VDNH 1H9DA 2OWOA 3LKOA 2E76B 5C71A 4J4PC 1KPUB 3OJVC 4JHUA 4XXDA 3V0FA 3I9IA 1HXYA 4BQ9A 2TRYA 4K3EH 4HIQA 4OF0A 4IGBD 1LO3L 1RUMH 5IW1A 1HQ4B 2ZUVA 4WF7A 5EZIH 1SZXA 3P30A 2EYRB 2BIOA 4JI7B 3ZT7A 3M1CA 2AZAA 1GIGH 5I23A 2ED6A 2YAPA 4P2RD 2R1XB 1B2WL 4HFWB 3VSQA 4OLEA 5D2LA 2G2PA 4ORZC 1J5EB 2BHFA 4HUWA 4RMQA 1ECYA 5IEHA 1AI7A 1XGRA 3H1LH 1TQCC 2CLZB 2JGUA 5IY5B 5AOZA 4ZXBD 4QXTA 3NBNA 4JI1B 4PG9A 5DRNA 1OGTA 4U4BA 1K97A 2EVIA 1TXKA 2QKIB 5AOKA 1THZA 3UZQA 2AJZB 4S1QH 3UAAA 4OUUA 4O2FB 1JYXA 1JRHI 3BP7A 3MLTA 1C16A 1DQJB 1DVFA 5LMUB 3LKPB 1SFHA 3L6FA 1CD1B 1DR9A 1H19A 3NJXA 4Y5YC 2F53D 1XDTT 2QSCH 1EZUA 3FSVA 3WJLC 2UXDO 4WJKB 3VQ2C 4KTEL 2VDPH 2IJ0C 1EHAA 5CEZD 2CUHA 2HVJB 1Q0EA 1VZHA 3AQZA 1UVQA 4XE0A 5HYSB 1KGWA 1HNWO 4XXWC 3ARDD 3H42L 5TPWL 1DANU 5LGJB 5E7BA 4DR2O 3ARGC 4HNAB 2DQTH 1AQDB 4KNUA 5C6WH 3CUPA 5DDHB 1RM1B 2FJHB 1RFDH 1U9KA 3SKJH 1AG6A 4F6EA 4GAGL 3FQWB 1MJJA 1UJTA 3TVMD 1CWVA 1N33B 3KYKL 5IOPA 3NPZB 4OAWB 4BWAA 4LWSB 4JPKH 4UAHA 1YEWA 3SPCA 2XBZA 1QLRA 2QMKA 5ID1A 4B3SB 4OLUH 3DC0A 4H13B 1QSEE 2G2RA 3JTSB 1I3GH 5ILTL 1PL3A 3MV8E 1KGJA 3UYPB 3GBML 3HKZA 5CN3A 3HZVB 4QRTA 3WAKA 3WTTA 4X83A 4JLRB 1E7UA 3QUYC 3UMNA 3ZOAA 4OF6A 1OZTG 4G6MH 3V5KA 1M4UA 2XOKG 4QD2E 1G6RL 3I74A 4YE4H 2MRYA 4QO1B 2UZIH 3VXUE 5IJVA 4X62O 3RI5F 1VLXA 3M8AA 3LNGA 2IPKB 1BFVL 1Q94B 1RPQA 5GHWL 5FA3B 4J5VA 5DUPH 1YNKL 3IYLW 1X5YA 4YLQT 5HTSA 1WAEA 4B7EA 2BSBA 3FSWA 3KHQA 4L4TD 1KXTB 4LU5H 2AXWA 1CO1A 2AVFA 5KJ4A 4KH9A 1OT1A 2R9IA 3GI8H 1IV8A 1KTLA 4LLDA 1UM6H 4JASA 1IBKB 3SO3C 1JMKC 2AKRB 5ABAA 4UV9A 1MQ8A 3F64A 2QQQA 3BUPA 3TBTA 2O57A 2NW2B 3G6AB 4IHOB 3B4NA 4PD4K 2XX0A 3SDDA 3H9SE 4ZFFB 4F2FA 2H94A 4DR6O 1G7PB 3EBAA 2X4RB 3CPUA 2ZONA 3MRBA 1OAXL 2J44A 4GG6A 2BSED 1NZRA 3B2UC 3PNWA 3HNVH 3WFDL 2CH8A 5ICXA 3EO9L 2DJ4A 1NCBL 4OI7A 3R8QA 4MXWH 3VACA 2WBXA 2ZE0A 1DBKH 4PRHB 2F4VB 1AGCA 1AGEA 2FLBT 2WK2A 4X7TB 2FATL 4XMKH 3STZB 4YUEL 2EDJA 4AVKA 1VFAA 1RIVL 1XV8A 2EC8A 1QG3A 3APOA 4NZUH 3UZEA 4NQVB 1C7SA 1UZ6F 4U05A 1Q9OA 2W60A 2AEPH 2GSGA 2XN2A 3SPJA 3NZHH 3V95A 1P4IL 1YYML 1LILA 5DURD 2Y7QB 1SLVA 3A0OA 5K1PA 2P5WB 4X5XB 1NQTA 2F54D 3LN9A 4EUPG 1KWKA 2F9BT 4V1DA 2HMIC 4MDIA 3BGFB 3R66A 1XIWD 4PMFA 3S3BB 1QHOA 1R46A 4IBQA 2ODIA 3HBGA 4CSSA 2W0FA 4PWJA 1AJ7L 3WKPA 3CVDA 3MSPA 1LEKB 4FTVA 4C4UA 3T0ED 2MH4A 1TVBA 1ZVYA 1Q1JH 3QEGH 2YBRA 5D1QC 3O45A 1QR8A 2ZDIA 3VFOB 1I8MA 3B77A 1JXGA 4HMDA 5IB4B 4LDCA 3A4FA 4N2CA 1JHKL 4IJ3B 4KMTH 1KECA 4JGNA 4HYOA 5HFLA 2VWEC 1JPFA 3NSXA 4GFXA 2AZ0A 2G75B 5AKVA 5A1AA 4IBZA 2WYIA 4GKJB 2Q6WB 2KDGA 3UDWC 2EIDA 3CRMA 1X9UA 3BRFA 4P5MA 2ZD0A 3C60B 4O4LA 1Q90A 2A6IB 3TBYA 2GBOA 2J6EA 2DEWX 1MN4A 3ISWA 2BDNL 2FHCA 4KPHL 2Q87A 1QFHA 2WQ8A 3KLQA 3FCGA 3LPFA 3AU1A 1DUZA 4TLTA 4WO0A 5C08A 5AAPA 3WAJA 4NBXB 4G6JH 3JVGA 3PV7A 1ND0A 4AQ8A 3GSVB 3U36B 2PR9A 4AQZA 1PNDA 1XR9B 4AYFA 1XMEB 5D1XE 1ONQB 3RX7A 1I7RB 3RZCA 1BX2A 2CE4A 2ENSA 2IVFC 4XN1A 1V5JA 2RB8A 4PRPB 4CVZB 3OXSB 4BIKA 3HKFA 3RIFF 3HRZB 3BPLB 1OXYA 4M1CD 3RFZA 3ZDYB 4O2EB 4KMLB 1RZ7L 1GZPA 3F7RA 4H1LH 4DR7O 1E5AA 3P2BA 4KK6D 1CPUA 4Z7UB 5E4IA 4K3DH 3QNEA 5HDWA 3I84A 2J2ZA 5BRQA 1FLRL 3ZMRA 4ZJ9A 1FA4A 1I85C 3DO3A 4NLAA 3LEYL 3RL2B 2W9LA 3HS9A 1JOIA 3WN5B 2FKXA 1EANA 1PM9A 4ABWA 2Y5TB 3C6LB 1MSPA 3LNHA 2E5LB 1TJMA 5MEQA 2O6CA 4CU8A 4ALAL 4ZMAT 2GJ6E 3IU3A 1R5IA 4MVZA 5AVYB 3GMLA 3RWIB 3TBVA 4LARL 2ZE8A 2XQYG 4RVBA 2BX5A 3TJEL 2B1HH 3IU4L 3MA9L 5A2IH 1XWVA 1Q6IA 3DGCR 5IY5C 3IK2A 4HEME 4YIQB 3W0WD 5FV1L 4CU6A 4OLVH 4OZFG 3K6SB 1I3UA 4QRSB 3QISA 2IAMB 4LOUC 3QO0B 4A2DA 4ONHB 1FP5A 4Z7VB 2QKIC 2BLFA 4J7RA 1IGIH 4I4TB 3GIZL 2DLTA 4NT6B 4EOWL 1NCCL 4H4NA 3K3WA 2Z93B 3LH2H 4CH4A 3L5JA 4G8EB 4UQ3A 5FW8A 3RQ3A 2WZ6A 5IR1B 3UPRB 5CZXC 3NFSH 4H7VA 3UJIL 1NBVH 4P2QA 4A7TA 3HKDA 4Z0XB 5J9PA 2GHYA 1KJMA 1JHLL 1NICA 2VIRB 4M7LT 2FTKA 3WEXA 1FL5B 1Q4NX 5EU4A 5GSVA 4KAQH 1CDBA 5MEND 2YAQA 2R0ZL 4XPAL 5TK2A 3OXRB 3SO5A 1K85A 1IEBB 4PJ9D 3QXTA 2P1YA 5I66B 2F5AL 4HUUB 3QUMB 2CCVA 3VI4B 4AJVA 3WSQL 2E8ZA 1HIMH 4JI5O 2P22C 1L9QA 2X5PA 3IDXH 3K6DA 3NTCH 2OR7A 1OGAE 4IK7A 3UAJD 1D6VH 4HC1H 2ZOKB 5I75B 2P5PA 4LF6O 4P57B 3TLRA 2J25A 2LU4A 7TAAA 4LKCB 1JGEA 1XH3B 3CFCH 2WAMA 3JYCA 4GH7B 4EN3B 1RK1A 1BAGA 2VDQL 2QM7A 4HIXL 1OE3A 3BH9B 4KZCA 1D9KD 2YRPA 3X11B 2F7RA 5LGHH 2IBBA 2KLSA 3GTVA 4ZFOA 1OW0A 4HUVA 5J2TB 3PNRB 4F9PA 2AJVL 2Y7OA 5HI5C 3DSNB 4RGNB 4TQIA 1T20A 5JHMA 1HQRA 2RR3A 2JIXD 3LKRA 4XPGH 4M6OH 3O2WH 5BZDB 4ADJA 3PXLA 2DTML 3APFA 3BA9A 1Z9SB 2P24A 4R7DB 3ZHTA 1A3RH 3HG3A 4X4YB 1A64A 1H3PL 3Q9QA 5CA1A 1A6VH 3V9FA 3NIGF 1HKFA 2XCMC 5JVDA 2WXMA 3MV7D 3OAWA 4ERSH 5IZ7A 3VM7A 2ICCA 4ZFGH 2UXFA 4JDEB 2JK5B 4G5ZL 1NCDH 3FH7A 5EU6E 5F9WB 3IJHB 3LY6A 3WS6C 3W2DH 4BCYA 3HZYB 2FBJL 4Z18A 5BZZA 1BEYL 3GJEA 1JVMA 4OKVA 3T2PA 4NENA 3X3GL 2NY6C 4UCTA 3Q43A 3WD5H 2VO8A 4X9IA 2HCZX 1N59A 5AG2A 4HWUA 5JYMA 3KPSB 4KJWD 1P1ZB 5DHVA 3ZE1F 2EADA 4M7ZC 4ZUTA 4PDMA 2E7LA 1Q1PA 4UBDD 1DJSA 3C5SA 4DEPC 4L3CA 4JI2O 5FWRA 1YPZE 1J0JA 1PKOA 3T6WA 1U6AL 2YC1B 2NQDA 4Y8DC 3TTSA 3MRLA 1R17A 2LAAA 4Y16D 3C09B 4FNPA 2BXYA 2FEEI 5LB1A 5I1DA 1CXZB 3BT2L 5FGRA 3UGUA 4DN4L 4CH6A 5IJKC 4U7NA 2YIAA 3ZTJH 3CRAA 4GT0A 4IRSA 1GRJA 1N8ZA 2WLIB 1UQSB 4IBSA 5BOJA 4FN0A 1FDLH 2A4CA 3TEZA 4OCSL 5DQDH 3ZTNL 5BCAA 2NY7H 2EIKB 3PV6A 2VE6A 3Q48A 4H2CA 1W0VB 4XNBA 1S3KL 1T6VN 4JFHE 4OY9A 1U8KA 5AVSB 5I73B 3LPGA 4HDIB 5F2FA 2ESVE 2HKHH 1HE8A 3ECBB 5KN5A 1HHJA 4M7JH 2N1TE 3IAPA 4I0KA 1BECA 1JX9A 3FNKA 4L3ED 4P9HH 2EDRA 4HBQA 3JALA 3FHAA 4FZEH 1PG7L 3DVGB 3SDYH 5KLVH 3D4GA 4PJBE 2DEYX 4BGLA 4F1SA 3RIKA 3QC6X 3RYIA 2GSIA 2X6CA 2Z4QB 2OCHA 1U8NB 3OPZL 4NUJB 4O2CB 2HLEB 2I7SA 3DBSA 3QDME 3C12A 4RNRB 3KS0J 1CFQA 4NN5B 4OH2A 4M1GH 3GI9L 4C55A 1U8OA 3BW9A 3T0XA 1A4JA 1PYWB 4PUBH 1X44A 1YI2V 4N3UA 4AZ8B 4UT9H 3ZKND 1TPXC 4ESKA 1A7NH 1CTOA 3OTOB 1NH2B 3C60C 3N85H 4EQ2A 5ACZA 2N0MA 1GN2A 1N5AA 4F33B 5L6YL 1SN0A 1UC6A 2VM9A 2NNAA 3D52A 4NOBA 4DV5O 1ZD6A 2OMXA 2CBMA 2OCFD 4GSRA 2H26A 3DXRA 4TXVB 1WO2A 3BVNA 3WS3B 1WNSA 1KXQA 5C09E 3BQVA 2X4PA 3FB6A 3B9KC 4BUQA 5AW2B 2VLLA 5D8JH 2VN3A 3F6IA 3QPXL 1H2GA 1NA8A 1CR9H 1JNNH 3D39E 2SEBA 3D09A 2ZKMX 3HRZC 3FB8C 1KG0A 4LSVH 1A2YB 2IG2H 4UCFA 3J81N 4L18A 2Y3AA 1CXLA 2APXA 4KOCA 4D0DA 4XNMA 4I3SL 1U93B 4IHBA 3P77B 1FVEA 4D0BB 5F88B 3VG0H 5JZ7D 1PPJH 2A6JA 3HB3C 3L9DA 3P4NA 4I4WB 1ZHNA 3M17B 1FYTB 3T2MA 4F24A 4KRNA 4TV8B 3WFHB 4F92B 3VQYA 5D7JB 3G71V 1XBLA 1WC7B 1IRAY 2H1XA 5H2BA 3UG4A 1DSFH 4R3SA 4H2AA 1E9QB 1XX9C 1BLNB 3RAJH 1IE4A 5DZJA 5T5NF 2A0LC 3ALPA 5CJOH 5C0AE 3ABKC 3O3AB 4AQAA 1SC5B 5D2NE 1Y1DA 1MAMH 1TTGA 4HU2A 4QTIL 4DV6O 3KWUA 1K3ZA 3L9RA 4XVSH 1URFA 4D9QE 3QNXA 4ADGA 3LNFA 2ZIDA 3ARBC 3AABA 1XF3B 2P5ED 3WG7B 3TO4D 1BE3H 1USQA 1YJ9V 3A67H 4JQIA 4GX2A 3S5LG 4MWFA 1QTSA 2GIMA 3TP4A 4AM0Q 4L23A 4OFIA 3WFEL 2JB6B 4IGBB 3SODB 1TQVA 3ARFA 5EDXA 2WGXA 1AKJD 3WJJA 2BWIA 1L9MA 2CO6A 5EZOH 5FUZH 1WLEA 4DXWA 1MFCH 1Q72L 4LF9O 3FFCA 5IREA 1J8SA 5ICYA 1HOEA 4P2RB 1J9CT 3GSNL 1DQMH 4OFDA 4UCOA 1MUJB 2NY4B 4O00A 3WY1A 1KOAA 3V4UH 4NFDA 2DLEA 1KELH 3DX4A 4BKLA 4W9LC 1IZJA 2XWRA 2X9ZA 3O6FA 2Z1PA 3T0AA 5I6MA 2WZ0A 3V0GA 3IJ8A 1ILSA 3G6EV 2Q1EA 3KLAA 1KKCA 1OSZB 3QFJE 4GW5B 2ARJQ 4H5SB 4P23A 2QLVB 4KK9C 3GEFA 5CA0B 4NCC2 2P6JA 1H5BA 3C5ZD 4N2FA 1F5WA 5ISZE 3UPAA 2F53B 4C56B 4CZZA 1CI3M 1YUKB 4XPFH 1NIBA 4D7PA 5HGAB 4RWYH 2XJKA 4Y19B 3QZOA 1T7VA 2Q8BH 1MCSA 1ZGLM 1VEPA 3AUWB 3DHJA 1W72B 2VZSA 3ARDB 3CN3A 1G1XB 2XPGB 3MLSH 2I5YH 4QCIB 3U1SL 5LHIA 1S7RB 2EYRA 4MVQA 3ZL4L 1SDDB 4MTFA 4PJ5E 5B1NA 4EVNA 4P5TC 4QJ3B 2R1XA 4XODA 4K9EL 1VGEH 4HFWA 4BUHA 5GS3A 3TJHC 4Z3JA 1RIUL 3GJFH 4JRYD 5T3ZE 1T0NB 3TVMB 4X1KB 1A6ZB 4Q74A 3TURA 5CUSH 3QQNA 3V0WH 5I5JA 3MOBH 2F68X 2CLZA 4M7LL 2OPCA 3OGIB 2EXTA 4DP8X 1EHKB 4GI9A 4N2GA 4AGOA 3FCTB 3CSBA 2Y0PA 2F43G 3CLEH 2AJZA 3KXFD 4Q52A 4IIQB 4O2FA 2H0EA 3ASNC 4LF7O 3BQUD 2A99A 4RISL 5TE7L 1DQJA 1BZDA 2XRAL 3LKPA 3RWDB 4BFBD 2O93L 1H8NA 1F56A 1CD1A 1SHMA 2EDLA 3SGDI 2N0KA 2OZ4A 4E5XB 4ODWB 3U7YH 4W6WB 2W6JG 3TCXA 4G7YL 1BLIA 2QDOA 2XY1A 5J6GB 2HVJA 3OAYK 4I18B 4PDRA 1BQLL 5HYSA 2YC0A 2WVUA 3WO4B 4IJTA 3SQBB 3AXIA 1M7UA 2V7QG 1P0SE 3QZWB 3FUMA 4HNAA 1HWHB 4H8PA 1AQDA 2EVFA 4LBAA 1P2CB 5DDHA 1AI5A 3MXWH 2EJ1A 3STLB 3SYPA 1OK0A 1XGYL 3PIQB 4Z7QB 5FHAL 3FQWA 1N0JA 4EI5C 2ZKOA 4H25B 2W80C 5BXFB 2EIKC 1NLBL 2H32B 4WWKD 3DBXB 1KBVA 5HGDB 3V0HA 5I9QC 2ZYRA 3B5HA 1T1YB 4LWSA 2ZWSA 4Y4KD 5IBUG 3GWOA 1EO7A 2VXQL 4DP4X 4U6TA 5DC2A 1XH0A 2Z4TA 2JCCE 5F7DA 3JTSA 3UYPA 3HZVA 4LNUB 4U31A 4NJAL 2EQDA 4DO5A 4NRXB 4XO9A 2NPLX 2ZF8A 3MRMA 2CG9X 3TJPA 3ZZSA 5DYFA 5DZLA 5LQBL 1YXBA 1IZ3A 6FABL 2QHRH 4J3OF 4XB3A 3X14B 5HHQB 3ZUNC 3F01A 1AQKL 5T33L 1IXBA 4UUJB 4QNPE 1Q94A 3SDAC 2CU9A 4JCMA 4UWQB 4FM0A 1SQFA 5CS7A 1KCVH 2AJXL 1K4DC 3I6GB 5BRPA 2OTWB 2LT9A 6PAZA 3QVNA 4YXLH 1I7ZB 1HHGA 1KXTA 5KSUB 4J28A 1KB9F 1YVWA 4OVUA 4F8TA 1OGSA 4ETQB 5DQ9B 1R5WB 3DDGA 3L9BA 3M1OA 2F54B 1QEXA 3H3KA 1CBJA 4CL7A 2AKRA 3JWNE 4X5QA 2DIEA 2W92A 1MRFH 3UC2A 2NW2A 3G6AA 2J8UE 4HISA 4IHOA 1G6VK 3WIHA 5I8OH 2EVGA 1LQSR 4F7EB 4ZFFA 4UT7H 2QZ5A 2CGYA 1KGUA 1G7PA 3TWCL 4NZRL 1EEUA 2X4RA 3OMNB 3QRGH 4TV3A 5DEJA 5GS2D 2R9HD 3EGDB 2IPTH 2A7BA 1RL1A 2NXYD 3EG9B 4JBSA 3RWHB 5ELIA 1K8AW 3FRPG 3JUZA 4MYPA 4M3JA 4DK5A 1B6DA 2B08A 3UO1L 4YDLB 2XTJB 5IJ9B 3PL6D 4ICGA 4PRHA 3ETDA 4XDLA 4X7TA 5DZPA 3STZA 1J0ZA 2VDMB 1V7ML 5D4QA 1SY6H 1I1RA 2XKUA 3JV0A 3WKNA 4NKMB 1AGBB 2LU7A 2K6ZA 4UVBA 4NQVA 4XP5L 4J3OD 3T2NH 5D5ME 3B1UA 1JF1B 1EDQA 3HR5B 1ZS8B 1JGDB 4UTAL 4CILA 1QHTA 2Y7QA 3JZYA 3K6NA 2P5WA 2YAEA 5IJ0A 2ZXEB 2FYUH 4X5XA 3ETGA 1FO0B 5CKAA 1DQDH 4KFZC 1P9MA 5TF1H 3S36H 3U0ZA 1FWXA 2IANE 5I0ZA 4F8NA 3RWGB 4GAJH 3SE9L 3UJJL 2BIPA 2AABL 3QEQA 4HS3B 1DN0B 2DDQL 4N26A 1LEKA 1LUVA 4V11A 4XWGH 4EF3A 4PWEA 3RU8H 1NTZH 1AE6H 1UM4H 1TENA 1XF2B 3VFOA 3HCVB 3WG7C 1UGNA 3GJFK 3GZQA 2CA4A 5B39G 1NPNA 5IFAH 3KLHD 2EDEA 4K15A 4C57C 2DY2A 2G75A 4XPTL 4ZAKA 3QPKA 1PFOA 1U8JA 4IGBC 2Q6WA 1CXKA 3VWJC 4ES9A 3QWRD 2QPDB 4N21A 2OCCC 3CVHB 4DOHB 1KGYE 2A6IA 4QXUH 3SZKC 1UZ8A 3T4AB 5AALA 1Y6NR 1SJEB 5B3NA 1SHWA 4O4YL 5FHBL 1UXWB 2H3XC 2OK0H 5IMLA 1I31A 3ZVVA 1TIUA 4N8CH 4FRWA 1HEZB 4ZXBC 1QSFE 3W0WB 5C0GB 4G11A 3VXRE 4BFOA 4DP5X 5EOCH 1TJXA 2GIXA 3NSCA 2D7PA 1ONQA 1I7RA 4JVPA 3P3RA 1ULVA 4BK5A 4MB3A 4HJTA 4ZS6D 5AW4B 3ROOB 1EGJH 4PRPA 4CVZA 1R33A 2C8NA 3OXSA 5INCA 3IJ7A 3KPRD 1FGVH 1MJ7H 4LVEA 4O2EA 1AHKA 1F58L 4GSQA 4L4VB 4WTZA 3KMDA 2AHZA 3CDFA 1U42A 1RZKC 1Y07A 3OQRA 1CJYA 1WEJH 3FAWA 4KRPD 1JYVA 1PJWA 1T21B 1USZA 5H35B 1DJZA 1M6UA 2LLLA 2WIMA 1RZGB 4LFCO 2D9CA 3RL2A 1ZA3A 3E1F1 3FU6A 4GLRH 3AS3A 4JKKA 1C1EL 5E4AA 3SGKC 3WN5A 5MENB 3S8FB 2Y5TA 4JMXA 3C6LA 2ZOOA 4M6NL 4PJ9B 3V4VH 1YAZA 4JCWA 5EEYA 2GEQA 2MPVA 1NBZB 3QDJD 3UTZB 1KWGA 2YARA 4MVUA 1HINH 3DX0A 1NC4B 1NWPA 3RWIA 4FG6D 4LP4A 4YHZL 4JFOA 3ASOC 4ZOAA 2V17L 3GO1L 3AW5A 5IGXH 5GJSH 4YIQA 3QXUA 3K6SA 4JAUA 3NACL 5DD3H 2VRZA 4N20A 4QRSA 5IIEB 3CMEV 2IAMA 4PJEF 2ZR2A 2YK1L 1D9KB 4ONHA 4Z7VA 8FABB 4UM9D 3JWDL 3NSYA 4I4TA 2WA3A 4NT6A 5K9JL 1TJGL 2HT2D 4G8EA 1IGML 1MHEA 2UUCO 5FUOH 5FDWA 5FYKL 4Z0XA 3FQ1A 3L54A 2VIRA 4E68A 2CLVB 3M45A 2FL5B 2WXRA 4I18C 2VLKD 5H94B 2AITA 5D72L 3OXRA 1IEBA 3PUUA 1UENA 2H0JA 4IMKC 4U49A 5I66A 1ANUA 3MV7B 3QUMA 4HUUA 2ZXWB 2AJYH 2XLLA 4GX5A 3VFSA 3VI4A 1I1AD 2PWFA 3SDCB 1C5CH 3VX0A 1I08A 1ASOA 1EBOA 1GGIL 1HYRC 1RZ8B 2DYPA 2Y7LA 2W0KA 4HF5H 4R90L 1NBQA 5EORH 2ZOKA 3K5OA 1TYEB 3VXSE 4P57A 1F4XL 3ATFA 1WHOA 4LEBA 4OGQB 2VQFO 2D2CB 1XH3A 4XI5C 5DU7A 3DK2A 4OCWL 3A6BH 4EN3A 4E0RB 4FLZA 3BWZA 3B9AA 3HC3H 4IDLA 3F7QA 3NABH 4LC1A 3VGBA 2NTFB 3BH9A 4RMTA 4K7PX 3ABMB 3X11A 4ZT1A 3OKNB 5J2TA 1I53A 4QXGL 1PGRB 2DD8L 1JGVH 5IHWA 3RTLA 4D7BA 3OR6C 1KQSU 1M7DB 3AG4C 3FUHA 4KQ3H 3OF6A 1YEHL 4XX5A 4DKTA 4Y16B 4WV1C 1G5GA 3K58A 3MJ7B 2FB4H 2XVBA 5F8RC 1Z9SA 4R7DA 1QFUL 1QNIA 2MMXA 1W8NA 4X4YA 1HWGB 4L1SA 4OZHB 5BZWA 5GGRB 3B2MA 1DBBL 1ZTMA 1EIBA 1WVZA 4O9HH 2KT6A 3CVBA 3D2TA 1CTNA 4LSQL 4JDEA 3H7BB 2JK5A 2XJLA 1NM9A 1VQ4V 3N43B 3WXWH 1FCGA 3DROB 3V0VB 3NJGA 1MJUL 1RZIA 5F9DC 1IQWL 1E79G 3KM1A 2EAEA 4X7FC 3S34L 1X5MA 1XIWC 5JR1L 1MNUH 3UCSC 2WKOF 3GK8L 4KQ4H 1IBFA 2EDXA 2YPLB 1Q6UA 2AXFB 5FAAA 5I16B 3NCYP 3G5VB 3GZPA 3KPSA 1P1ZA 2V9RA 1G87A 3T0EC 2EEAA 1B4JH 5B38G 1SBBA 5C97A 2CO3A 2C1OA 3HC4L 4N8VG 5CA3A 1MWAB 3C2AL 4QEGA 3N50A 2R7EB 1KTKE 2N1KA 3E2EA 5JW4R 1JCKA 2UXXA 3CC1A 3FT0A 4YDLC 2BOCC 5CINL 4OPHA 2WLZA 5E6ID 4PLOB 3WUWA 3ZHLA 2QJ1A 4P05A 5AFAA 3V8OA 2WLIA 1MVUB 1UQSA 4JX0A 2B39A 3H85A 5AL0A 4F15B 4PH8A 5EOQL 1A4CA 2IH3B 1MFNA 1HCYA 3BAEL 4X9YA 5I1IL 1NT2B 4X7SL 2QGNA 1W0VA 2VUOA 5KEZA 3C3SA 4HDIA 2OJEB 3KS0H 5A7EA 4F93B 3ECBA 4LRNL 4HLEA 4DVRH 1QBZA 3C75A 3ZN6A 1KP3A 3G9VA 2GBVA 5AAWC 2PABA 2OYLA 4RGMB 2EDDA 5E95B 3DVGA 3TEWA 1OQOA 1AFVL 5C0JB 1IM3D 2BY2A 3D51A 3DTXB 4KROC 4IIJB 4M1CC 2UXNA 4OM0L 4JFED 4KK6C 3I3DA 2HG5C 1U8NA 4NUJA 1NGYB 4O2CA 4RNRA 2E27H 4ICXA 2ALAA 1KJ2H 1OCWL 1PSKH 2G3ZA 4FXTA 2WO3B 3LDBB 2CDGA 1TVKB 1TFPA 5SWZD 1JZJA 1RIHH 4AZ8A 4OCYH 1E5BA 2BZDA 3WGVB 1UCBL 4XBFA 2H1PL 3JXAA 3D25B 3KBHE 1F13A 1GGYA 4IBWA 4F33A 4LASH 4ONGH 2WWMD 4LCIH 2JI2A 2UVEA 4Y4HD 1MRDL 4KY2A 3WS3A 4JFFE 1MA1A 2AK4B 3U4BH 4CNIB 3MRGB 1K8DB 1EAJA 5AW5B 1CXHA 4D8PB 2CO7A 2FMLA 3ZMVA 3E80A 3NG5A 4GP5B 4J3UA 1JK9A 3S37X 3IN0A 1RD6A 1A2YA 2NXZD 5F7WC 3RX8A 5KW9L 3BZEB 2V9UA 1S7VB 3FW6A 4Q0XL 3MCYA 2BY1A 3C8HA 3ZZ1A 1NCHA 4DNLA 1U93A 3WMQA 1WJZA 3P77A 3R1GH 5EWIH 5BR8B 1P1VA 5F88A 4B95C 4HA1A 4JREC 2XC8A 1EPFA 3O4LB 3L74H 4I4WA 1ACCA 2F18A 3CS5A 2OL3B 1FYTA 4PA4A 3M17A 4XHQA 5DO2C 4YMPA 3WFHA 1C7TA 3RVXD 4JZGA 2ZCHH 2L8AA 2A79B 3NVQA 1WC7A 3NT0A 1FPTH 5D7JA 5DT1H 3WY2A 1A9EB 3FMGH 3JBG7 2L04A 1E9QA 1KFAL 3UAJC 3O3BB 1UD2A 2NUTA 2G5BB 3O3AA 3MBED 2OP4H 4WTWA 3S35X 3T0WA 3BIBX 4JHAH 1NOAA 5J12B 1N4XL 2YXMA 1PS3A 1RJZB 1HNXB 4YSCA 1N18A 4UINL 4OGAD 4FCAA 3H55A 1D9KC 4PSRA 2GTWB 3C5ZB 3C87A 2XZCH 3SKOA 1TTAA 2AFNA 2C1PB 4RCAA 5IE9A 1Q9LB 4NM4H 5HHPB 4L8SB 3V6BR 2NQCA 1T2XA 3F6LA 4Q2ZB 4WFEA 2RD0A 3IEAA 1J11A 1JD7A 3T4YB 1XNQB 4BZ2A 3LN4B 4B9YA 1AQMA 3CQPA 2J73A 1KCBA 2RCSL 1SYSB 5SX4H 1QA9B 4AGMA 2WNXA 2KH2B 4PA9A 4K2UH 4XO5A 1H3UA 3C08L 5B8CC 2YA0A 4GUQA 3MACL 5EBWB 1MUJA 2KYIA 4BW9A 1N9PA 3IGUA 1TG8A 2ZAGA 3RGVD 3GBDA 4A55A 4JFZL 2BZCA 2OW6A 3ILDA 4A6YL 2OX5B 4PJXE 3FYEB 1NVPD 5I24A 2RJZA 1I8KB 1OAQL 3OL2A 5A2CA 3CD6V 4GUPB 5E8NB 4B9IA 1EMTL 4GW5A 1OSZA 4H5SA 3MBWB 1NFIB 3KXFB 5DHDA 3Q44A 5CA0A 3G6DL 1GA2A 1FC1A 4U2ZA 5K59E 3DMMD 4KJWC 3BABA 2DLIA 3O9WB 5EN2B 4C56A 1Y6KR 2X41A 2N74A 4U3FH 4XNZC 5HGAA 5IDJA 1KTCA 4UBDC 1X9RA 4Y19A 2DQEH 3MV8D 1M9SA 2F1MA 1N7ML 2YZ1A 4R4BB 4ECNA 4U33A 2AHIA 1W72A 1JF5A 4JM2B 3ARDA 4Y16C 6TAAA 2YQ2A 4PGJA 1EM1A 2XPGA 3EIFA 4QCIA 1G1KA 1FV1B 1F3JB 1S7RA 5JCOC 2GJZB 3NCYS 2CDFB 2QQNL 3OZ9H 1DJIA 1SDDA 4HUCA 1SQQH 3ARXA 3UBXB 5GJTL 3O3DB 3NN8B 4LBEB 5E6ZA 3KLDA 4UM8B 3L75H 4EZMA 3EXAA 3VH8G 2YRLA 1T0NA 3TVMA 4X1KA 1A6ZA 3BI9X 3ES6B 4WWKB 2OXGA 1RUPH 3MJ9H 5ECGA 4NQSB 5EZLA 3FCTA 4BSVB 1P84J 4JYCA 3Q7JA 2XYBA 4RMBA 4AT6A 4L8BB 3V10A 4IIQA 5FKAA 2AJUH 2W94A 1MFBL 4I1NB 2VJ0A 4RUFA 4EXPX 3DSFL 3RWDA 4EBQL 5DMYA 4Y4FD 4G80B 4R2GB 5AQ0A 3NEOA 4E5XA 1F90H 1OPGH 2Q0AA 1YMHB 5J6GA 3HE6B 3CCQV 2DL2A 4F37F 1AR5A 2OM5A 1PVHA 2ZCKH 3SQBA 1XMOB 1SXBA 2G3XA 2W5PA 3QZWA 3GSWB 4XP6L 3R4DA 4IIZA 5E2WH 4BXSV 1O9WA 4TNVK 2WOYA 1TGOA 3ZDWA 1AD9B 1P2CA 4UV4L 5EUOB 2HRHA 4IMLB 1E6OH 3WUZA 3STLA 3ROLB 1JGLL 1R6NA 3PIQA 4J2QA 1CK0L 3ZKNC 4DR3B 5J5EA 1DEDA 1KEML 1RU9H 4H25A 5BXFA 4L9DA 1QI5A 2RFXB 2VXSH 5HGDA 4JKMA 1NL0L 3IF1B 3WBDA 1T1YA 2UZXB 5EO0B 3D6GA 1FS0G 5DC0A 2UU9O 3H9HA 2X2YA 3D9AL 2DB8A 4E4EA 4FNTA 4GLXA 1U58A 2ZCLH 4AQYO 2R0KH 2R27A 4JHZA 4GKKB 1QI3A 3T1HO 3GM0A 1JDDA 4AJYV 3E8HA 3RFRA 3KNBB 4G7VH 4LCCB 1JZGA 5B1KA 2EIMB 5DCCA 2BSEA 4LNUA 4YZFE 1WBYB 4NRXA 4XVTH 5C0NC 1XL4A 2IF7A 2ORBL 1P5UA 3NAAL 3F83A 2ZX6A 4N2HA 4BE5A 3BAYA 2KB1A 4GX1A 3MFGB 4MXQD 4N24A 1DQTA 3PL6B 1AQHA 1EZVH 4M1DH 4MMXB 3K0GA 4RAIA 4NOFA 3X14A 2QQKL 4A1RA 5HHQA 3LIZL 3SOBL 4TULL 5GW7A 5JZ7C 4UUJA 1FAKT 1ZLVK 2W9DL 4HQQH 3MRPB 1X5FA 2F23A 1XAUA 2JQZA 3MNMA 3I6GA 1MCRA 2C9PA 2OTWA 2YA1A 5KSUA 1I7ZA 3UTOA 1L5GB 3KYAA 4JI4O 1LWRA 3O6LH 1R5WA 2VLRA 5DQ9A 5DVLA 4ETQA 3VXQA 4GFTB 2A06H 4G6FD 1CPYA 2DBLL 2VISB 3PAYA 4BSWB 1RZKH 4D2NA 4B3TB 2BXZA 3REWA 2PGGA 3QZNA 5CEZH 4Q6YA 4F7EA 3WKQA 1A7PH 4LDOB 4O5LL 1Z5HA 1L6XA 4Z8FH 3KEHA 3A3YB 2R70A 4NGHL 2AANA 2CH7B 1EAQA 3EGDA 4X4KA 3U46B 2E6QA 5D1XD 2PWHA 4M29A 5DMJB 3UACA 2ZE7A 3EG9A 2E46A 1HU8A 4WEBH 1HILB 1FIGH 5HHOE 1L9TA 5KMGB 3N1PC 4YDIH 3S98A 1E42A 3TO4C 3QXDA 3QWQB 2UXGA 2KDYA 1ZTEA 5IJ9A 4UQCA 2JKNA 2CJUL 2XNAB 1SVCP 3KG5A 1NGZB 3B6SA 3JWOC 5FCUH 2MCAA 3OC5A 1V10A 2OYMA 1CGXA 1F23A 1YYLL 2Q3AA 3OEHG 4C4BA 4OFYD 1EAOA 1CL7H 4IW4C 1AGBA 4XP1L 4OZGE 1E7VA 2P8LB 4PVLA 2AEQL 5DFAA 3HR5A 2F8OA 4R7NB 1ZS8A 3D0VB 1JGDA 1U3HA 1JWSB 4DV2O 4NN7C 5IK3B 5CJQL 3F7YB 4TTDD 1FL3B 2FT7A 4W70A 3VDBA 1LDSA 3SD2A 1AROP 4HS3A 3QO1B 1N36O 1DN0A 5ES4B 4ZMQA 3RWRD 4JTDB 3KPRB 1XF2A 3FCSB 3C5ZC 3VNYA 2D7TH 3HCVA 2F66C 1AJPA 2XICA 3K5NA 1U8MB 3CCMV 3B2EE 5FX3A 1B9ZA 5CP7B 3QHZL 3UJTH 1S9WB 1NKDA 2WLYA 4GS7C 4ZG1A 2HP8A 3QE5A 2OTJV 4OJFH 2J88H 2H32H 3F8UB 5F3BB 1XGUA 3CVHA 1HKLH 3LAFA 3T4AA 4BK8A 4UTBA 2E9WA 1QD0A 2HXAA 1SJEA 4MT8A 5EBWC 1FORL 5ITBH 3WNMA 3TA4D 1BFOB 1WT5C 1M57B 1MFEH 3L3KB 4FQCH 3B7YA 5DFVD 4Q9QH 4OLYH 3U9WA 5M95B 1AKPA 3EYUL 3W0WA 1HEZA 5C0GA 3RIAK 4JPVL 3RN4A 5TDPB 5JXAH 1OGAD 4KKRA 3VRLF 1AI6A 3SJCC 1NAKL 4H8WC 1NAMB 3REVB 4P07A 1RY7B 3ROOA 3BQUC 3EH4B 3WIIH 3OAAG 3RVUD 1RCYA 2NYYD 1TQSA 4WUKL 1S9VB 4PEEA 4L4VA 4RFOH 1WFJA 2PTVA 1I5XA 5ESAB 5HFMA 3L4ZA 5CLTA 1DVQA 5C0EA 4OBSA 3BKML 1T21A 5H35A 3SSGA 4WI2A 1RZGA 2VLKB 3U0PB 2NX5E 2FZ3B 4ONFL 2UXDB 4PJFA 3TFBA 4MA8H 4PJ9A 3LTVA 2WV3A 4W4OA 1UJ3C 1Z1WA 2OSXA 5D9SB 4WCYH 1NBZA 1HNWB 1S4IA 3UTZA 3EHBD 1NC4A 1NTDA 4WU7B 4DR2B 2R23B 3EJTA 4QGTA 1ESOA 3O81A 3G7TA 1KYOF 8PAZA 4F7MB 4WWKC 5PCYA 3WKML 1WV7T 5JMOC 2Y5EA 3R06B 3VQVA 2Q7EA 4Y1AD 7PCYA 3CNKA 2VN5A 4Y4KC 1O6SB 4PBDA 1FVDB 1UOWA 2YN3A 1EJ6A 3EJYC 3OR7C 1BBJB 8FABA 1RP9A 5KS9E 5KWYC 4JYYA 1SVBA 4A04A 1IXMA 1KB9J 5ETUB 5C7ZA 2VDMH 1W0WB 3HR6A 1MFMA 2A9BA 2UZYB 4PJBF 4PJEB 1VQ7V 5ITFB 3HC2A 3K4AA 2HFEB 4TRPH 4ZYKB 2AQSA 2V8MA 1XCWA 2R83A 2YPVA 3M8OL 2GC4C 3H9ZA 2A73B 5D6DA 3MLXH 3SE8H 3OUFA 3MAWA 2CLVA 3OJ2C 1OK8A 2Z35B 3IPBA 2FL5A 4XNXH 5H94A 4QRRE 1W15A 2IMNA 5DSCB 5I1HH 1YA5A 1QHQA 2ADGB 2HJFB 3K2MC 1FO0H 4HMEA 5TISZ 1CYXA 5JYLA 1HJCA 3LZNA 4X62B 1TQUA 5CMAB 4P2AA 3SDCA 4XOAA 2FT8A 1HH9A 1QBAA 3P0VL 4AE1A 1YEDB 3FK3A 1ZIAA 4FXGA 4FCHA 4KKCD 4Z76B 2VZVA 3EOTH 4ATTA 3OT7A 1SJMA 1JS4A 3GNML 4YX2H 4JZOB 4E0RA 5LGYA 1T6WA 4NWTL 1MCWW 4U4IA 4FI8A 4FYSA 4JFVA 4JFHD 2NTFA 5JWPA 2MNWA 1S7TB 2ESVD 3OKNA 4XNQB 1TNMA 4KJPC 3AREB 4I9QA 4FG4A 5HHMD 4DP1X 5G5DB 4JFQB 3N2GB 1Q43A 3P3PA 2NXYC 2PO6C 3CLFH 4FZ8H 1M7DA 4OCXL 1IFHH 1IBMO 4UB0H 1F7YA 3QEHB 5FYLL 4MQ7B 1IQDB 2CMRL 1MI5D 5SWSE 1O6TA 1ZX3A 3MJ7A 5GXBB 5D7KE 2JKRM 3B8YA 3MGAA 4KZDL 5E6IB 1INEH 4WFFA 4ZKIA 4JI8O 4MSWB 4OZHA 5GGRA 2J6WA 1AIFB 2K3HA 3DK0A 4CKVX 4J3OC 4X64B 4FMKA 3H7BA 4LFHD 4PIBA 2PR4L 2OSWA 3DROA 3K5LA 3V0VA 4B41A 2IJJA 4CC4A 3RWJB 1AMXA 3I56V 1A6PA 3GTNA 4MD0B 3EUDA 1RJYB 4HT1L 4PRIB 5AB0A 1GZHC 4HFUL 5EBGA 3QG7L 3OTFA 4L8DB 3LS4L 4RRPM 3ZYJA 2BS9A 2YPLA 3FSZA 2AXFA 4YHMH 5I16A 2VL5B 3ILPB 5CJXC 3G5VA 4PV1B 2LW7A 1RURL 5IP4A 1G7QB 2HSIA 3HNTL 4O02H 4J1UB 4B3EA 2PCPB 1TITA 3ARPA 4CDHA 1NUFA 3IAGC 2X9XA 5EULV 4JFEB 1MCHA 1R0AH 1DCEA 1MWAA 2K8QA 5GZOD 4KKZA 2R7EA 5E2UH 3D39D 3KLHC 5DMIH 1IAOB 2QHLA 1J88A 2JKJA 4GKLA 5F21B 5HJBA 2Q7YB 1WZ1H 5G2NA 3MFFB 3UZVB 5SWZB 1MW0A 3TT1H 5CD5D 4XBGB 4LESA 2Q9LA 1F41A 2IH3A 3LMJL 4N0UB 5FYJH 1CZ8L 1F6FB 5TQ2L 1PL4A 2Y72A 1S76D 3DRQB 5AG8A 3TV8A 2BVOB 2CBPA 2K9PA 4Y4HB 3EXLA 2VSKB 2OJEA 3MU3A 3SYCA 1UCTA 2PN5A 1F6AB 3BLBA 3I6LD 4B5EA 2JDIG 3ULVL 4JDTH 4K3JL 2FYYB 1VFOA 4ZMOA 3UL4A 3CFMA 5I18H 2XHNA 4ZS6C 4JN1H 4CSTA 3VXPB 3HNSL 3D3VD 4ABVA 5C0JA 3DTXA 4IIJA 1R3KB 2MKLC 2NRDA 1F0LA 4YQXH 5JUEH 1JXJA 2OA9A 1SGKA 4XNAA 5E94B 3RDJA 4D9QD 1MVYA 4JY4B 4LLUB 1XGQB 4ZQTA 1NGYA 5F9AC 4KRPC 1U8IB 4GKNB 5DS8B 3VXME 2DJSA 4DR7B 1AIZA 4XN9A 3L4UA 4KKLC 1BT8A 1TVKA 3TCUA 4AK2A 5JXEC 3IPFA 4I9WA 5E9NA 4POYA 2GV9A 2JEUA 1PD0A 3VFPA 1LO2H 3D25A 3KYNB 4YPGA 2KZKA 3PJSK 4GNKB 2C9SA 2J4WH 1X5GA 1BJMA 4FG6C 4J3XA 4ZW6A 3VGFA 4AQ1C 3FF8A 4FLHA 2B4CL 2CSPA 3MBEB 1I3RA 5D5QA 1FNHA 2F1EA 3POCA 5KHGA 5D7SL 2AK4A 1TZGH 3HHRB 2BTQB 4YJ3A 2H0PA 4PGDA 4CNIA 3MRGA 5E9DE 2NTSP 3FQTB 5TQ0L 1K8DA 2PW1A 5LYJB 2DW5A 12E8H 1A5FL 3TX4A 1ZEAH 4LLAA 4D8PA 4H8QA 1LGVA 2J57A 5DEDA 5HDBE 3QFJD 5KBNC 1FN4B 3HAEB 2X2HA 1PZ3A 5FLVA 4IBYA 3BZEA 2HT2C 4LPYA 5D7HA 1S7VA 3A47A 1BZ9B 4ATWA 4ISVB 1S0VA 2AERT 2JQAA 2VDLL 2F5BH 1J8RA 4IRJB 1P6WA 4WKZB 3WKYA 2XBDA 3O4LA 2JH2A 3K08A 2WLNA 3WNLA 1LD9B 2Q2EB 3WV0A 4F7CB 4P99A 1KB5H 2OMZB 4DWHA 4JPKL 3CFEB 1NANH 4LVNB 4YK4C 3RGVB 3TT3L 4OCNC 1A9EA 1I1AC 3IGLA 1BM3L 5DJ6B 4K23L 1HDMB 1GJIA 1HP8A 4PJ5D 1IX9A 2EDMA 3O3BA 1E43A 5LBVA 5LBSH 5GGTL 1KDJA 2G5BA 4PR5B 4AYGA 1S3JA 2WP3O 3RNQB 4DUXA 4OSUL 1LEGB 5T3ZD 3WDJA 2CRYA 4UU9A 5DD0H 4JDZB 3S3XA 5B3SB 4N2LA 1YNLH 1P7KB 1RJZA 4G6ML 3OLGA 4LF6B 2B9BA 2GTWA 2Z8RA 3ME0B 1VHPA 4CDGC 3ZIAG 3VMNA 1Q9LA 2H2SD 1KFGA 2EE2A 2A1WH 3VQMA 1QSEB 5DK2B 3MV8B 3II1A 3RP1A 3ML9A 3S3PA 2CGZA 4TUYA 1JTOA 3T4YA 2A2QT 2CTRA 3LN4A 1OP3H 4N6RB 1SYSA 5AKRA 1QA9A 2V9QA 4DP2X 5I1KH 1UA7A 2IOIA 1JV5B 1HEHC 3CCHB 2HJFC 1SZNA 4HPOH 2YJLA 3RIFK 5B66Z 3LHPH 2Y1YA 3FT3B 3VXUB 1VZGA 3MNWB 1BF8A 4LLVB 4WTQA 4LCVA 4K8RD 3DECA 2Z31A 4GBXB 2FRGP 3ALXA 5B1BC 1DBMH 1VFMA 2UUAO 1AHWC 2NY3D 2OX5A 2BZ7A 3NJKA 5EIIB 2Y06L 1I8KA 4NXSA 4U1KA 4GUPA 5E8NA 1X5KA 1X5XA 3G67A 3MBWA 4LFBO 2Q2LA 1NFIA 1J10A 4B53A 2MQCA 5FV2A 5KHHA 1CFMA 5ADPH 4ADIA 4HAFA 3EFFB 5HYQB 5IG7B 1II4E 1TDQA 3O9WA 2WXPA 5EN2A 3GMRB 4ACTA 3KH3A 4AH2A 3H9SB 3ZE0F 4TNGA 2BNQD 4TN9A 2VMDA 4NZUL 3NEXA 3FO1B 5B21A 2CGNA 2VXVH 1ASPA 1YF2A 4R4BA 4YSRA 3BPZA 3GLEA 4JM2A 4LDEB 3QNYB 3AFLA 2JVUA 5IM7A 3DPDA 4JI2B 1EJFA 4WO4C 4WNJA 5E6IC 1F3JA 2GJZA 1MCKA 2CDFA 5D70L 1JWMB 3VX1A 3QO8A 4LGSB 3CD4A 3BVUA 5D1ZD 4NXNB 4LBEA 3NN8A 3ZO0A 4AEIH 4WFGA 2H0FA 4UM8A 3SDXF 1IMHC 2DAVA 1WZKA 1S2EA 1B3JA 3ES6A 4KVCL 3AT0A 1TZHB 3P9WB 1KBWA 2VWEE 2EIJC 3DX1A 4NKIL 3RUGE 4KRMB 1KXVC 3RVYA 4NQSA 4BFNA 4LRIC 1ZHBB 3QHFL 5C2BL 1D2DA 1CGWA 4BSVA 5KJ7E 4FFKA 3IFLL 2A9CA 5A2AA 4L8BA 7PAZA 1D5ZB 4GXVH 2WCSA 3JWOH 2K6WA 1YEJH 2UXCB 2XN9E 2UY6B 2OR9H 1ZWIB 2XIDA 4G80A 4PV1C 4RETB 4K4KA 4N1HB 4YXKL 4DK1A 4N8UA 3L5IA 1DJWA 2OL3H 2JKXA 4ODHH 4ZS7L 1QKZL 3L5WA 1YMHA 4FNLL 4Q9RL 2C9VA 1Z9PA 2CBOA 1M42A 4NJ9L 3HE6A 2M6YA 4AL8C 4DV0O 1QP1A 3HKCB 4E42B 5ADOL 2FHBA 1RPOA 3ZHKA 3GSWA 3KGRA 1A6TB 1RP8A 1G6RA 3NJHA 1CLYL 3ASWA 4IMLA 5EUOA 4BINA 3ROLA 3ESPA 2J56A 2AF2A 3ABZA 4YIPA 1A8ZA 2PUSA 4XBPB 4J27A 3ZHDA 1ZSHA 2JFCA 2WWMC 2JI3A 3IF1A 3O41B 4KXDA 2UZXA 1BYPA 4JZNB 5EO0A 4YC2B 5IWAO 5F0PB 4UQEA 2YMTA 1JERA 2X1WL 4Y4HC 4ZK8A 4J8RA 3V6ZB 5JA9A 4MA7H 4ENED 4DV5B 1R3LA 2F0CA 3H54A 1IC1A 3LXAA 4FLSA 2I69A 3ZRCC 3KNBA 4LCCA 1I9JL 2IAND 3DARA 3ILQD 3ZDXF 5IQNA 1WBYA 3F2LA 2WSDA 4HBCH 3W5MA 1JJOA 3TXSA 4Q7DA 4NRYB 4X6EB 4YGAB 2NXZC 2XPZA 1S5IL 1KTJA 3PL6A 1SXCA 4MMXA 2WANA 3VDAA 2MJWA 3OKKB 4JQVA 4B3RO 1XD1A 2P48B 3BP4B 4HSAC 3F5TA 1GC1L 1SXNA 2AHYA 3MRPA 2A74B 2PXYD 1IC7L 2PYLA 1UD5A 3IMUA 4H8WH 3H6JA 5GRUH 1VKXA 1I7UB 3A4EA 1W8EA 2QADB 1L5GA 1X3DA 4FQJL 5JOPE 2CHWA 3UTTD 4BEIA 5TTRA 2E75B 2HVKC 4POUB 4QOKD 2DIAA 2X4OB 1IGIL 1XF5B 2GJ6B 4GSDH 4ONOA 2VISA 4BSWA 4OR1A 1OP3K 3IC7A 2ZAIA 1M2OA 3S0PA 3RDTC 2R1YA 5FYKU 3QRLA 3LNIA 1P4RA 2APBA 1AI1L 2CK0H 3AS2A 4OGAC 3U46A 3DJRA 5B3JE 4MS8D 1U30A 2F8XC 1XCTB 5E99L 3B3IB 4DV6B 5E56A 1HILA 3JAWA 4GUNA 2DQCH 5KMGA 4TYUA 3ESNA 1HNZB 1DL7L 1R4XA 4ZD3H 5HYJA 4KGLA 2EJRA 2H8PB 3UYOD 3R19A 2WYHA 5FFGA 2XNAA 4HS8L 1NGZA 2MPAH 3P9MB 1GS6X 4LSTL 4PFEA 3KPTA 3HLAB 3ZMTA 1UM5H 2J21A 5CN0A 1OTTD 5BY1A 2P8LA 3MHSC 2V2TB 4I0PD 1RSFA 2QA4V 4R7NA 3D0VA 4FYRA 3FUFA 1JWSA 3DUUA 1FG2B 3FJTA 5IK3A 4ZUWB 4N0YH 3F7YA 3V4PH 4FQXB 2ENJA 4XCEA 1FL3A 3ETBJ 2EZ0D 3ZKMD 3PFUA 3U4EB 1OGAB 4PS4L 1N34O 1KBGL 4GRLD 2EH8H 3ZSSA 4KXZH 2C2AA 2ROXA 3HI1B 3OBAA 1BVOA 2J6EL 5C7XH 4NIYE 3O0RL 1NFDF 3DMMC 1NLDL 1M6OB 5FUCC 3IXAA 5I17B 4M61B 3RHWF 4P49A 1M2VB 3OVUB 2VAAB 1N64H 1U8MA 2B14A 5B1JA 2ZM6O 1OM9A 5C92A 1QLEB 4J7KA 5E2JA 2E3CA 3O65A 1S9WA 1WAAE 4OV5B 1JDCA 1KCUH 2J8HA 5DR5L 2XBTA 4IQHA 3BAXA 2WXOA 5J6HB 4WY7L 1W2KT 5F3BA 1T66D 1MG1A 2F58H 2JV6A 3WENA 3N1QC 4CBZA 1H6EA 3LZOA 1J8HD 1DSWA 3WD5L 5FWQA 1O75A 1BFOA 2NT1A 5EU7C 2EEDA 3BEHA 4JE4B 5I8CB 2NZIA 1H8LA 1ZT1B 4LCYB 2ITEA 2JTDA 4WI8A 1O0VA 3QUZD 1DF4A 5TDPA 1MHHB 3HG1E 1YC7A 5EU6B 1LP9E 2KKQA 4GIAA 3KJ4C 2CJSA 1NAMA 3CBJB 1E6JL 3REVA 3ZYZA 5LWYH 3QNZA 4NX0A 2VDKB 2IDFA 4Y4FC 5AAMA 1JOYA 3BFOA 3H3PH 1NGPH 1MREH 4LLQA 4PJAF 4J3OH 4KK5C 5ESAA 4D7TA 1X4TA 3ZJZA 2X7LB 4Z7WF 1A4AA 1HXMA 4OPAA 2XWEA 3U0PA 1GH6A 2YEVA 3DIFB 1YPZB 2FZ3A 4HJIA 1YCIA 4YSDA 1JHTA 1BOYA 5C0IB 5KVEH 4AGPA 4DGVH 1Z6JT 5D9SA 2F7IA 3A4DA 1NMCB 5AZEH 3WTSA 2R23A 1F18A 2FB5A 2E74C 1SUJA 4KKAD 4F7MA 2YAHA 3PY9A 5DJCB 3SDYL 3R06A 1BAFH 2CGRH 4UT6H 1NUNB 4B3MB 3AG1B 2B5IB 4YXWG 1O6SA 1FVDA 1BS3A 4ZNEE 1WFMA 3PP3H 3W82A 2C9UA 1BBJA 2P80A 3SQRA 2ESVB 4HYTB 3T4ZA 3GBEA 4JO3L 2DJVA 3BN3B 1YMMD 4FQLH 1BHAA 3FQUB 5ETUA 4M1GL 1RZQA 2KG7B 1W0WA 3VRJB 4KU1A 4KHXH 4AWJC 3S8WA 1DVZA 1X5JA 1G1OA 3CPWU 2HFEA 1BIHA 4PUBL 4S1SL 4ZYKA 4ZDHB 2P4AB 4O2BB 1WB8A 4QE7A 2A73A 3QG5A 2DZEA 4MXQC 4OD3H 4PJBB 5L7XL 4FHJA 2Z35A 2VERA 3P0YH 3BSZA 5D7LE 5J7CC 5EBMB 2BSDA 4OD1H 1EDYA 4POZD 5DSCA 4OF5A 5B4MD 3ML8A 4ZFOL 5C1MB 3QDMB 3AMLA 2ETWA 2IJKA 3NCXA 4JFTA 5IROC 2JJWA 3VD0A 1IT9H 4QHMB 3CYOA 5CMAA 3E9TA 2YDEA 3CPLB 4JKPL 2IU0A 3PQYA 1YEDA 4RIRB 1MLBB 3FONA 5L3CA 1MY7A 4LLWB 4XX1G 4Z76A 1CBVL 1BF5A 2RJMA 4JZOA 1OCRC 5FO7B 1OCZB 3UYRH 1RULH 1JFQL 2PW2B 1S7TA 2NY1B 4MKMA 3RPIB 3DIDA 3DVNB 2PYFB 4XNQA 5C09B 5FR3A 3IKKA 3AREA 2ZXQA 2VC2B 5G5DA 5D1XC 4JFQA 1TUPA 3N2GA 1KZQA 1VGKB 5KSVB 2NSQA 3P3NA 4MQ7A 1IQDA 4HOXA 2DWXA 2K4AA 3V6OE 3D39B 1HL9A 1TKWB 1PLCA 2CJ3A 4X80L 3HPJB 3PABB 3VG9B 3SKUD 4XMVA 1CG9B 1U2CA 3FQXB 3QDAA 2LTQB 2PWGA 3CHPA 4MSWA 5K93A 5DC9B 4N2AA 1YECH 2Y7NA 4ZO9A 4YPJA 1AIFA 2F7QA 5GZNC 1E27B 5KSBF 5ACMA 4DFIA 1CURA 3P3UA 5H6QA 1W6WA 1AXSB 4XO3A 3HRPA 3ZL1A 3HZMB 2X38A 2MOGA 4L5FL 5F7YC 4JG1L 2E75C 1LO5B 3RWJA 1OHHG 3AAZB 1V27A 3IGAC 4PRIA 1RJYA 1CE1L 1K72A 3VW3H 3OLIA 2ZYIA 4L8DA 2VL5A 3ILPA 4TOYH 5C0AB 3TIDA 3X1EA 2CK2A 4PA7A 2P8MA 1G7QA 1N6VA 5D2NB 4LF5B 5DRWB 3VA6A 4J1UA 3QQXA 2PCPA 5IWLA 3FFOA 2P7TB 4L0PB 2WPGA 4E41D 2HPTA 2H45A 4JFEA 2QKAA 2OSYA 4PDVA 4B50A 2VDOB 3S36X 4HCRH 5LXGH 1WP8A 1HNGA 4PJHE 1IAOA 1J5HA 2EINC 1YITV 2WUBL 2Q7YA 4WFHE 4UZSA 5CGTA 3UZVA 2DWEB 5A2JH 3PHSA 2VW6A 5KVFH 2YQ3A 3PJNA 2YGQA 4XBGA 2GJJA 2L0DA 3COOA 3CLWA 2AJSL 4DKFH 5C0RH 1OT2A 4N0RA 2Y07L 2LHAA 4N0UA 4XP4H 5GS1C 4KXCA 5E1GA 1XCXA 3DRQA 4PJ7E 2FO4B 1BIIB 1W9XA 1VIBA 2BVOA 1I7TA 2EE9A 5DFVC 2HAZA 4WGWB 1GTOA 5DHEA 3V52L 1V7NH 3EW3B 5GS0L 1F6AA 3FX7A 3VI3E 1A14H 2FYYA 3IDGB 4FFZA 3TC9A 4LVHB 3QFJB 1TAEA 5ALCL 5I71C 2JELH 3RVUC 1R6VA 2NYYC 3HG0A 3MLSL 1R3KA 5K9KB 1FNGB 4LNRB 3QJUB 3B2VL 1CFVL 3DJTA 5E94A 2G0LA 1FNSH 3DPBB 3AY4A 4LLUA 5ISZB 4QPJA 5HYSG 1U8IA 4GKNA 5DS8A 3U9UB 1WA8B 1AD0B 4ZPTB 3H01A 2MSPA 4M8UA 4N5ED 2YD9A 4PJDE 4Y5XA 5J13C 2ZT9C 3TZVD 4LFCB 2YKKA 1P7GA 5DLMH 4OUOA 4G7QB 3KYNA 3FQNB 3EHBC 2MW2B 2BC4A 3HUJF 1VERA 2WOBA 4P4KB 3QAZB 4PJ5B 4Y2DD 3GHEH 2IGFH 1TEYA 3HPLB 3TNMB 4YHOL 3CC4V 3MBEA 2XQBH 1HR0O 4XN8A 4ZX6A