1V55B

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1v55B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1v55B02
5B7EA 4KO9A 4HALA 1J9SA 3UGEA 1ZDSA 7PCYA 1W8EA 2ZWNA 1BXVA 4ENZA 5B1BB 3H4HA 4BDVA 2CCWA 3QJQB 4G7RB 1BXAA 4N8UA 4KO6A 2YAOA 1OOWA 1X9RA 3CDZB 3PXLA 3NJGA 3G5WA 5I26A 3X2QB 1QNIA 2BW4A 4A67A 4YVUA 3CDZA 5D4JA 3NSYA 2UXVA 2R7EB 2A3TA 2XVBA 3NJIA 4M4RB 1AZCA 2X88A 5IY5B 1CYWA 1ZPUA 3FQYA 2PPAA 4BK5C 2IDUA 4AX3A 1OE3A 3V9EA 3KW7A 1RKRA 3T9WA 4E9SA 4DP7X 2PPCA 2QPEB 3DIVA 3CVDA 1L9QA 1MZYA 8PAZA 3QJSB 1QLEB 2NRDA 1JZJA 2IH8A 4HHGA 2HRHA 3JT2A 2XXFA 1WA1X 1N68A 2YAFA 2IDSA 3KW8A 4YSDA 5AKRA 3PAVA 3U25A 1E65A 2DWSA 2IDQA 2VM3A 4K9JA 5I5IA 3HB3B 2Y1AA 1E5YA 1WS8A 4G7QB 2B08A 1KCBA 2VSMB 2XV3A 3FYIB 3FQ1A 5D4HA 3X1BA 1XB3A 2PP9A 4KO5A 2HRGA 1AQ8A 3UABA 1T5KA 1NIEA 2Q9OA 1FFTB 5B7FA 4DPBX 2IDFA 4E9XA 1BYPA 3EH5B 1FA4A 2BO0A 4YL4A 3WIAA 3HEIB 1W6WA 3WKQA 1MDAA 1WA0X 1MZZA 1X9UA 2XWZA 2BP0B 2VW7A 2AZAA 1JZGA 1PLBA 3FPXA 1PLCA 3X1EA 1KDIA 1XMEB 2PLTA 5B1JC 4E9QA 3N2JA 2CALA 4GP8B 4FAAB 2BP0A 4F7KA 3NJMA 3AG2B 1HAUA 2GC4C 1IUZA 4W9ZA 3AG4B 1NPJA 2FT7A 2N0MA 1F56A 3IBOA 3C75A 2UXFA 2YAQA 5B7MA 3SBRA 2XLLA 4ZK8A 2HLEB 1NZRA 1ZV2A 2AFNA 2ZONA 3EH4B 4KO7A 1KDJA 4G71B 1XB6A 1M56B 3S3CB 1ET5A 4P5RA 4EF3A 1JVOA 1AZRA 2E86A 4KOCA 1L9PA 2H3XC 3QJTB 4A2HA 3S3DB 3T6WA 2GSMB 4PCYA 1SF3A 3NYKA 4N4YB 1HAWA 3FPYA 1E67A 1J5DA 2FT8A 1BQKA 3NT0A 1NIBA 3DTUB 4KNSA 2X87A 2LLNA 1OE2A 4WTQA 1IKOP 2ZXWB 3WKPA 5LDUA 1RZPA 1NWOA 4NB7A 1J9RA 3QJUB 1A4CA 4YSCA 4GYBA 3CVBA 5A7EA 1JOIA 4DP1X 3FQ2A 3OQRA 3CG8A 3TA4D 5F7BA 1WA2X 2PPDA 4GXFA 4FA7B 1JZFA 2YEVB 1L9OA 1SFHA 1V55B 2J55A 3ZX1A 2XYBA 2EILB 5PAZA 2RACA 5B1JA 5F7AA 3FSVA 3GXUB 2PPFA 3GYRA 3NSFA 1W6LA 2XXGA 3NP4A 3S8GB 4HCIA 3EHBB 5I5JA 1YLBB 3FT0A 4HHWA 4HZ1A 2J5WA 2MTAA 4MFHA 3IEAA 1PCSA 3QJVB 2YAPA 1R1CA 2W88A 1L9RA 1SNRA 3NJFA 3ABMB 4X4KA 4AKPA 1TKWA 2UXTA 4G72B 5TK2A 1JZEA 3UADA 1OE1A 3AG1B 2EIMB 1NIAA 3FS9A 3ZBMA 4DP8X 1DYZA 3FSZA 4YSQA 1AG6A 1ZDQA 3IN2A 4JHUA 2HZHA 4P5SA 2FQFA 2P80A 6PCYA 2XU9A 1ASOA 2VM4A 2GB2A 2WO3B 3T6VA 1NWPA 4YVNA 1E5ZA 4L0PB 1ASQA 2GC7C 2YXVA 1OCZB 1JXGA 3V9CA 1BQRA 2DYRB 1ID2A 3BQVA 2UX6A 2YARA 3PAUA 2VN3A 5I6MA 1EHKB 4YSTA 1IC0A 2EIKB 2JKWA 2QT6A 3D12B 3ERXA 1GS8A 3PAZA 2XV0A 1J5CA 2DV6A 4W1TA 4YSPA 2FQEA 1JVLA 5B3SB 2PCFA 2I7OA 1OCRB 1AG0A 5AFAA 1PNDA 5ANHA 3IN0A 4HCFA 2GIMA 1UATA 1A4BA 5I28A 1SHWA 2I85A 3X1GA 4DPAX 3ABLB 3CZUB 1ADWA 1KCWA 2IWKA 1A8ZA 2VMJA 5I6NA 2PP8A 1AR1B 4GP5B 2PP7A 3FU8A 2H47C 3AY2A 3X1FA 1PY0A 4DP6X 3FU7B 3TBBA 1A4AA 3TU6A 3AW5A 4E9RA 1ETJA 1JXDA 1AS6A 2P80D 2HX7A 1AZNA 2MRYA 3NJKA 4HCGA 4WKXA 5E9NA 3ZDWA 1NTDA 1SF5A 1ZIBA 3ABGA 3FU7A 4YSSA 3T6ZA 2BHFA 2WO2B 4CSZA 1J9QA 7PAZA 4RH4A 4A68A 4TXVB 2BP8B 1GS7A 1FWXA 3AG3B 4BWTA 1GR7A 2IAAC 3NJNA 2BP8A 2BWDA 1AAJA 1M9WA 1L9SA 1PLAA 2QPDB 3QJRB 4G7SB 5AZUA 1GSKA 3UAEA 2FQDA 3NP3A 4NERA 4DP0X 1PF3A 3UAAA 2FWLB 3IE9A 2AVFA 2PCYA 2GBAA 1RZQA 2IH9A 2J57A 3NJHA 5PCYA 1CC3A 3JTBA 3MX0B 1ET7A 4DP9X 3GDCA 2HX8A 1AANA 2OV0A 2GI0A 1NDTA 1IBZA 1BXUA 5TK4A 4A66A 2HXAA 3NJJA 3PCYA 1I53A 1GY2A 1NPNA 2I7SA 2VSKB 1XB8A 4GY4A 1PMYA 4F2FA 1OF0A 1OV8A 3MBWB 1URIA 4E9TA 4QKTA 2QDVA 4HIPA 4KOBA 3OMNB 4PAZA 3T71A 1ILUA 3EH3B 2EINB 1E30A 1PNCA 1SDDA 5I6KA 4KNUA 2XV2A 4A2FA 2CJ3A 2FTAA 1V10A 2DYSB 1AS7A 4DP5X 1V54B 1EZLA 3TBCA 1WAEA 1AS8A 1TEGA 1A3ZA 2YQBA 2YAHA 4A2EA 2EIJB 1BEXA 2HX9A 2IWFA 2YAEA 2VW4A 3H56A 1JZIA 2QDWA 1TU2A 4A2DA 2W8CA 3X1NA 2JXMA 3FU9A 2JFCA 4YSOA 2FT6A 2AANA 1BYOA 2OJ1A 4DP4X 2VW6A 3OMIB 2BZ7A 3L45A 3FSWA 2FJSA 2J56A 2Q5BA 2XX0A 3NSDA 3WG7B 2BW5A 1SFDA 1CYXA 2R7EA 2BZCA 2DY2A 2TSBA 1CURA 3T6XA 3SBPA 1DZ0A 3WNIA 2B3IA 4BWWA 4A2GA 4F2EA 3UACA 3SQRA 4QLWA 3ABKB 2UX7A 4JHVA 1NICA 1ZIAA 3S3BB 1WS7A 4NAJA 1GY1A 3PLYA 1N70A 4M3HA 3FYEB 1PAZA 2IWEA 1AIZA 2FNWA 4E9VA 4DP2X 5I5MA 1GYCA 4HAKA 4BXSV 1ILSA 2YAMA 4E9WA 1QHQA 5I6PA 3RYMA 1SJMA 1MG2C 2H5UA 9PCYA 3AZUA 5B1KA 1GW0A 3PPSA 3WNJA 4UAHA 1J9TA 2YXWA 1KYAA 4YSRA 1JXFA 4BXVA 1CUOA 1BAWA 1KV7A 2UXGA 2DWTA 2Y69B 4YSAA 1AACA 1GS6X 1KBVA 3OD3A 1A65A 4UF7C 1KGYE 2OCCB 3BVDB 1PZAA 4AI7A 1HFUA 3FSAA 2CAKA 4JKNA 1JZHA 5B1AB 1PZCA 5I6LA 1OCCB 1AZUA 1VLXA 4Q8BA 3ZIYA 3DKHA 3NJLA 2WSDA 3SBQA 2BWIA 4Q89A 1AOZA 4DPCX 4GP4B 2XUWA 3QPKA 2IDTA 3EF4A 4KNTA 3QQXA 5D4IA 5FC9A 2AZUA 4AZUA 2PPEA 5I6OA 2TSAA 2CBPA 4AKQA 2XX1A 4CSPA 4YSEA 1TEFA 1BQ5A 1IBYA 1MG3C 1OCOB 2GHZA 4G70B 6PAZA 4UANA 3WI9A 1ASPA 4E9YA 1JERA 1L9TA 3H4FA 3OM3B 2ZOOA 3OMAB 1NIFA 1NINA 1SHXA 3ASOB 3TASA 1M57B 4AKOA 3ASNB 2CUAA 1PZBA 1KBWA 3N55A 1SDDB 4YSUA 1NIDA 5EHFA 3CVCA 1RCYA 2FQGA 3S8FB 1AZBA 4BWUA 3NSCA 1B3IA 4BDVB 1ET8A
chains in the Genus database with same CATH superfamily
5BZXA 2G38A 1EJ6A 4ELDA 3HI6L 4JN1H 2BXYA 4S1SL 3TM6A 2ZWNA 3KDPB 4DW2L 5C70A 1LL1A 2EDMA 2Q6WB 3R06A 3RDTD 3LSQA 2CO3A 3TEXA 1PD0A 3MV9E 3K2UH 4J8RA 3KYKL 2DJMA 2HFFA 4OSUH 2BDNL 3OKEB 2X2HA 3NCYS 5DD3L 5B3SC 5F2VO 3X2QB 2OTUB 3WS6C 3MC0A 3RA7L 1LDPL 2DQDL 5BCAA 3CDZA 4JFFB 3COOA 2UXVA 3NSYA 3MFFA 4MNGB 5F7EL 4WSJA 5A43C 1OAYL 2Q87A 1T5XB 2N74A 4J3UA 3NCEB 4WWKD 2C7UA 2BJML 4J7RA 1ZPUA 3T08A 3O8XB 1IBKB 3SDDB 4OI8A 2PPAA 3ETGA 4YE4H 2IDUA 4DZBB 1P7BA 1Z5LA 1OE3A 1XOUA 2DIEA 3BMWA 3IBEA 3U0ZA 2OWOA 4D3CL 3JYCA 4OPAA 1A3LH 1F58L 2NY1C 4M8RA 3ULVH 1QUNB 3JTSB 1BA9A 1IU1A 1F3JB 4GRWF 1CU4L 2Z5UA 1ED3A 1JN6A 3GQFA 3BFWA 4UQAA 2AF2A 3RBSA 3TIDA 4EKJA 5FGBC 1WIOA 1E27B 1I31A 1N19A 2VZSA 3KH4A 2YD2A 3N85L 3AMKA 4N2LA 1E65A 1LHZA 4K9JA 1JPFA 2AK1H 1NFKA 3FHEA 3HZKA 1GVIA 3NG5A 2R1WB 2GFBB 3I6KA 1I1AA 4K15A 2P24A 4JFOA 5D96B 4UTBA 4MCNA 5BMVA 1TVHA 3BFOA 3DO7A 1AMXA 1L0YA 3E1F1 4WFED 1MQKL 3T0DA 4LVNC 4JJHA 2AV7B 1FYTB 1KCKA 4MT8A 5F9JB 3CV5A 4XNMB 2EZ0D 3TZVB 1MW1A 4FP8H 4LZKA 4PJ5A 5D2NE 2GK0B 1N3NB 3WJLC 1K8DA 4KU1A 4NIYE 5B7FA 1XSOA 4RZCB 3C6SA 3UDWC 2MCMA 1Z66A 1Z9PA 2Y22A 5F7UA 1YZBA 5DS2A 1ZWIB 1SUHA 3S37X 2AZAA 2PR4L 1IGMH 4FE9A 3FPXA 4LHUB 1RSFA 5TDOB 3R0MA 4FD0A 5EF1A 4GS7C 2XBDA 2JF1A 2HVBA 3LZRA 2EDBA 1TUPA 1A4KA 4JI8O 2WXQA 1ZOXA 2A9NL 4ZMVA 2UYLB 3I9GL 4NNPH 2EINC 2ZOWA 4RQQB 2XWTB 5KVEL 3IDIA 3RVWD 2I9LA 2Z4QB 4Q7DA 2ZONA 5B8CC 1R3HA 2VH5H 32C2B 4FXKA 4J6RL 3MUGA 1VKXA 1QEXA 3D30A 3C8DA 1JVOA 3QHZL 2WTPA 4KOCA 4GIAA 2EIJC 1V7NL 4JI6B 1D5MA 2NUTB 4LASH 4R9HA 2FLBT 4H8QA 4WUKL 5JMRA 5JOPE 5LMNB 1P49A 4XPHH 3IMWA 3BMVA 4XN8A 5DDHB 5LGUA 1NIBA 1NJ9B 2E8YA 2Z0UA 4PV1C 5DUMH 4UXNA 3C2SA 4LLMA 4WK0B 3V4VA 2ZXWB 1LEKB 4QHMA 3DK2A 3E6HA 2NY0B 1EZUA 1E4JA 4N2FA 2HG5A 5K39B 1G9ML 4XVOA 5JHLL 3KLDA 4XWOC 1I3GL 2WNKA 5C6TL 5JNYA 1U8LB 1NAKH 4MMXC 5LXTA 4LPVA 3H1IH 4DP1X 1M42A 4EQ2A 1FXHA 1UA3A 1TTUA 3NXSA 1MSPA 1SRDA 1H3XA 5AG8A 2F15A 4L0ZA 4J8RB 5L6YH 1I3VA 4IBSA 1GYWA 1YEWA 1TJHL 1WFOA 4U3XA 2WVVB 3RIFF 2FGWH 5CBHA 1NKRA 4AE0A 4DCQA 3QCTH 3SCMC 3TFKD 3K0GA 4JB9L 2VDRH 3LZFH 1SLWA 4PBDA 3DXRA 5JA8B 3ZIAG 2C7UB 2XXGA 3S8GB 4MD5B 2BVPB 4ZUVA 3C5SB 3QRBA 3PDDA 4OIAA 1CMOA 1LQBC 4UQEA 1NBVH 1LQSR 1Z5LB 2P7TC 4R0LC 4BFFA 1SVZA 2ZXEB 1Q0EA 4HGWA 5H4ZA 2Z65C 4WTZA 3RX7A 1E4KA 3AWFA 2DPKA 3ARZA 3ZE2E 5CN1A 4N8VA 5C8JA 4WFBV 3CFCH 1MFEH 2B1GA 4ZXBC 4DGIH 4HXBH 2CJTA 1K4DB 5A6LA 5HSFA 1YNLH 4PJDE 2V5YA 2VR6A 2VZOA 1DVZA 5EFIA 3R66A 4EZJA 1DBAH 4IBVA 1JPFB 2XVLA 5CU5A 4HGMA 1ZT1A 5TGBB 3HZKB 4G59C 3QO0A 2G0LA 3I6KB 2KKWA 4JFOB 3FHQA 3QDMD 5ESVA 4XBGA 3DO7B 4AOFA 3G7TA 3T6QC 2AJZA 5F21B 4ZFOL 1DE4A 1PZSA 5CJQH 2EH8H 2DAVA 2GC7C 4ZQTA 4Y1SA 1QRNA 1A7PH 3FRUA 1JXGA 3FBQA 4HJTA 4TV9A 4Y5XB 1BQRA 4DVBA 4C4KO 2UX6A 3ECQA 4KFMA 5C9JB 3MV7A 4PWKA 4YSTA 2G2RB 4QE7A 1NMBL 3C6SB 1LE9A 1KYOK 2ITDB 2BTOA 3QZOA 4GG6B 2LO1A 2XN0A 1GM7A 5TE6L 4XBEL 1C5DA 4NYLB 4GSUA 4R3SA 2R39A 1FE8H 2J8UA 1NANI 3PWJB 4ETQA 4FNQA 5HHXL 1T1XA 2IG2H 4O4HA 1R6KA 3IJEA 5ILTH 1Z32X 1Q9OB 2LHAA 4LPCA 3B4NA 4HCFA 3UGXA 4PJBA 2EVFA 4ELMA 1N2RA 4URTB 1IBKO 1KLFB 2B0SL 3AB0C 1OSZA 3B7SA 5C0AD 4IT5A 2QQLL 2VMFA 3LQAL 4UT7L 4DPRA 1B4RA 3IDIB 2BCCH 2B5IB 2IPTL 4PA9A 5HHMD 2MHAB 1IT9H 4G8GB 3ZL4L 5F3BA 2EVIA 3AGVA 4XE0A 3A2FA 4LPUA 3OX8B 1NCWH 3GXMA 2VDPL 4AUYA 4A39A 3UMTA 1UZ8B 1E9OB 3EGDA 4FXGC 3NIGB 2GUOA 5CMUA 1VACB 4LMQI 1E28B 3C12A 3WGUB 4UOW0 3RDTA 5JR1L 4HS6B 1KOAA 3JALB 1ZT7B 4I77L 1P9MA 4LIQH 3U0PA 1SMOA 5IG7A 3SKMB 5GZNC 1I1FB 1SEQL 2HFTA 4EJ1C 3UCSC 1FL6A 1MCCA 3EJTA 3EW3B 5FFGA 1Q0XL 3K81A 1XIWC 3MV8B 3W7UA 1LUWA 3D52A 5F2FA 4H2CA 4ZW3A 1R5WA 4AH2A 1HWWA 4X6FB 1NEZA 4PVBA 2Y2WA 1I75A 3WKYA 2APXA 3JWDC 4JQVA 2ADPA 1N6QL 4DP9X 5EUKA 4Y19D 2J25A 3AS2A 4DCQB 2Y5QA 3SPVA 1QWNA 4Q9QL 4JQXA 1MW3A 1XGYL 2KI6A 1YYML 4LFHG 1JHKH 4L9DA 4RIRA 4HC1A 1DO6A 3BW9B 3W2DL 3O41A 3QQDA 3QQ3A 3T2LA 1URIA 3X3FH 3H54A 3HB3C 2X4TB 3RX5A 2AKRA 1ILUA 2FSEB 2JIXB 2R56L 5DHVH 3FTSA 1KXTB 2OULB 4XPGL 5D6CA 1QBLL 4P5KA 4PJIA 1PP9H 3GSQA 2LU3A 1RSOB 3LEYL 3MYZA 3V6BR 4QI3A 1DEDA 1RJLB 3DSNB 3BAEL 1HJCA 1KYDA 4HZAA 2YAHA 4TULL 1CL7L 2FB4H 2JVDA 4H13C 2PYFB 3VQVA 5CWSA 3WU1A 4F37F 3QIUB 3JAWA 3RWIA 1QVGU 4IQHA 5E99L 2F54E 1NCAH 1SY6L 5D1ZB 4YSOA 2DW4A 4AVIA 1BYOA 3QZWA 4G7YH 5LMNO 4MVMA 5ESVB 4XBGB 4F7EA 2AJZB 3DO3A 2FDBP 1XSIA 2UXDB 3RP1A 2BW5A 2R7EA 1EJOL 2IF7A 3P0VH 3M8AA 1QRNB 4DESA 2DY2A 5T1JA 4Y4KC 1A66A 4DVBB 2ZE5A 2PI4A 3OZLA 3MV7B 4Q0XL 4IU3B 2R9IA 5BV7B 1N59B 5EU7E 4Y1TA 3RVZA 1DQTA 2R59A 1LE9B 2V9QA 4O2FB 4OQTA 3P4NA 4RAHA 1C5DB 1U8OB 4EXPX 4UFZA 4R3SB 3FF7A 4WFFA 4IYKA 1DVFB 3MLSH 4NTYA 3UOAB 4F4LA 3RPBA 4MJIB 2FNWA 1A25A 3IJEB 3KJ6H 3VA6A 1KELH 3GVMA 5EYPA 3KPPB 1EANA 3ROLA 3O0RH 1FNGB 1GN6A 2YICA 1KENH 2BHYA 4QXUH 1L0QA 4JZNB 2DBLH 2FIRT 3SDYH 4ELMB 1N2RB 2X6VA 1X9QA 1RIUH 3G6AA 2PXYC 4I3SH 4R7VA 5GRYA 5IQ9A 4UQIM 1XCTB 3FCUB 4GO9A 2D3NA 3L2MA 4KMTH 1NDMA 1Z0NA 5F3BB 4GRLB 4KKNA 1WZ1H 2B3RA 1OF2A 1T03L 3STLC 4HV8A 3B2VL 5E24E 3ARQA 2Z0AA 5B38A 2OCCB 1FAFA 3RTQC 4AQ8C 3MJ7B 4Z7VA 4HA1A 3FB6C 5TE7L 3SOTA 4ZMLA 5FWRA 2VQFB 1D5ZB 1ZA6A 1CD8A 3NTCH 2QKIC 4FEMA 2AJXH 2MH4A 4N3TA 1F2XK 4K9EH 4L8SC 3FULA 3HHMA 4Z7WF 1GJIA 3STZA 3U0PB 5IG7B 1MHCA 4ZAKC 1GK9A 4IEFA 1TYEB 4XN7A 5FDWA 4FFZH 1PZ3A 2FATH 2VMDA 1H8OA 1P4BL 1UACL 3PWNB 5LXGL 1OEZW 3BAIA 4PWFA 3ULUD 3VFGL 4U6XB 4WWKB 3KJ4B 5IJBC 1QFHA 2IDTA 4XMUA 2A6JB 3PUCA 3EHBC 3VXOB 1DQDL 1I4FA 1CN4A 2EDQA 4LLQA 1WFUA 1SXCA 1G6RL 3Q2CA 1NEZB 3SKOA 4LMQE 3K8MA 4QEGA 4GW1A 1GA2A 4OT1L 2CBPA 2LFSA 1WT5A 1WVZA 4DEPC 5T3XH 3MLUH 4JRYD 1Q72H 1QFWM 2P90A 1X7QA 1ZANL 2EACA 3FUFA 2OZ4A 3RJDA 5FB8A 2RFXB 3HLAA 1BMZA 3P9MA 4MJHA 1GAFH 5C8YA 3FUEA 4N2OA 1KT2B 3CHRA 1XF5B 3L95B 1TVKA 1SQVH 2OIGA 5AG2A 1KB9J 1OKEA 2FX8L 4TUYB 5DFVD 1EH9A 3FONB 3G6DL 4JKMA 1UD8A 4OCWL 3ASOB 1GYAA 2WUCH 1JNHA 5DJAB 1UG9A 2QTVA 1PYWA 2YGNA 1N9PA 5CINH 1XV8A 4G8FB 2O61A 1WK0A 3AC0A 1OHZA 5E51A 1B0GB 3RJOA 4LF5B 4LLUA 5I0XA 2BNUA 2FHCA 4A7QA 4WO4C 5CHNB 2ZE6A 3S98A 1M71B 4GAGH 3IDUA 4PJIB 4YNYB 1RD6A 2OA9A 3GSQB 3UGEA 2QGNA 4Y9BA 1NBYA 2HFGL 4X6BB 2BXZA 2DQMA 2OYLA 1NUNB 1JX9A 3GIVA 2AI0H 4S11A 4JDTH 1SYVA 3L1GA 2DQGH 3PRZA 4WUUE 4Y9CA 5HHOD 3JAWB 2RBLA 4XNZB 4ATWA 1MWAA 1S7VA 3O3AA 3U2SB 4FLRA 1MRFL 2YEVA 1NFAA 4ETYA 3Q0HA 4F7EB 3TNMA 1JZ6A 2ZOUA 2UUAB 1YHQV 4N28A 1QLFB 4PJXE 4WU5B 3TGXA 4YVUA 5D4JA 2R7EB 2XVBA 2AZ0A 1CB4A 1BV8A 1IGTB 1IDSA 1DQKA 1K5WA 3MCYA 4GX5A 2GITA 1S3RA 3MQIA 4Z7IA 5T1LA 5E08H 3C3SA 4LL4A 3FFOA 1LO5B 2OMNA 4JFXB 3TO4D 5L4JA 3PL6C 4HH9A 4WHTA 5FDYA 3UBHA 3HFMH 4OM0L 4E9SA 2QPEB 5JHDD 2ZXBA 1XO8A 2NNAA 1L9QA 4LEEA 1MREL 3RFZC 2OMVA 3LKRA 1HHJB 3CCQV 2WTRB 2IH8A 1CR9L 2E7MA 4H1LB 2AXFB 3RAJH 5EYPB 4NKIH 1R19A 3ROLB 5IESL 1T7YA 3VXSA 4XCEA 2NDFA 3FQNA 4WW1B 1SQBH 1VADA 2CH8A 4FXLA 4G43B 4EUPA 1W0VA 4HX1A 5ICYA 1CTOA 2HT4C 3RIFK 3EBIA 4PMEA 3B83A 2ZF8A 4H8VA 3QIWC 4W9EC 4XPBH 4MRCA 5DWUH 1MFVA 4JFDD 4NZJA 3TN0D 4LT7A 4HV8B 4JFFE 2R51A 4ZQKB 4MNGE 3SQBA 1KJ2A 3ZRCC 4AW4A 3QDGB 4NI3A 4ZX3A 3TC9A 4WJ5B 1HNGA 4ZZFA 2DTSA 4HEMA 3BI9X 3A6OA 1A6TB 3FCTA 4F7CA 2IMMA 3EH5B 2ZYSA 3OZ9L 1DN0A 2WUBH 3BPLB 4WIQA 4Q9RL 3TWCH 1NAMA 2DKSA 4ZPTA 5AENA 2OMYB 1JZGA 1YN6A 2PLTA 3MRGA 4E9QA 5HI4D 1TQVA 2CDEA 4UU9A 5DO2C 1A6ZB 5CILL 2NX5D 2UXDO 4AUUA 4F7KA 2W0FB 1IUZA 1DJHA 1A9VA 2CPCA 1I4FB 1F42A 3CMOL 3MOBH 3OPZL 3OJMB 3SKOB 2F5AH 2O26U 4PY7A 2BSRB 2CR3A 4U3JB 1CDIA 1I7RA 2XLLA 1XBRA 1XWVA 1T2QH 3J27A 2V7NB 2GSIA 3P3TA 2NNUA 3VXQB 1X7QB 4NFBA 3UC0H 1BFVH 2R4RH 1YTFD 4DN3H 3UTPD 3ETQA 2A9CA 1KN4L 1XCQA 1FYTE 5CCHE 1XGQB 1L9PA 3QJTB 4QTIL 5DEJA 5CZRA 4WBNA 4ALAC 2GSMB 1XBDA 1BIIA 2ADIA 4TUUA 1JNHB 4TQHA 1R24B 1PYWB 3GMMA 5FKAA 5TPWH 2O61B 2EE9A 1Q86W 2GBUA 4B95C 3N0PB 4QRPD 1BQKA 4PP1D 4ZMNA 1NGQH 3AGWA 1JFFA 3DTUB 3QDMB 4CBZA 4Y5YA 2LLNA 3MROB 1XF4A 1XMWA 1PZDA 1RIVL 1IKOP 3BQUB 3MI6A 5EDXA 1HZHL 1NOAA 1BREA 1NTKH 1PQZA 4LBEB 2ZCEA 1UKQA 3S3WA 2ATKC 3PQYA 3OGCA 5IVZB 1ZMYA 3BWAA 4H1LG 2VDLB 5HYFA 3FQXB 3QUXB 4YBLB 1I1YA 4MTFA 1FO0L 3ML8A 2JWYA 3QEGL 1DVTA 2F1BA 4BQ9A 1OHHG 4UBDD 4TPRH 4PJAB 2GTWA 3TA4D 1CI3M 2OIEA 5D7JD 5T5NF 1KLGB 1U3HC 1S7VB 3JUYA 3O3AB 1F6AA 2JVUA 3TT1L 1RLBA 2YEVB 3LD8B 1I8AA 3GJEA 2Q86B 4AGLA 1T0PB 4P48A 2YXYA 5KYWA 3T2MA 4NUJA 3SPHA 3E9TA 4ORGB 4ONFL 3VRLF 4PRPA 2L4OA 3V4PL 1DZBA 5KHGA 1P7KA 5JPMB 2XDHA 4IKKA 4XDJA 2J5WA 4GAFB 4C59B 3RWEA 3AXLA 4A6YA 4UCUA 5C0AB 3UYRL 4HBQA 4ZMYA 2QPUA 1EZVY 3PJSA 5F6IC 3D85D 4TQEL 4B3TB 4R97B 4N68A 1YO4A 5K9OA 7FABL 2F93B 4LHQB 3LPWA 1KD1W 1TQBB 3QR2A 2WKLA 4F8TA 2WXLA 3QXTA 3O9OA 4GKOA 3RVUD 4HWZB 4XCEB 2P26A 1KUMA 3FQNB 4JY4A 4LPWA 1KMGA 2ZCLH 2CJUH 2ZNWA 1MLCB 3HC4L 4EUPB 1W0VB 4HX1B 3U30B 4OU3A 4XMWA 3E22A 3ARBC 2OTJV 1IVSA 3APNA 5F1KC 2E9GA 5CFAA 4HZ3A 2HLDG 4LF5O 2N7AA 2WGXA 4J27A 2PCXA 4Q6IB 3SIKA 4PJ9C 5IB3A 4JE0A 1KCUH 4FG6C 5FYLL 3IU3B 1BPVA 3BQVA 5EIIA 3GZOA 1V3JA 1QSED 1ZVSA 4Z3IA 1IC0A 3QDJD 4H26A 3GNMH 3N1GC 4F7CB 4IRJD 1T0MA 5I82A 2PCFB 1Q4NX 5IUCA 2ZAGA 5D1ZI 1VMGA 1NAMB 1ORQA 5FUOH 4EBQL 4Y19B 1D5XA 3BLKA 5DQDH 1YN6B 2E76B 2WCPA 3Q3GA 4B97A 3A4EA 2CDEB 1AG0A 4LFBB 2UUAO 3KGTA 3IAQA 5FPOA 3C6LA 3KYNB 3LRSA 4F37K 4EDXB 3CZSA 1GW6A 1HNFA 1WE5A 4W9CC 4TLKA 1H3UA 5E8PA 5SWQA 5I28A 1SHWA 1B6DA 4K94H 2PYJA 4PY7B 5J6SA 2L6LA 2Z3FA 3L2NA 5FXCH 3IMSA 4UV7L 1FNSL 5GONB 1I7RB 4NI6A 4NKOA 3CDYA 1LO4L 3OD4A 5MEOB 1RUKH 3WNPA 2Q7AA 1WFMA 2YD9A 2ZX8A 5I6NA 4UUJC 4ZNEA 4LDEB 3D36A 3Q6FA 4N0FA 1XCQB 3DX8B 5C6PB 1TITA 1KXVC 4PRHD 5JDSB 2Y4SA 1UCBH 4LSSH 5I1LB 3UO3A 4PJGF 3F7QA 4YSSA 1VZIA 2G3NA 2BSTB 4PRNB 2IFFL 3FUMA 4A38A 4CSZA 1MELA 5HD8C 1F58H 1JFFB 2Q7YA 3QEQD 4KTEL 4OLXL 4GG6E 4DV0B 4Y5YB 1T0NA 2FWOA 1XF4B 4J3OH 4MJ6B 2B14A 4JLRA 4JGSA 4POZC 1U4EA 1MVYA 4AL8L 3MACH 5IBTH 5D2NC 1CLVA 3HKFA 3BP5A 5IQNA 3NZUA 1AAJA 5HYQB 1X5HA 2E5EA 3US0A 4BAYA 3IDXL 3LZOA 3OGCB 3JT0A 5AZUA 1OW0A 1I1YB 2V5MA 3U9UB 2D03L 1ZTEA 4IDLA 4Z18A 4UINH 2ITCB 2YN5A 2IH9A 1TJIL 4OUOA 3GM8A 5C0JA 2HX8A 3K72A 5IQMA 1U8JA 5DO8A 4CU8A 2BTQA 1GC1C 2XACC 4G8GE 2VWJA 2AERT 2LR4A 1FNFA 5D2LB 3ATDA 4K5LA 4TQ8A 1S9XA 4ZOBA 1NCCH 2AGJL 3CD4A 2A73B 1YNTF 4R50A 1DJGA 1KULA 1P7KB 3MBED 3CVHB 3NIGE 4AY0A 2VT0A 3U1SL 1RP3B 2R0LL 4J28A 2VITA 4KOBA 4A6YB 2BY2A 4ZO8A 1SDDA 2QKAA 1O9HA 3D34A 3PJSB 2CNZA 3VWJD 4FLYA 3ARVA 1FPTH 3GUTA 4BZ1L 1YUKB 4X80L 5D7LD 3ZDYF 1MFAL 1MXDA 1EZLA 4JFDA 4BCYA 4V11A 3TN0A 1VSCA 2F5BL 1X5JA 4OF3A 1TU2B 1MCHA 5CP7B 3AAZB 1HINL 3LKSB 3BAKA 4LSUH 3ZT6A 3KDMB 3MV8E 4M7ZC 3WMSA 5D1XD 1EAPA 2ZOLA 3MU3A 2CIKA 2EYSA 5F88B 3LEVL 5FM5M 5I8KL 3T0WA 4QHKI 2NCEA 3WN5C 3UAJD 5JHAA 3SYAA 5IB3B 3G9VA 5BVPL 2XN2A 5CBFA 2APFA 4WENB 4Z7AA 3AG2C 3RVXD 3HLKA 1ZVSB 3DK0A 4JRLA 3FB8A 3UIYA 4KXRA 3LH2H 3N41F 1S7XA 1ZHBA 3ABKB 1QKZH 4M8UA 4YH6A 1AH1A 4A7GF 2V3EA 5FCUH 1ORQB 3PHQB 4JRYB 3VXMD 4OCXH 1UB6B 1F4XL 2DQUH 4B0MB 1X5GA 2Y0IA 4QRQA 4XN5A 2VOTA 3AU1A 3FMGH 3VXRB 4F9PC 4HMCA 3KNBA 3HNVL 1X6LA 1K9MW 1NC2A 5E8PB 4GKLA 1NQTA 4ODBD 4WZ9A 3VGEA 3QFDB 4HK0A 3O6FC 4QWWC 3MRJA 1D3CA 4I0PC 4QRPA 3M17A 5IB1A 3TP4A 2EIDA 3B9EA 1MJJB 3D0VB 1ZHKA 2F7IA 3ARFD 4GXUN 4IJ3B 2DQCL 3ENEA 1F11B 4UVBA 3Q6FB 4N0FB 3LS4H 3OD3A 4B3TO 2K9UA 2D8KA 1XF2B 2VLLA 1MJ7H 1QRNE 5DT1L 4ODVL 4JM0A 5CN3A 4B9JA 3MV7E 5HHOB 4ZFFA 3FD9A 4TWKA 4AYID 2ILLA 2QQKL 2QADD 1OCCB 5FNVA 1T0NB 2CBQA 2FWOB 1VEMA 3I50L 1X5XA 3ZIYA 1TZ8A 1IKFH 2G75B 3NJLA 4JLRB 5HYJD 4MXQC 3FU6A 5A16A 3UZQA 2H7WA 1RZKH 4MJIE 5DTFA 2CLRA 4PDRA 4DN4L 1WGOA 1ZGLP 2FX9L 3C5XA 5F7KC 2NYYD 3KL5A 5DMIL 5HPMB 3QPQC 3TO4B 4ELME 1KMIZ 4WSGA 4XPFL 5HHNA 4F7PB 4C83A 5CJXA 3CMEV 1QP1A 3BGAA 2EBOA 4N21A 2FX7L 4HUMB 4KZDL 2WGNB 3EKCA 4JTCB 1J18A 3GJFH 1UZGA 3K72B 3ABMC 5JHDB 1KGUA 4HFWA 5T5FA 2ZT9B 5B22A 4ONHB 3VFPA 3G5VB 2P4VA 1S9XB 3L5WB 1JERA 1IBFA 2EDKA 4LFBO 2D4FA 1FBIH 4OFQA 5JUEL 4NRYA 5L3DA 2LTQC 3BEVA 3BX7C 3KMDA 3MBXH 1RURL 3AUWB 4HXAL 4AIEA 1P5UC 4YHKH 1GGTA 4FQJH 2QJ1A 1WWCA 2VLKD 2XFXA 2B59A 1SDDB 2ZUXA 5IK3A 5TE6H 1RCYA 3LV3B 2Y2TA 5EBWC 4BWUA 2R29H 2YKLL 4PB0H 3GUTB 2TRYA 5DGRA 1DBML 2Y7QB 3EH2A 1J9SA 4N2GA 4XPAH 4TVPH 4JFDB 5HY9A 3ZHTA 1CWVA 3LNNA 3TN0B 1YQVL 2X4PB 3HKCB 3S35L 2E27L 4BFNA 1R3IH 2MFNA 3TONA 1P84K 2ARHA 4N8UA 2AEPL 1QSEA 3UJIH 5BMFL 2YDEA 2H2SC 2R23A 5DS1A 3WELA 5KANI 1IAIH 4ZBMA 2ZOLB 1X9RA 3LQAH 4FQQA 4XI5C 2ERJC 3HKDA 3HUJA 2Y9RT 3GSNA 3PXLA 3K8LA 1UD5A 1T6BX 4XNQA 5HDWA 4XP9L 4AM0B 4DV0O 1FXKC 3G5XA 1H3GA 3V5DA 4M4RB 2NX5B 2VIRA 4TQPA 4NGHL 1FGVL 5IY5B 2YQGA 3CBJB 5DQ9B 3KL3A 3T2OA 1S5JA 5J1AB 5DEFA 3T1FA 5CIPB 2WLNA 3WY1A 2WA4A 1BZKA 1JYNA 5CB4A 1KF9B 1EFRG 4LKCA 1S7XB 4JPVL 2NQDA 4HJJL 4L4JA 4JG1H 5BXFA 1VP7A 1VF6C 2EH7L 4OJAA 1SA0A 5C2BH 4ZHQB 2EABA 5IMMB 1YTFB 1PTZA 4WFEE 2EEAA 3AU1B 1AR1C 1EIBA 4PJIE 3JAKA 1MVUB 2UWEA 5HDOA 4LFCB 2UY6B 4JJ5B 4RAUA 5GSVB 5TTRA 4S0HA 5IBLC 3O9WD 1KCSH 4OD1L 4XXCA 3I2CL 2JQZA 1G1XB 1N68A 4GEJA 4K3JL 4N9OB 1RJZA 4H8WC 4HK0B 2OR8A 4FVMA 4D7PA 4Q20A 3MRQA 3RZCA 4QRPB 3M17B 1K5SA 1RP9A 4FQ2L 3IDJA 2MCPL 1C9SA 3QEQA 4XH2A 4ZUUA 5CD3A 5EBMC 2G3XA 4HJ0D 1HT6A 4DO2A 5A6IA 4P4RA 5I23A 1IVTA 1E4XI 1P4LB 3MMEA 2AEQL 4ICXA 1J0KA 4NN7B 3QHFL 4B5EA 2H0PA 3QRGH 4IYIA 3ARDC 4HUVA 2BMKA 2XQYG 2QZQA 4ZFFB 4JKKA 4DKEH 2BE3A 2CXGA 5D7JB 2BO0A 2DWYA 4X2UA 3TK1A 2VC2B 3HEIB 4IBZA 5T33H 1RM1B 3MZGB 4NQXB 1MDAA 1MZZA 2GJRA 2RIKA 3QO1A 4GUQA 1H3VA 1I08A 43C9A 2DQTL 3ZHVA 1A7QH 3LHPH 3F7YC 3UZQB 4A37A 4XNYH 1FKAO 2B1IA 1CGVA 4AYGA 3KPTA 5EU7C 2NLJC 5BW7C 1NGYB 4D8OA 3AFLA 3IBOA 5E99H 3OFNG 3LKNB 4XVUD 3M7MX 3Q05A 2UXFA 3NZ8A 1UXMA 5HDBB 4JRWA 5L2JA 3ISYA 2CDGB 2H3NB 4IK6A 4R7LA 1G1YA 3GM0A 4HFWB 4W4NA 4U2ZA 5C0NC 3D85B 4KVNH 4LCWA 1L3WA 3BN9C 3HG4A 4QXVA 4Y89A 5D7LA 5JW4N 4BH8A 3ILQD 1J5IA 1U3ZA 1EZVX 3QJHB 3IMTA 4MNHA 4WTWA 2AXHA 3VI4B 5GJSL 3ULSA 1NOFA 2BOBA 5ADPH 3BSZL 1QUPA 2HVKA 1E9PB 3QDGE 5AVUB 3BEVB 1T5EA 2QSAA 4PLJD 4HH8A 4CGTA 6FABH 2PI5A 2X7LA 2YXLA 3ZS8C 3QAZC 3WHE1 2AHIA 2FT8A 4J3OG 3NT0A 4ODHL 3DX1A 3WL9A 1AROP 1G9HA 1JZ5A 5LN8A 1XILA 1BGXL 3NH7L 4XCCL 3UAJA 4NJAL 1S77D 3CLEL 3D18A 2A99A 5E6IC 3B9KD 4HWBH 1K8AW 4IM8A 4S1DD 4K3GA 1FRGL 1B6QA 4JRFA 5AB1A 1QSEB 3MCLL 1KB5A 4B6ZA 3QDJB 5AD0A 1N33O 4IRJB 5EEXA 1UH2A 2ZUTA 4FQQB 2VS0A 3HKDB 1G1OA 3GSNB 4ZTOH 2DQIL 2PPDA 5EWIH 4EN3D 2YIBA 1ZHLA 2VDKL 1V55B 5EOCH 1JNNH 1HHHA 1WWAX 3I74A 4FNUA 3ZX1A 1G0DA 2YHGA 4N2CA 3ELQA 2HCZX 3IMUA 3CFDA 5TE4H 2OP4L 1CGSL 4RGNB 2G4GA 3ULVD 3ULAB 2VIRB 4XMPL 2JJTC 3DMMD 3X14A 1FNHA 1IGJA 2OJEA 4FFYA 1HX0A 2EYTA 5DEFB 3A0RA 1JPTH 1EFXD 2WAMA 5CB4B 2IC2A 2XG4A 1G7MA 3ESUF 5IKCA 2GJPA 3GGWA 1DQQB 4NM8L 1S7SA 3NJXA 4G1EB 3IEAA 4DZ8A 1R3KA 2YA2A 5DRWB 4JFQB 3T4DA 1JPSH 3PE9A 1Z3GL 3QDME 3NCCB 4UT9A 3ARFA 1GGCH 3CUPA 4PV9A 5F89B 1EO8L 3F12A 1JZEA 3JAKB 2UY7A 3MRFA 4PRHB 2EIMB 2HKOA 1NIAA 2DQJH 2KBGA 3FS9A 4YC2B 2DIBA 1R3LC 2WM0A 2R69A 5D1QD 5IF0B 1DLFH 1AG6A 1WA8A 4R8CA 4BE6A 3PNWB 1LP9A 2WVTA 4UT6A 4PJAE 2EC9T 3N50A 3IDJB 3OVUB 4TNWF 4L8CB 1G84A 4MMZA 4FMTA 3ARYA 4XH2B 3FT2B 1LGVA 2WVSA 1MG1A 5C0BB 1E5ZA 1LO3L 5HYJA 2WQWA 1BEYL 4GAYA 2JGUA 1B88A 1JPGA 1S3KH 4NC0B 1PKXA 1H3WM 4OLZH 2FX8H 4CVWA 2C3GA 1ID2A 2DL2A 1SQMA 3MD0A 2OR9L 1Z1WA 5EC2B 4L3FA 1I8MA 1BAFH 5HHPA 2DLFH 3P30H 4QHKJ 5IB2A 5SWSD 3OKLA 5A3ID 3DI3B 4Q9CA 5IGXH 2NCMA 1KTJA 1IKNA 5C0AE 3WUZA 3DX2A 1A7NL 4Z1MG 2WCGA 5IBUG 5JIQA 2VISB 4LPYA 4IBQA 3SKUD 43C9B 2EP6A 4K35A 1HL5A 3JD4A 3RGVA 5ANHA 2C3VA 2KMWA 1AO7D 3CE1A 3NA4A 4OGYL 5C9KA 1HOCB 3MBEB 5E8OB 2HPOA 1YPZB 2NY7L 1URFA 1UWXK 1WSST 2DWEC 4ODUA 4OUUA 1Q1JL 3MUHL 3T2PA 2GAZB 2VLKA 1QFUL 1EGJA 4OF7A 1JR9A 1MSDA 3LOWA 2Q76A 3TCTA 3BT2L 3VWJB 5DD6B 1T83A 1MCRA 4W9FC 4BH8B 2PP8A 1T7XA 2H2PC 2NY5C 4BW5A 3QIBA 4X9IA 1BFSA 5IYBO 4GXVH 4MNHB 4GW4A 4XB8A 3UO1L 3X1FA 5JO5A 3RPIB 4PA6A 2CO4A 1U95A 3AS3A 1OXYA 3DX0A 3GO1L 4YDZA 4LFCO 4UV9A 4HUXA 4FI7A 4XODA 2V7HA 5D1XB 4P06A 5IEHA 4IMLA 4O02H 4I1PA 3VGBA 5K9QG 3ZSTA 5JXEA 3OXRA 3X2QC 1EVUA 4YXKL 4BWTA 4NBYB 4MDIB 1Z5VA 2CAZC 4Y19E 3D18B 3GSUA 2XTSA 3JWOH 4U7OA 1BJ1J 3EJCA 3HNSH 4BA8A 4XVSH 5CMAA 2D0FA 3O8XC 4YDMA 3SDDC 1UWFA 4Z7UF 3LB6C 2XWDA 5AD0B 2BSKA 5FOBA 2WVUA 4GI9A 4WI7A 4LDOB 4HUWA 3EGXA 2CDFA 4TRPH 3UCRA 1NGPL 2HLFC 4A5UB 5EO0B 2IFGA 2Z9TA 5ETUB 3LN5A 1FXVA 1ZHLB 3GDCA 3VXMB 1U8CA 1HHHB 4PJDF 1ZUQA 1Y0LA 2FD6H 4RWHA 3U83A 3WENA 5K69A 1DDHA 1T20B 2D7QA 3CFDB 1ZTXE 3G5YB 2COQA 2ZWYA 3PCYA 5DJCA 2FBJL 5KVFH 2G60L 3CU7A 3QUKA 3KWWB 2CIIA 1S0VA 1BD2D 3OTOB 1IGJB 2OJEB 3O9WA 3X14B 4ZTEA 5T3ZE 1YECH 1J9CT 5IKCB 3FB7A 2QDVA 1NFDA 4DKDC 3OZ9H 4P3CH 5D96C 1HSBB 1KTLB 1R3KB 5FV1L 4BQ6A 4L3CB 3ILPA 5I6XB 4O4JA 3IMVA 3ARFB 5IB5B 3ZYOA 2WNGA 4BQ8A 3TZVC 3DDGA 1DQVA 3MRFB 4ZD3L 4K8RC 2FE0A 3LRHA 1MIEL 4O4LB 1ZT4A 4N9GB 1MFNA 3TFBA 2Y1ZA 4M6NL 3QBTB 1OO2A 4FA6A 4XPTH 2N0KA 4OD2A 1UC6A 1JNLH 4OB5H 4A2DA 1ZLZA 1LP9B 5IOPB 3BY6A 2JXMA 2QADB 1UFUA 3THOA 1ZWIC 4MMZB 3RWRD 3K6SB 5D71H 2WSSG 5FYKL 5LCVA 4N1CA 3WXWL 2XX0A 2OL3A 2WINB 3NSDA 5DR5L 2VQ1A 4KXBA 3QO8A 1JPGB 2APSA 3CB2A 2FJFA 3VE0A 2A6KB 2J4WL 5D2LE 1C7TA 3RB7A 4JYYA 3IJHB 2BVTA 3WO4B 4L2LA 1R6TA 2MKWA 2YD1A 1V3MA 4BFGA 4ES8A 4PR5B 4RMTA 1ZLEA 4JO3L 3OKLB 4JHVA 3WNNA 2O5NA 4JFWA 1QCEA 2R2EA 3JWDL 4DUYO 3IFOB 1HEJC 1P2CA 3PLYA 3CNKA 3BHBB 1A6WL 1CT8B 1J10A 2IWEA 3DBXA 4X62B 4IIJB 4Q58C 5KSBA 3JTTB 2C3VB 1SN0A 5KAFZ 1NCBH 4K07A 4K0OA 4R96A 3VQ2C 1N12A 1NTZH 2V5RA 1IE4A 4ODUB 1KC5H 4JPSA 3TT1H 2ESVD 2BNRA 3Q2WA 4OGXH 5FKPB 4XP5L 2OMTB 4OCNC 1U58A 3VI3A 1H5BB 1GPOL 2ZXWC 1BAWA 3WEBA 2NY0C 5LXVA 1MFDH 1GS6X 4AVHA 4GW4B 4AYFA 1PPJH 3KXFB 4NRZB 2V2TA 4YIQA 4RWYL 1U95B 3BVDB 3ULUE 3QWOA 3UJJL 3PABB 1U30A 3FO1A 5TISZ 2IW5A 4HUXB 1FVCB 2V7HB 1X5LA 4AV0A 1H8NA 5IEHB 1GGUA 2MKLC 3DV4A 3CWGA 4ERSL 1MCJA 2UXXA 1T1YB 4AIOA 3VFNA 3EYOA 5GHWH 5LKNA 1VLXA 4FC3E 4JRYE 4L29B 5CZXC 2WSDA 3GSUB 1B2YA 2ZNIA 4ZTPL 1G6RB 2YLKA 2R1XA 3VXRE 4XP4L 1EHAA 1O6VA 5CMAB 2NTSP 4YHYB 3QQXA 5LBVA 1EFXA 3LNEA 1Z2KA 5FOBB 5IJCC 3W9EA 1Q9KB 4WNQA 3EGXB 2JLLA 5TQ0H 5I6OA 4E2LA 5KS9B 3WTUA 5C08D 1M7IA 4CSPA 1IBYA 2V17H 3DHJA 3P4OA 3BRGC 5DHEA 1NCTA 1IC5H 1SZTA 3EDKA 4UM8B 2OYKA 1K4DC 2P5ED 3ECUA 4UANA 5G55A 4E9YA 1MABG 2AMUA 3QUKB 5IROC 2CIIB 1NIFA 4TSBH 3V10A 1RZJC 1T7ZA 5J12B 1SETA 2H8PA 1VHPA 2AMGA 1LK3L 5I8OH 3EYSL 1U3NA 3FB7B 2YPVL 4Z5RA 5HHOE 3ATEA 1DQJA 1V8HA 1WBXA 4JL1A 3LDEA 2Z7UA 5EF0A 1ESOA 3G08A 3MRKA 4FQLH 3ZKNC 3TOPA 2OXGA 4NZTL 2OK0L 3WFBL 5I1DA 2D7TL 4DK0A 1CXHA 2V1DA 7PCYA 4JANA 5AVTB 4EI5A 1BXVA 3MXVH 2XZAL 4Y5XC 3DGEA 1ZT4B 2D9QB 1IFGA 5EIBD 1UXLA 4XP1H 3ZU8A 2IAND 4K7FA 3WBDA 5GXBB 2ITDC 4I2XA 4FLSA 4YFDB 2JXMB 3WU2Z 1V9PA 3HUJF 2JKXA 2XZCH 5GS0H 2HFEB 1AC0A 5CA0A 5EV7A 5JHDE 2QQNH 3NPSB 4X89A 5LWYL 1G7QB 3I55V 1JF1B 2DQEL 1AZCA 3VX1A 3VE0B 3LIZH 5F7LB 1KEML 4RRPM 2X05A 4L3AA 1OLZA 1AO7A 3B2UD 1YY9C 1CE6A 3LRMA 4U1JA 3AITA 3KR3H 3BP4B 1A02N 1QBML 4FPPA 4XBPB 3CXHJ 1AHWB 3WCYA 1SDAB 1BBJA 1JWSB 5AW7B 5CUSH 3QQ9C 2B5IC 2AV1A 1CQYA 4XNBA 5DZPA 5GRWA 4MTXA 3SZKC 5HYEA 1T04B 3K5RA 4UWQB 2NZ1A 3KPSD 3TV8A 2CO2A 4TSAH 3MLZL 3L4YA 4JFDE 1OK0A 5KSBB 4OZHA 2HRHA 3SPGA 2I5YH 3D3VD 4DF9A 1MKFA 4JY6B 3RUGB 1A2YB 3KW8A 3MHSC 2VR4A 2RN9A 3OTOO 3AK2A 2VM3A 1NUDA 1WO2A 3U46B 3FFCD 2Y1AA 1MHHB 4YHOL 1PY4A 3LNGA 4Y2DA 3OGOE 4HIEA 5BVJB 4UDTA 5EO1A 3LS5L 4QAWA 1UJ3A 4JFPA 3ZE0B 1J11A 3B9KB 1MPAH 4JPWL 1UENA 3P77A 1JGEB 1PKOA 3EDEA 1U93A 2NX5E 3PWLA 4MZ3A 3S36L 5FAAA 3LDBB 5F93C 3S4SB 2WLZA 4JYAB 4GG8B 4S0TD 3RKPA 4ABVA 1RU9H 5IQOA 3X13B 5ID0B 4AENB 3N2GA 5LYJA 1KIQA 1JTPA 3DUUA 4YDVA 5FW8A 5EZYB 4PY8J 5HJBA 4YXLL 3EYOB 1QFWH 4EN3B 2QVKA 1YEEH 4MCZB 4MHHG 4AQOA 2Q4PA 1LO0L 2BNQD 3HMXL 4NR1A 2WTOA 1Z9LA 3ELAT 5I0ZA 4NKMA 5FHAL 1IMHC 5B3JF 3UTPE 5T3XD 3ZTNL 5BZDA 2VO5A 4FAAB 1OIOA 4S1QL 3LQMA 3QQ4B 3DMMB 4NKGB 2X09A 5JIDA 1BD2A 3MLRL 1UM6H 3N6YA 1P4UA 2JELH 1YEFH 2W07B 4KMQA 3U9PL 4TNWK 4P07A 4WNQB 3BUQA 1UUNA 4LCIL 1WZAA 3UQ8A 4QRPE 3SGEH 2ZD9A 5KYUA 3VXNA 1NGZA 1DK1A 4RETB 1QA9B 1G94A 3II1A 5IT9N 3P4OB 4BZYA 3OPUA 5KW9H 4DFHA 4YGAB 1OAKL 4IU2B 3SJVE 1N0LB 3E2HB 4BA0A 2VUOA 1XF3B 5GGTL 3J7HA 3UYPA 4X62O 5EF3A 1MZEA 3GHEL 4H7VA 5D1QB 1AQKL 4GQQA 1W2KT 3QIUC 4Z5RB 4LPXA 1FJ1B 3FPYA 4PJXF 5D1ZC 2B7DT 5MEPA 3L3HB 1WBXB 2JTYA 4X8AA 5ADOH 4HK3J 3MRKB 2X87A 2A38A 2BVOA 3HAEH 2K7PA 1BJMA 2XIBA 4R26L 3WKPA 4JZOA 1PLGL 2IADA 2VXVH 1FO0B 4HIJB 4BFIB 1QLEH 2JNZA 4JANB 4KK8C 1CLZL 2VL5A 1BG1A 4Y4HD 4YIPA 2ISDA 3V0EA 1BSIA 1WHOA 5BV7C 3U79A 1JOIA 2CHZA 4GUNA 2XNAA 5CLXA 5FECB 4K7FB 4PJ7A 3FQ2A 5KVEE 1EHXA 4FLTA 1OARL 4OFYD 5SWSB 4HJIA 2R15A 4IOFC 5LGKA 1H0DA 1H19A 5I15L 4FA7B 1AI4A 3VD3A 4DQAA 5HDBE 3BC9A 4YUEL 1DJZA 3H2PA 3V4PB 4FNLL 3RI5F 1DVFC 1HI6B 4DK5A 4YN3A 2EDDA 5CEXA 5C0GA 3GXUB 1OB0A 5AZEL 2Q8AH 3VI4E 4ODVH 3SE4A 4GZRB 5C0CD 3A3YB 1S2EA 4H4NA 1VIBA 2XA8H 2MTAA 3G6BA 1BIHA 4P5TD 2XJKA 4XC1L 4HISA 2ADFL 2PWFA 1XH3A 3ZIMA 4L1HA 1AP6A 1BCIA 1NGXA 1GAXA 4GRLC 3IWUA 4G72B 2ZX9A 4HJGB 3VDBA 3M45A 1XNRB 4WU7B 3K2KA 3SBWA 3AQZA 3BUYA 3JV5A 2OCCC 1B4LA 2GSGB 3NCJL 3FT3B 3VXPB 2KLTA 1FFXA 4ALAL 1QSEE 1MNUL 1BCCH 4XB3A 4XXDA 3TCUA 3QDJE 3IFLL 3S37H 4RSYA 2WBJB 1RZFH 4WEMB 2QDOA 1PDKB 2CO6A 3VG0L 1P9MC 3FCBA 1ASOA 4HIEB 1BFOB 2QVFB 3DC5A 4NM4H 2AQTA 1CL7I 1OTUC 4XN4A 1UJ3B 1UH3A 3F5TA 3SGDI 1Y74B 1ZXQA 2BSDA 2VXQL 3ALWA 4NENB 4PRBB 3RJQB 4RGNE 4WWKC 3KJ4C 4PYHA 4K3DL 1UB5A 1E6JL 2UV3A 2B4CH 5IVXB 5BQ7B 3CCEV 5LYJB 2YC0A 1KIQB 3DUUB 3HG5A 4YDVB 1UHVA 3PAZA 2C9RA 3NAAH 2YKLH 3IGUA 1J0ZA 3JWNE 5C08A 2XWRA 1OK8A 2WO4A 2ATAA 4HAFA 5DHVA 3RBGA 4MX7B 1INDH 1M2OA 3FW6A 1U8PA 1YMHB 3ZN6A 1K4CA 2CHNA 1ZLVK 4PRHE 3DTXA 3ASOC 5IT2L 5ACLA 3VXTA 1A4BA 2EDJA 2N1TE 1XBLA 3H1LH 4AMKH 5GGSA 2W65B 4M5SA 5I2IB 1J12A 4BRVA 1ADWA 3L4TA 1CLYL 3QNZB 3DSFH 4NIKB 5KYUB 2WXIA 3RBZA 1KZQA 5GTHZ 3W56A 4AM0Q 4U3SA 3DTDA 3GIZL 4WFGA 2MTPA 3MRLA 5C0BE 1EFQA 4X8JA 5DEGA 2EZ0C 1AJ7L 1PY0A 4TUKH 3S0PA 1M3IA 3V0WH 5K1XA 1JXDA 3L81A 4W9KC 1A1OB 4OLUH 2IANA 1F4MA 2X53A 1M4UA 5CM1A 3BYTA 1JYXA 4XNZC 5FGSA 5LB1A 3T6ZA 4M8QA 1FH5L 2GBTA 3WB1A 1A8JH 2ZG3A 2WANA 5IQLA 2BVOB 3D09A 4KRNA 3QJXA 2IADB 4C4BA 5BRZD 5I18H 1J0YA 3CPLA 2VL5B 4OCSL 4AZ8A 2FYVA 1J8HA 1HXMB 4ACTA 4PJ7B 3EO0B 3QNXA 3S6CA 1YPZE 1EWHA 3GSOA 1FFRA 3F65A 2ZPKL 5DK2A 4JYAO 4M1GL 3RY5A 2QJDA 2GKIA 2CA3A 3OTFA 4YHPA 3RVWC 3D08A 4AWJC 3JVGC 3NCBB 4X8GA 1O0VA 3V9FA 1FL5B 3QS3A 4EDWL 4G3YH 5CEXB 3NBNA 1S9YB 2OSWA 2GTQA 3QHFH 3LNMB 2X0UA 3LXUX 3D3VA 1SZXA 4GY4A 1AKJB 4ONGL 3FZUD 5MP6H 4JDVA 2Q68A 1ITBB 3L1OH 1CD9B 1VF7A 4S10A 4HIPA 4KUZH 5D1XE 3ML0A 3JATA 2N7BA 5DYOB 4NHCL 4WNJA 2ESVB 3A5VA 5KAQG 2CJ3A 1SQXH 1NGXB 2VLMD 1T21B 2E75B 1FLTX 2DQTH 2EADA 1PZ5B 2VRAA 4MJ4A 5I1KL 2J44A 3VYNA 4NRXB 2X70A 1FORL 4KZ0A 4X6CE 3SKNA 2YQBA 4OIIH 4DERA 1K72A 1IARB 2J21A 2JK5A 5TJWK 2K8MA 4FFZA 4N0CD 5I71B 3D07A 1CICA 1J87A 4UQ2B 1INEH 3RHWF 4XXDB 1BQLH 1DO5A 2GBVA 2R2BA 3WMQA 4CMMB 2CO6B 4CVXA 4DWHA 3BPLC 3VD0A 3CXCU 4FFKA 3GI8H 4NO5A 1MDTA 3FSWA 1D9KD 4NUPA 3K71A 4QMEA 2BNQA 5ISZA 3VXME 3FOLA 4HHAA 1W0WB 2ZM6O 3TFKC 4J12A 1QLNA 2BZCA 1MF2L 2W0FC 1Y1DA 4NWTL 1M6UA 1UB5B 3UTTA 2ODIA 1CS6A 5LBSH 1SPDA 4FA8A 5DD0H 4Y7OC 3D2TA 3VO0A 12E8L 5KJ4A 1WT5C 1JJ2U 1M1XB 4NAJA 1G7LB 3DECA 1K8IB 1A7OL 4M43L 5C08B 4X9QA 1Y76A 3JD1A 1VGEH 3DETD 3MRCA 1GXEA 4NXMO 2ED8A 4NAMA 1OAQL 3BDYL 2KHAA 4EKXA 4DR7B 4JVUA 2D3VA 4AIZA 5TQ2L 1NSNL 1CVRA 1XHXA 1IQWL 2DWDA 2LVCA 2P5EB 1R47A 1K4CB 4G9FA 5AKTA 2ZR2A 2ED7A 3GS7A 4BXSV 1Z9SA 4QTHB 3DTXB 4NJ9H 4I4WB 1HHIA 1D6EA 3QPXL 4HWEH 3Q9QA 4GG6F 1QRKA 3CDFA 4I5SA 3K4AA 1ADQL 1G5AA 1YEIH 3NSJA 2XCMC 5GGSB 3VMNA 3SDXA 2DQIH 1LP9E 4F15B 1JD7A 4M5YL 5MERA 3OR6A 2WMPA 1NS1A 3HR6A 43CAA 2ZUQB 1SMAA 5E2WL 4P2CG 5DEGB 2GABA 4LBEC 5A7BA 1A6UH 4Y4HA 3B1TA 3N9GH 5K93A 2X4SB 3QUXC 4YBLC 5CSGA 4D9RD 1AHMA 1WAAE 3VG9B 2HHHB 4J9ZB 5IYDO 4X4XA 1L7TH 2GI7A 2GUYA 4OFYA 4Z0XA 4OJEH 2VDMH 3QG5A 3N1QC 5KBLA 3LD8C 3DPBB 2UU9B 4X20B 1W91A 1ZA3A 4G5ZL 1VGKA 4HIHA 3GPSA 2DJVA 1EO8H 4Q8BA 4BK8A 4DVRH 3UGUA 4HIIB 5IJKA 3MRPA 4XZ4A 3VMOA 3NIGF 4KZEL 1B0IA 2FCBA 2XUWA 1LJMA 3H0TA 2W94A 1UA7A 3FRPG 3T4AA 2YEZA 3QWRD 5KSAD 1HQ4B 5DZLA 3GKWH 1OM9A 4FHKA 2F0CA 5C0CA 5JPMC 3D06A 1NCHA 2BVEA 2YWZA 5DK2B 4E68A 2XT1B 2D3JA 2OCJA 3CN4A 3QXUA 4IGBD 4AZUA 2TSAA 1GN3A 4FQXA 4PJFF 3ZMNA 1HILB 3OQ3B 2K6ZA 2N59A 1I1RA 3QCUH 4LEBA 3V0DA 4R97C 4L3ED 3RW0A 3EZJB 4HD5A 4Z7OB 2UXCB 5B21A 3KPSB 3DURB 3PWPD 4DKTA 1TQBC 4OZGA 4JFHD 2K6WA 2FO4B 3VJ6B 3H4FA 3IETA 3OM3B 3D3VB 3KXFE 4QDGA 2Q8BL 1ZEAL 5A2LH 1QQCA 1MCOH 1HDJA 1YDPA 2ZKHH 3U30C 2E3VA 2D7OA 2Z7WA 2J73A 5DMGC 5JH7A 3FFCB 5GGVH 5IHZA 5LG1A 2C1OB 1ZLDA 3HAEG 3CX5J 4LSTH 3WD5H 3M88A 4QJ3B 3VH8B 2AXWA 4BFBD 4ZMXA 5CLWA 5IHBA 5LHHA 1RUML 1FN4B 2FYUH 2J88H 4FZ8H 5IM7A 3UBXG 4ZIBA 4X64B 4Q6IC 4R4ND 1K3ZA 3W82A 4FZEL 1KPVA 2ALWA 4W9HC 1OP3K 3SKNB 4X9BA 4X1YA 3VSTA 4YHML 1BXAA 3L17A 5DZOA 1TZHA 1KTDA 3IFPA 2NXZB 2Z31D 1AGBA 4CVXB 3K5NA 2XG5B 3GLEA 2CR0A 3GEWB 5KS9E 2ZJSL 2E76C 3CLWA 4HHAB 4OAWB 1BZQK 3P3SA 3D9AH 2F8IA 3GPEA 1LEIA 1BLNA 5KVGL 3T3PB 3CFEA 3O2VH 4GT1A 1E3FA 3V5HB 2OMXA 5F9AC 1D5NA 3CZNA 1A64A 4YXHH 5KMGA 4H44B 4MNQD 3A0BZ 3HG1B 2WYZA 5E8DL 1TQSA 1UFIA 3P3PA 4MJ5B 5C07A 2PETA 2YMXL 3VM5A 1MN4A 3JUZA 1Y76B 1MCBA 4ODXA 5CEZH 3KPRD 3RU8H 1O7VA 5HHVH 2KERA 3F01A 4YL9A 4OR1A 25C8L 3KLAB 4O5LH 5EZOH 2DWDB 2COVD 3DRQA 3QXDB 2H45A 3VFTA 2VERN 1Z9SB 4AXWB 3P69A 1GGBH 1M1KW 1HHIB 3JSLA 4MVSA 1D6EB 4YSDA 5AUMB 2BSBA 4LSPL 2DWSA 4KQ4L 3P9WB 4XP6L 4CMHB 1IB5A 3SDXB 1ULVA 1EK3A 4QNPE 3CC5A 3PXJA 2JKRM 4G7QB 5LHGA 2K78A 4NFCA 3OR6B 3RI5K 4BKSC 1M7XA 2WMPB 4FFBB 4Y5YC 5DMKB 4EOWH 3TBSA 4PB9L 4FCHA 1H8EG 2MPVA 2OQJB 1F4AA 4TF4A 5BRZA 5DUJA 2X0VA 3V0VA 1ZLUK 3MCKB 2FEDD 4LVEA 3OGCC 4PRDA 2BC4A 4Y4HB 3CSYB 4LAQH 3K3QA 1NIEA 1JJOA 1JGVH 3MHZA 1DUYB 2Q9OA 4I9XA 4KKRA 4X7SH 4BSVB 1U6AH 4X4XB 5B1CA 2ITCC 5H35A 3BEWA 1NFIB 1BAGA 2DMHA 5I1EL 5JYLA 3QUGA 4IRSD 3BKJL 4IIZA 5J9PA 1TUEB 4E4EA 3SE8L 2HR3A 1OV9A 1EEZA 4TYUA 4UTCA 3EOTL 1BVNT 3MRPB 1UXWB 3RIKA 1PX8A 1U8QB 3Q01A 3UPRA 4FI6A 3C9NB 1K7DA 2B2XH 3H0TB 3NJMA 5AYTA 4Z0BL 4BUQA 2YEZB 4HWNA 5KSBE 2H6UA 5M7QA 1CFVL 4OV5B 4S2SA 4QGPA 5C0CB 1HL4A 3RUGE 4MAUL 1H6EA 1HH9B 1YC8A 3CC1A 4KDWA 1TVBA 4P5TB 1MHPH 5DD1L 4ISVB 1YY8B 5KN5A 4N87A 3RYFB 2H1PL 4XVJH 1R9FA 1I94B 1CFQA 3WIFB 2NR6A 2ZG1A 3IDGA 5G4OA 4AVKA 1TQTA 1YYCA 2C9XA 3ML9A 4ODSL 4CC4C 3WB0A 3ZE0E 4DR7O 5G5DB 2H3XC 1MAMH 3NESA 4CU7A 1AD9A 1JBJA 4TVPD 1CJYA 1Q7YW 1YDPB 1RZ8A 4OX9O 4FEIA 4H8WL 3ROOA 5JH7B 1J5EB 2IGFL 4CW1A 5L8JB 1G9NL 3ARXA 4U33A 2IQAA 4OKDA 2SEBA 5GIRB 1OE2A 3MLXL 4KKLD 4P57B 2BOLA 1A32A 4AI8A 2QEXV 1C5BL 2X38A 4YSCA 3ULUC 4GSDH 3HE7A 1N36B 1IZKA 3U7YH 1Y6NR 4P23D 1F90H 4K5MA 4LVHB 2XPZA 4C58B 1BZ8A 3TESA 4JDZA 3SE9H 1BGYH 2E5LB 1WP6A 2VDKB 1H6FA 3ABKC 1KY7A 2EUWA 2HHHO 1YVWA 2P9RA 3TIEA 4RX4A 1OL0A 5DJDA 1ORQC 5JHBA 3U0TA 4QPKA 4WHYH 3MO1B 4G9DB 1DFBL 2XYBA 2EILB 1N8RW 4IKJA 5CBGA 2UU9O 2EE0A 4R7DA 3R7QA 1YJDH 5ANMB 3EXLA 1BLNB 2Z35B 3O2DH 4PG2C 1RVFL 4DUXA 3CFEB 4E36A 4RDQG 4JI5B 3VD1A 4RMWA 5DD5L 2GUZA 2OMXB 3N44B 5FF6B 3VRJA 5KX5A 5D1QE 2CKBL 1SN2A 3SDAA 5IFAL 3X11B 2QR4A 3BD3A 1L4IA 4AKPA 4J4PA 1ODAA 4KJPD 4IJ3C 5DEZA 4D0DB 1MY7A 1OB1A 5K9KA 2EDTA 2YFNA 5F3FA 3I75B 2W59A 3T3MB 5D5PA 4GUPB 5I1AB 3VFTB 2YMTA 4BKLA 1EERB 5DK0B 4PJCF 5CSBA 3IN2A 4OZIA 4XXWA 3JV0A 1XL4A 1HE8A 2Y06L 5SWSE 2VMEA 4J11A 4I0XA 4F7TA 1OCCC 4HZLA 4JO4H 3QG7H 3K0DA 3UJTL 2P46B 4M1CD 5BRZB 3K5SA 2XPGA 1AP2B 1KIPA 2PW2B 2C34A 2NTFB 3CCUV 2DYRB 1B4TA 1L6ZA 5GSRA 2XY2A 1OW0C 5KSAA 3AM8C 1ACCA 3T8XA 1U8IB 5AYUH 2WXPA 2FAUA 1ETZB 3TO4C 1I7TB 1BBDL 1A4JB 2AK4A 5ICXB 4DV6B 4RQEA 5I8CA 1X5YA 3OT7A 1QSFA 1NBQA 3OSVA 2VQTA 4P9HC 3OC8A 1A0QH 4ZUSB 2DQHL 2ZT9C 4URKA 4Z95L 2D7TH 1FVEA 3L9RA 4L3EA 2UUCO 5AW3B 1BZ7A 2IDCA 1NCOA 3UPRB 3PWPA 1AGCB 2OS7A 2P5WD 4TLSA 4K23H 4O51B 3REWB 5I19L 1QHPA 3RHWK 2ZXAA 3QVNA 2Z7ZA 2LLLA 2GIMA 3DHMA 3VCLB 4JS7A 4HPOL 4N6QA 3BH9A 1Q94A 1KXHA 4WLCA 4QJ4B 4U6VH 1X44A 4L1TA 1TVBB 3ILDA 4DPAX 3CZUB 1GHFH 4KX7A 3G6JB 2F19H 5KN5B 1UVQA 4BK5A 2BSED 4M7JH 4WGVB 3LEXA 4G8EA 5FYLE 2L8AA 4GP5B 2PP7A 3TN0C 4J39A 2OMZA 1KEMH 1IL1A 1S6NA 3P3RA 4YZWA 3OEEG 1LE5A 3HHSB 4G6AD 2C3XA 1LYQA 2EC9U 4JPRA 4OGAD 4B9FA 5IE9A 1NTDA 2JS3A 1SF5A 2A9BA 1EBOA 5IVXE 3ROOB 4OZFH 2QTSA 4CW1B 2Z31A 1XGPA 2FSDA 4TXVB 2SEBB 3PIQB 1D9KB 5F70A 3U0WL 4B7LA 2YGOA 1UWXH 4YX2L 1E3XA 2WWWA 4KFZC 5HI4C 3MLZH 5L3GA 1IBLB 1QTPA 2NZ9D 3ECBB 4Z7QB 5IVNA 5DECA 1M9WA 5IY5C 4JM4H 1CLOL 2DQ3A 4Z7NB 4EVNA 1DBJH 2WQAA 1F8TH 4NNXB 1M93A 2ZP8A 3IE9A 3OKNB 3TIEB 1UKTA 1ETB1 5DJDB 1CC3A 2Z8RA 4QJ5B 2E7CA 1SLVA 3CZLA 4PLKD 4R7DB 3SDLA 4X9YA 4FTVD 1BS3A 4NPYA 4AV4A 4NS0A 4Z3EA 2WC7A 4DGYH 4DK6A 4GAJH 1XH2A 2QSCH 4BFOA 3EBGA 4CC1A 4UV4L 3BPCB 4BKTC 1ZD6A 4PVNA 3VRJB 3B09A 4BIZA 2XASA 3MLVL 2HP8A 2L7UA 3V4UL 2M83A 4NUGL 4JI1B 5KLVH 2F1AA 2EDRA 3A67L 1WH0A 4TOYL 4X6EA 1I85A 4PP1C 4TNGA 3V5KA 2E46A 4FYTA 3K91A 3PP3K 4YAQA 1K6QL 3HE6D 5K9KB 1OB1B 3ZPDA 4QY8A 5IWAB 3BOVA 2KLSA 4DRXA 4LU5L 3V52L 4GKSB 3TBCA 2FBRA 2R2HA 4BKLB 1J8SA 1I82A 4U1SB 1ID5I 4HIXL 1BEXA 4NN7C 2JCCB 3O45A 4H20H 3CXDL 3L6FA 4YDJA 3VB8A 1WBYB 1JZIA 3FBKA 4UBDC 4PJ7E 4KKBD 5D7JC 2HTLD 3H2WA 4Z3FA 4QAMB 3BRDA 2Z0BA 1RM1C 1GH6A 1I9RH 4RA3A 3HKEA 1J5EO 1G9EA 3LKPA 2EDXA 2YSSA 2EUZA 2MPAH 2JH2A 3O4LA 3BO8B 4B53A 5HGDB 1TA8A 3GJFA 3W39A 4TNFA 3I3BA 1VQMV 2ZP0T 2OSLA 4GINA 3PFUA 1N36O 2X4RB 4XVTH 2DLTA 5EULV 1XCXA 1GIGH 2CH7A 1EAJA 2E5LO 3MRRA 1SRYA 4IGBB 1QZ1A 5F1NA 5FYJL 2RH0A 4R7NB 1JNJA 2ESVE 1V5JA 5CLTA 4FYRA 4BZ2L 4ANVA 1FVEB 4L3EB 5C7ZA 4DV2B 4L5FL 2OCHA 2APBA 1MFBH 4WI4A 2VGLM 2NY6D 3RYIB 2R29A 4OI7A 4LIQE 1T22A 2L0DA 1XAUA 3BAWA 5GRUL 3INOA 2XQ0A 2O57A 4H8PA 1Q94B 4YHNA 1SJMA 4JI5O 1MG2C 2C7FA 2YD7A 4LRIA 5ENWB 3W1ZA 4KGLA 3TJEL 1DR9A 3H53A 1TTGA 5CJ8A 4WFAV 2X9YA 3WNJA 3O4OB 1UVQB 2HLAA 3PGCB 4M7KH 4PD4J 4FNLH 4LCCA 2J43A 1N8OE 2VB5A 1QPPA 1TCRB 4J7KA 1H15A 3BIBX 3F5WB 1BYNA 1P7GA 4U1HA 4K8RL 1LE5B 3F7VA 2VKXA 2Y2YA 1MIMH 3QWNA 1IC4L 1XDCA 4MA7L 2V9TA 1SXSA 4TQIA 4ZOCA 5E2TH 4G2AA 3P32A 4IRJC 1DANT 3FSAA 2Z31B 1XGPB 3OWEA 4X5PA 4MAYD 4GT0A 1F23A 3CEIA 3I5DA 3MJ8A 3REVB 1V55C 4HIQA 2KG7A 3RGBA 4OGQB 1UOVA 5D7IA 4J3VA 5GISH 5C08E 1OD9A 2IM9A 5F7DA 3SBQA 3B5HA 1AOZA 4L9LB 4RGNC 4WCYL 4DH2A 4QHPA 5DJ6A 4PG9A 1NQBA 4K7PL 2P5EE 3WHE0 3WSQL 3VA2C 4EVNB 4W70A 2ICEA 1N0XL 5CO1A 3CLFH 1PSKL 2HRPH 4MNQB 2G2NA 3CXHF 4LNUA 3BRCA 3JWNC 4KC3B 2HJKA 4LLYA 4HS3A 1CXZB 4YJ3A 1TETL 3KPRB 3KS0H 5D6DA 5JQ6H 4YHLH 4P0DA 4AG4H 5B3NA 1OPOA 1TO4A 1H2KA 5FLUA 2F53B 1R0AL 2EIMC 4O4IA 4YC2C 1KCVL 4XXCC 2ZOOA 5IMOB 1KJMB 1OTTD 2WBWB 1HIMH 5LGHH 4OY9A 2HYMA 3S34H 5EHFA 2EEXA 4LR3A 3O81A 5I0WA 5CZVH 1ET8A 1JFQH 2UZXA 3IKKA 4Q74A 4PSRA 4QY8B 5EUOA 5IYCO 2ZQKA 4MDJA 3BUDA 4ANXA 1UA6H 3G9AB 3B40A 1W8EA 3ZT7A 2Q0AA 2EKJA 4F58L 1JWUA 3H4HA 2IMNA 2QM4A 3QJQB 1YF2A 4E0RB 2XQBL 1FNEB 5EC2C 1NGWA 4PRID 3L6FB 4YDJB 1EQWA 2AABL 1PS3A 5JQHC 5KHJA 1GMIA 5C0RH 3LNIA 3B5TA 3G3LA 3Q1SH 5D70L 2IJKA 2A74A 2WXRA 4IRSB 2CWRA 1XD1A 2FMLA 4GLXA 3LKPB 5D72H 5GRVK 2YSSB 3OKMA 1HEZA 1JDCA 4XNUH 1AJ7H 1K34A 2CQVA 1EO7A 4Z7OE 5HYSA 1KJVB 3GJFB 3W39B 4YGVB 3KPSE 4E5XB 3UAFA 1SVCP 2P5WA 4JR9H 1I8KB 1F13A 1JCVA 2AITA 3MBEC 3D3VE 5KSUA 2P8PB 1AQDA 5E9DD 5F3HA 2CH7B 3V9EA 3FF8A 4RQFA 2OJZL 2QWNB 4D6TH 3MRRB 2G5RA 1KIRB 2HKAA 2KKQA 2VDNB 3FFCE 3L5XH 3OXSA 3QORD 5IVOA 1HZLA 2X4OA 4JI3B 3FO0H 3VWJC 4RAVA 4X1KA 3ULUF 4JE4B 3LQZB 4PJHA 4GH7B 1TFHA 1HNXB 3F84A 4J7JA 3N5AA 3Q13A 5J11B 4WHDA 4OM1L 1K5NB 4U0QB 3ZKSD 3QC5X 4WJG3 5DUPL 1Z9OA 1VQ7V 1MCDA 4ZX4A 4OXSA 3UFIA 2I07B 5L3FA 2YAFA 3LVTA 3LYRA 4YHNB 3WTXA 3CBRA 5D1XC 2HN7A 4U7NA 4HWBA 1SYSB 4AEFA 4FFTA 1A1NA 1WPCA 5F7MC 6TAAA 1H8SA 2I25N 2VDOH 2ZYHA 4NQQA 3HPLA 2HLAB 4LSRH 4UTBL 1T1ZB 5KOVC 1CF8L 4PH8A 5FHBL 2YC1A 5F71A 4P5MB 2ZD0A 4OFKA 2H32B 2PP9A 3L3KA 4BINA 5LHDA 5IWAO 3BVNA 4WW2B 4P23B 4FN0A 3T3PE 1OAXL 4TLTA 2DE0X 2IBGA 5DS8A 1F4HA 2GEQA 2ZCHL 4C57C 4E9XA 1L1FA 4HS8H 1X5MA 3WIIL 1ML0A 3HG1E 2ZUSA 1CPYA 1W6WA 4NO3A 3WKQA 3WFEL 1YEJL 2DLHA 5JW4Q 2K45A 5LO7A 3LXBA 2L7EA 3QISA 4RMQA 2YI9A 4CRPA 1XMEB 3N2JA 4EKWA 4FTVA 2OTPA 3UZEC 2GY7B 3BH8A 1IBGH 2QWPB 2EXTA 5BS0B 5LA6A 4D0CB 5DK3A 3DJSA 4N8CL 3DOHA 2FRGP 3L7EA 3LH9A 4N1EA 5ACZB 1MH5A 4L23A 4LNUB 2M7WA 1CGUA 3SDXE 1R3KC 1MRDL 2YOAA 3QI9A 3R1GH 1ZV2A 5CJOH 1OPGL 5I6XC 3ARFC 4YJ3B 1DBKL 4B9KC 3FOMB 1NPUA 4YBQD 1VARA 3ZMTA 3VQLA 2DQFB 2YUXA 4A7VA 3CCHA 4O4IB 4HLZH 4LLAA 4JEGB 3RWHA 3VGFA 5DRXA 3V6FB 4OZFG 2P48B 1EX0A 4NVPA 3H9ZA 3NYKA 3ZCCA 1AY1L 4ADJA 4X65B 3J07A 3L16A 4IKIA 2QADC 3MRHB 1OCWH 4F6RA 4MMZC 3V7MA 4PVLA 1M6OA 5LOVA 3P30A 1CBVL 4MGXA 5CBEA 2KQNA 5BQDA 3V4VL 5J56B 2L35A 1GC1H 1XD0A 5IFJA 2BVUA 3FT1A 2CRYA 1EV2E 4GYBA 2UUDK 4PGZA 1GGIL 3PV7A 3WO4C 3ETBF 3V6ZA 1LNUA 5IQ7L 2NYYC 1ADQH 4Y4FA 4KQ3L 5C0CE 2W0XA 1AGEA 4LEXH 3CD6V 5IWLC 5DLML 3WUWA 4YZFE 4LCVA 3KBHE 2H6PB 2A74B 3SSGA 4LF4O 4LRNH 5AVVB 3IJYB 2A4EA 2BIQA 5B1JA 4JX0A 4NPJA 1QX1A 2F7OA 3BUTA 1D5AA 3PHOB 2P5WB 4OD3H 4OKVA 1CD0A 1ZVNA 2WKOF 3C2AH 4NO2B 4MB3A 4YK4B 1PG7L 2FYYB 5B39G 3US9A 3IB4A 2JB6A 4LCUA 4LGPB 4RDBA 2CTPA 1DHKA 1KNOA 4HUUA 3LRKA 2JB5H 4F7MB 1AXSB 1TG8A 3VVVA 4RAVB 5DFWH 4X1KB 1H5BC 3AREB 4AEIL 1T83C 4PJHB 2R1YA 4O02A 3UTSD 2IPKB 3FT4A 4HF5L 2BHUA 2OW7A 1WP8A 3KWTA 4PS3A 5EC1A 3IDMA 1IBDA 1DYZA 3MRMA 3TGUH 3C08L 4MQ7B 3EFDH 5F96H 3U7WL 4GMSL 4P5SA 1WICA 3W7TA 3BN3B 1ONQA 5KYXB 1HL8A 3UC2A 1NUGA 1EPFA 3EJYD 3EO1A 2VLJD 1NWPA 2YC1B 4X98B 4OTXL 5EORH 3L3KB 1FGNH 2YXVA 3TCLA 5BO1H 2DBJA 5A2CA 5ANME 4KI5D 4RZKA 1R17A 2QEJA 4YHYC 5KYYB 4KUMA 4J23A 1M2VB 2ZR3A 3OAZK 3QCVH 4UZSA 3VFRA 2EIKB 2YSUB 2EO9A 2JKWA 1D5IL 3KL0A 5ESQA 4JKPL 4NO3B 3NFPA 1WIPA 1BFTA 1EZVH 1WTGT 1KBKA 5IW6B 1WFJA 1OCRB 5LMUO 1T89A 2IAMB 1IILE 2NNCA 3T3ME 4YS4A 5HGBA 1D6VL 4Q6GA 3IJSB 5J12C 2H26A 4GB9A 3FB7C 3MNVA 1B4JL 3QA3B 5GS3A 3WDJA 4U7KA 2Y5TA 3TBTA 5BJTA 5I1HL 1JYWA 4DV7B 1B6UA 3IE4A 3HE6B 3QEUA 1JDDA 4HJ0C 5LDSA 1ZLSL 2ZE7A 3N06B 4Z8FH 4FQHA 1DP0A 4U1IA 3WFDH 1M7DB 4F57H 1R5VA 5BRZE 4X66B 1ETJA 1DTOA 2CGRL 1HWYA 1RFDH 1MJ8L 3FB5B 4J8QA 4UM9D 2M8XA 4PRIA 5DJYB 3TEYA 1S7QB 5D5MA 3V0AC 5JIKA 3APFA 1G7HA 4QHNB 1TTRA 2BP8B 2HFEC 1ZLVH 4KXAA 3CDGB 2F43G 3VI4F 1YJNV 5KZCD 5CBEB 4X4MA 3NPSC 1Z6JT 2HSIA 3A6CL 4FLZA 2DM2A 1H8HG 2EUXA 4NCC1 1B9KA 4N2DA 3QJRB 5JCOA 4W9JC 5J0BA 3MA7A 1GSKA 4FNPA 1RP8A 2Y1VA 3NP3A 2WLMA 4KQ4H 4XP6H 4ELKB 4UCRA 1AGEB 4XVUC 1P69B 3GBNH 5E9DA 1O5PA 1AHWC 1U8MA 1XFPA 1XGUA 2BRRH 4HPYL 1RHFA 2W9EL 5F7FA 1JAEA 3WUWB 3GF8A 4AUJA 5IJDC 1WHPA 1VQ6V 4GX0A 1NMCB 3L3DB 4HG4K 3G6JE 2A83A 4DYLA 3SR2C 5IMKA 1PD3A 5IJVA 2EC8A 4R4BA 2VLME 2OXHB 3ILQC 4JN2A 4MXWH 4PWEA 3IKCB 4XMKL 5B4MD 3MX0A 3B77A 1I53A 2DMGA 5SWZD 2NY6B 3VM7A 4AEHL 3SB3A 4OKVB 4TSCL 4F91B 5L0QB 2O5ZH 2I7SA 2FJHB 4LSQL 3V8CA 4HC1L 5LP6A 2E7HA 4XMLL 5E6UB 5DJ2B 2RMNA 2AJVH 2O6CA 4N0UB 4NZUL 3T71A 1KNOB 4BRJA 3K46A 3CXFA 4RFOH 1AE6L 1TCMA 2IEPA 2G2PA 1A14H 1KU9A 3SE8H 5AB0A 2CGYA 1QASA 3LVEA 1J1XL 3CFQA 3TVMA 2O6DA 3B9KC 5HFLA 3OHXA 5EC1B 3IDMB 4APQD 4J41A 4X7TA 2AXGA 2ICWA 2RHEA 4S1DC 5J8OA 3LDBC 1XSJA 1S5IL 5ALCL 4Z7NE 3CXHK 1NBMG 1K9TA 3LKQB 4QOKB 5HXMA 1KXQA 4X65O 2VDQH 4MAYB 4RSVA 4EN3C 1RUAL 1JCHA 4M7LT 4YHZL 3IVKA 4BIKA 2FJSA 4GQRA 4ANUA 2Z34A 4B0MM 1AIFB 4AQAB 3UG4A 2KQMA 2K1MA 4OLVH 1CYXA 1DUZB 4OPHA 2CTRA 1FZMA 3DMMC 4NWUL 3T6XA 1MQ8A 4BWWA 5I1CH 2F58H 3WKMH 1WLEA 5C3LD 5I75B 2YMOA 3EXAA 3VFRB 1IC7L 1WEJH 1UJWB 1OM3H 2AJUL 4OQTL 2A9ML 3J81N 2ENYA 2LLGA 4TUOA 1W15A 3ZZ1A 3NFPB 4N23A 5E6YA 1U41A 2NY4D 4QCIA 1RK1B 1S7WA 1MVFA 1UKSA 2OYMA 3QFJD 1KG0A 1XZWA 2XZQL 3DVNA 3E2HC 4ODTH 3VFWB 1YG9A 1ILSA 4HYTB 4DR6B 1A6AB 1IURA 3CSGA 5KBNC 5D1QC