1V59A

Crystal structure of yeast lipoamide dehydrogenase complexed with nad+
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
478
structure length
478
Chain Sequence
TINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+
rcsb
molecule tags Oxidoreductase
molecule keywords Dihydrolipoamide dehydrogenase
total genus 160
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1v59A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1v59A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1v59A02
4ZCCA 5U63A 3AECA 4CCQA 4H4SA 3ALJA 4ADWA 1EL8A 1GOSA 4U8JA 2OLOA 4J36A 4EIPA 2ZZCA 1B37A 3NTDA 1GESA 3LZXA 1CF3A 2YLTA 4NTDA 5GRTA 1CJ3A 4EMJA 4A6NA 3RP8A 4J34A 2B7RA 4CBQA 1GT8A 1LQTA 3RP6A 3AEAA 5L46A 2C75A 4JN9A 4K5SA 3VRBA 2XFOA 4HB9A 4H4WA 1VG0A 4B67A 1IUUA 2YG3A 1NHPA 3AXBA 2GAGB 2YQUA 3NKSA 4OPGA 3UKHA 2XFUA 1SEZA 3SM8A 4A5LA 3K7QX 4YSYA 4J57A 1E39A 4A7AA 2FJBA 2BS3A 2RGHA 3D1CA 3GYJA 4WX1A 2X50A 1S3EA 3WE0A 4Z25A 2WP6A 2YR4A 1XANA 3B6DA 3NK2X 3DK8A 3LXDA 5IQ1A 3H8IA 4OCGA 1ZY8A 3BHFA 3KPFA 2EQ8A 1FL2A 2WDQA 4Z26A 3UTGA 3V3OA 4YTPA 2YLWA 3AEBA 3T37A 4HA6A 1N1PA 3O0HA 1GRTA 1YQ3A 1JRYA 2PHHA 5FS8A 3CGCA 4OPCA 4D04A 1JRZA 5KRQA 2CFYA 3ITJA 4H7UA 2IIDA 4BV6A 2GR2A 3CGEA 2WS3A 3AEGA 2JKCA 3GSIA 1NENA 5FMHA 1CJCA 2YVGA 4A65A 1CC4A 5JCKA 4YTMA 3NNEA 3SQPA 3PO7A 1LQUA 3CPHG 1E1LA 4KX6A 3V76A 4OPIA 3FG2P 3SFEA 4Z2UA 2YLZA 4FDCB 4TM4A 3NN6X 3ALMA 1RYIA 1EL7A 2X8HA 1S2QA 2V5ZA 4Z2TA 2YVJA 1PS9A 5FS9A 2OAMA 4USQA 1YQZA 4O5QA 4A79A 1GETA 1BKWA 4K5RA 2R0CA 4YWOA 4H4QA 1E1KA 3H8LA 3NT6A 1NEKA 3EANA 4PAAA 1ZOVA 1FEBA 4H4XA 5BVAA 1ZP0A 1GPEA 4X9MA 4BJYA 5HYMA 2B9YA 4XWZA 4BK3A 4H4ZA 3COXA 1TDNA 4C77A 4U8LA 3CTYA 4Y4MA 1MXTA 3AEDA 4YT0A 2WBAA 1D5TA 2Z5YA 2WPFA 4ICYA 1OJ9A 3AE8A 1P2HA 1RSGA 1QLBA 4CCRA 1VRQB 3FBSA 3AE2A 4N9XA 5M0ZA 1CC2A 2IVDA 3ADAB 1O5WA 3CN8A 2V61A 5FS6A 2VRLA 4K2XA 5GSNA 2JB3A 3NYEA 4ZN0A 2XVFA 1GNDA 1BGNA 3NYFA 1BF3A 4JY3A 4UDPA 3CPIG 5EBKA 4X4JA 2C65A 1NHQA 4D03A 1ZOYA 1D4DA 1H82A 3EF6A 4A6NB 4B63A 2XVIA 4CNKA 1QO8A 3NH3X 4J31A 2C72A 3BI4A 1D4CA 5EB4A 3UKKA 3VQRA 1CBOA 2XVJA 2A8XA 3KU9A 4B69A 3QJ4A 4J56A 1Y56B 4U8NA 5BULA 1F8RA 4RSLA 1JOAA 4GRTA 4XWRA 2O9ZA 4FK1A 3SGLA 2YM1A 4BURA 2NPXA 4EQXA 2WPEA 2RGJA 4IA6A 4B64A 3UOZA 2WDRA 2WOVA 1OJAA 1H7WA 4DGKA 3G5QA 1S2YA 2GR3A 2C70A 4ECHA 4AT2A 4TLZA 1N4WA 1DJNA 3BI2A 1PBBA 5EB5A 3E1TA 1ONFA 2EQ6A 1BWCA 2XLTA 4K22A 1TYPA 1GEUA 1CHUA 2XDOA 5IQ4A 2YG6A 4NTEA 4X9NA 5C3JA 1NHSA 4U8IA 1JRXA 5CKUA 3QSSA 1NHRA 2YM2A 3QSEA 4B68A 4AT0A 2IVEA 1JNRA 4EM4A 3GWDA 1EBDA 1PXBA 2FBWA 4REKA 2BC0A 1NDAA 1IUXA 3AE4A 4PABA 3P4SA 2BK4A 4OPDA 3V3NA 2Z5XA 1GRBA 1H84A 3NRNA 3AD7B 1GTEA 1CJ2A 3BHKA 3UTEA 2BXRA 1LTXR 1L9EA 2C7GA 4GDPA 4B65A 2WDVA 3ISHA 3DGHA 1JNZA 3AE7A 4UP3A 3S61A 5HY5A 1ZX9A 1CJ4A 1D4EA 2C67A 2C3CA 4AOSA 3M13A 1CC6A 2OLNA 3P4RA 4KPRA 3VR9A 2YG4A 1PXAA 1VQWA 3GYIA 2FJEA 3ATRA 3ATQA 2XLRA 4O5UA 1UKVG 4H2NA 1GV4A 3DGZA 1PN0A 2CVJA 4Z43A 3EPTA 1KF6A 1LV0A 4EQWA 4I59A 2H89A 3QFBA 3NK0X 5U1OA 4H4VA 1PBDA 2BYBA 1LVLA 3NK1X 1MO9A 3CNDA 2GRTA 1LPFA 3AYLA 3AE3A 2JK6A 1VDCA 2Q0LA 1Q1RA 2H88A 3NTAA 1ZMDA 3JSKA 3C96A 2BXSA 4J33A 5IPYA 3C4AA 1DXLA 4DNAA 2APGA 4U8KA 1F8SA 4AOXA 1Y56A 2XLPA 3C4NA 3DJDA 4C3YA 3GRSA 5BRTA 1PXCA 4EIQA 2YLSA 4TM0A 2BACA 1S3BA 3M0OA 5KWFA 1CL0A 1REOA 3ZYXA 2FJDA 2C73A 4IA5A 3ICTA 3UKAA 1ZK7A 3UKLA 2RABA 3OC4A 4U2SA 1ELIA 5EOWA 4UDQA 3AD8B 3K7TA 1NG4A 3IHGA 1IUVA 1PDHA 2J3NA 2XFNA 4BK2A 4TLXA 4GCMA 3ICRA 4I58A 5HHFA 1E1NA 3CNPA 3LB8A 4GDEA 4U2TA 2YR6A 2FJAA 2EQ7A 2Q6UA 4Z24A 1NPXA 3Q6JA 4IV9A 3GDPA 4H2QA 3F8DA 2QCUA 3UOYA 3DJJA 1KSSA 1LJ1A 5J7XA 4YSXA 2GH5A 4EMWA 3UKFA 4U8PA 2GEWA 3DJGX 1H83A 5KXJA 1Q9IA 2TPRA 3NGCX 3AE6A 3AYJA 1K0LA 3CGBA 4H4PA 2ACZA 2VQBA 4WCTA 4RG4A 2DKHA 3UKQA 2ZZ0A 4H4TA 4DSGA 5KOWA 1PBEA 2YG7A 1OJDA 1F8WA 2EQ9A 2R4JA 3NIXA 2ZZBA 4DSHA 2NVKX 4U2LA 2AAQA 3RNMA 4UDRA 3M12A 2GQWA 1P2EA 1GXFA 4J2WA 2X8GA 3SFDA 3AEFA 3HZLA 4C74A 1GREA 2WP5A 1MOKA 4FK1C 3RP7A 1M6IA 3QSMA 1X31B 1FECA 3AD9B 4Y4LA 3GD3A 2HQMA 5LV9A 2WU5A 3PVCA 1H6VA 4XXGA 1F3PA 1GERA 1D7LA 3K30A 2GF3A 2RGOA 4RG3A 2BCGG 3L8KA 2GR0A 2GR1A 2V60A 3GD4A 4H2PA 3II4A 3ZDNA 3KD9A 1GRGA 2V6OA 5KVIA 1COYA 2ARDA 4OVIA 4USRA 4A9WA 2BA9A 4CY8A 1RP0A 3NLCA 2JB1A 2X3NA 1B4VA 2Q0KA 5JCMA 4K7ZA 2JB2A 2BS2A 3BI5A 2XLUA 3CIRA 1FCDA 4IVOB 1YQ4A 3UP4A 1ZDLA 1DOEA 1N4UA 2V3BA 3FIMB 4EM3A 4BK1A 2YAUA 3GDNA 3KKJA 3KLJA 5J60A 5JCIA 3VRDB 3AE1A 4Z2RA 4P9SA 1KDGA 2YR5A 4JNQA 1VG9A 3UKPA 4Z44A 1YY5A 4LA1A 1PJ5A 4TM3A 1PJ6A 3BNMA 3DMEA 1IUWA 2F5ZA 2WP9A 2XVHA 3CNTA 5BUKA 2YLRA 3CPJG 1DJQA 2Y6RA 2QA1A 2Y6QA 5KVHA 1B5QA 4OPTA 5JCNA 2JBVA 3AE9A 2QAEA 1GTHA 3LOVA 3NN0X 3I6DA 2YLXA 1E7PA 1E1MA 2B9WA 1TDKA 2R0PA 4EQRA 4NZHA 1M64A 2BCPA 1KNRA 1ZKQA 2YVFA 5CQFA 1F6MA 3VR8A 2BK5A 1NG3A 3UOVA 1KSUA 4YSZA 1XPQA 4M52A 1KFYA 2VQ7A 2VVLG 3REDA 4K8DA 3I3LA 1GRAA 2WHDA 2GMHA 3IWAA 3P1WA 4YKFA 2WPCA 1PBCA 2OALA 4H4RA 1L9CA 2VRMA 2R46A 2C66A 1TDOA 4MJWA 2Q7VA 4B66A 1Z6LA 4LIIA 3CNSA 1JEHA 1FOHA 3ABVA 2YWLA 4H4UA 2XYOA 1K0JA 4YTNA 4JQ9A 2R45A 4CRTA 3P9UA 4APNA 4YKGA 3NYCA 2QA2A 3F8RA 3GRTA 1Q1WA 4NEWA 3OZ2A 1H81A 3B3RA 3IC9A 2A89A 3QVPA 3EAOA 1H86A 4FX9A 1KNPA 3AYIA 2B76A 3G5SA 1PJ7A 2X8CA 4YXDA 1YKJA 4C5OA 2BK3A 1PHHA 1O94A 2ZBWA 3LJPA 4NTCA 5C2TA 3RHAA 2XCGA 2DKIA 3KA7A 3PS9A 4ZCDA 1K4QA 2YG5A 3FPZA 3K7MX 5FS7A 1EL5A 1BZLA 3CNJA 3LZWA 4YSHA 1IUTA 4GF7A 3QFAA 1K0IA 2VOUA 2E1MA 2WQYA 2PYXA 4H2RA 1XDIA 2B7SA 5JCLA 3S5WA 2AR8A 3LADA 2JAEA 4H50A 5TR3A 3D8XA 3ICSA 3G5RA 2WOIA 4EMIA 3R9UA 4H4YA 2V3AA 3L1RA 4TM1A 2BC1A 3DK9A 3Q9TA 4C3XA 1O95A 2UZZA 3P4PA 3VRAA 2R4EA 2A87A 3GMCA 4GUVA 1B8SA 2C76A 2XLSA 1XHCA 1Y0PA 4NEVA 3DK4A 2VVMA 3QVRA 3GMBA 2WEUA 3FMWA 1IUSA 4IVMB 4JY2A 3UTHA 2CDUA 2R0GA 1DODA 2WETA 4CNJA 1H7XA 3IF9A 4JNAA 1NAAA 2VZ2A 1TYTA 3CGDA 3URHA 1JU2A 1TDEA 1TRBA 1TDFA 2C3DA 1HYUA 2GQFA 2R9ZA 4AP1A 1GRFA 1L0VA 4GR1A 1DOCA 5ER0A 4OPUA 1FEAA 3DJEA 2XVEA 1DNCA 1ZMCA 3AB1A 2E5VA 3UCLA 4BJZA 1N4VA 1EL9A 3UOXA 2WOWA 2E4GA 3AWIA 4EQSA 1OJCA 2GB0A 2W0HA 5KOXA 2I0ZA 1L9DA 3AE5A 3ALLA 2GAHB 1BGJA 5M10A 3AEEA 1GRHA 1W4XA 2WESA 3BNUA 3DA1A 1DOBA 1GALA 4Y4NA 2GVCA 2X99A 3NG7X 2XFPA 5HXIA 1GSNA 4U8MA 3UTFA 3DH9A 2GMJA 3F8PA 4OPLA 1IJHA 2WU2A 4JDRA 2VVLA 1D7YA 2AQJA 2GV8A 3UP5A 4CY6A 3GWFA 2OA1A 1V59A 1PBFA 4LU6A 1E6EA 4AP3A 2BABA 3NHOX 2B9XA 2TMDA 5DBJA 5U25A 4B1BA 3P4QA 3KVEA 2XFQA 1OJTA 1QJDA 1AOGA 2CULA 4U8OA 4E0VA 3IHMA 2C64A 4A99A 2BS4A 3H4KA
chains in the Genus database with same CATH superfamily
3AECA 2GGIA 4Z1YA 4U8JA 3PWGA 1GT8A 4JN9A 3S47A 3EUB3 2XFOA 1VG0A 1IUUA 3FVDA 3Q45A 3CYJA 4YSYA 4A7AA 2RGHA 1S3EA 3JVAA 1XANA 2OKTA 5FJPA 3V4BA 1ZY8A 3PFRA 4HA6A 1JRYA 4G7FA 2PHHA 5FS8A 3CGCA 4OPCA 3ITJA 2IIDA 5KNLA 2YVGA 2W3SA 4FI4A 3FCPA 3I4KA 4KX6A 3SYIA 3QKEA 2CHRA 4FDCB 3NN6X 4ROPA 2QDDA 1PS9A 5FS9A 2OAMA 1YQZA 3HRDC 4A79A 4YWOA 3SZ0A 4ENLA 1NEKA 1FEBA 3TW9A 1GPEA 4X9MA 2B9YA 1TDNA 3CTYA 1MXTA 1JDFA 1RVKA 2Z5YA 1P2HA 1QLBA 4CCRA 1VRQB 2P8BA 3AE2A 4N9XA 2V61A 2AKMA 5EBKA 2QJNA 4KT2A 1JPDX 3NH3X 3BI4A 1D4CA 5EB4A 3VQRA 3KU9A 4B69A 1SJBA 3STPA 1F8RA 1JOAA 1H2IA 2O9ZA 5M10A 3SGLA 4B64A 1JRPA 3G5QA 1S2YA 2GR3A 3DERA 4JN8A 1N4WA 3BI2A 5EB5A 3E1TA 2EQ6A 5C3JA 1NHSA 4U8IA 1NHRA 2YM2A 3DESA 2IVEA 4EM4A 4J3ZA 4JN7A 4PABA 2BK4A 3AD7B 1GTEA 2BXRA 1LTXR 4B65A 2WDVA 1JNZA 3S61A 3GO2A 1D4EA 4KPRA 3SN0A 3A7AA 3ATRA 5FJRA 3DGZA 1KF6A 3A7RA 2W54A 4KEMA 2E3TA 2PSNA 3NTAA 4NNJA 4U8KA 3C4NA 2XLPA 3DJDA 2BRYA 1PXCA 2YLSA 3GC2A 5KWFA 1CL0A 2FJDA 1WUEA 2NQLA 1ELIA 5EOWA 4UDQA 3ICRA 1P48A 4GDEA 2YR6A 2XGZA 2FJAA 2Q6UA 3T8QA 3F8DA 1KSSA 4YSXA 2GH5A 4U8PA 3DJGX 1Q9IA 4DXKA 2OO6A 3AYJA 3PK7A 3CGBA 2ACZA 4DSGA 5KOWA 3P0WA 1N63C 4TVWA 2NVKX 2GQWA 4J2WA 2X8GA 3HZLA 4C74A 3RP7A 1M6IA 1NELA 3GD3A 2P88A 2HQMA 2GSHA 3PVCA 1H6VA 4XXGA 3K30A 1D7LA 4RG3A 2RGOA 2BCGG 2PTXA 1MDRA 4H2PA 3II4A 4HPNA 4CY8A 4OVIA 1FO4A 1SJDA 1R6WA 3NLCA 2JB1A 2X3NA 1STZA 5JCMA 2JB2A 2XLUA 1X2GA 4K1WA 1YQ4A 5KMSA 4EM3A 3KKJA 5JCIA 4Z2RA 4JNQA 3UKPA 1YY5A 4TM3A 3T4WA 2YLRA 2QA1A 5KVHA 5JCNA 2JBVA 2QAEA 4YWSA 2R0PA 1TDKA 4IHCA 4NZHA 1KNRA 1M64A 2YVFA 3VR8A 3P93A 2VVLG 3REDA 2VQ7A 4K8DA 2WHDA 2GMHA 2WPCA 4M6UA 1L9CA 3UCDA 4G6GA 4MJWA 2Q7VA 1JEHA 1FOHA 3ABVA 2YWLA 4H4UA 4YTNA 3NYCA 1Q1WA 3QN3A 1H81A 3QVPA 1H86A 2B76A 2X8CA 2GGEA 3DFHA 1YKJA 3LJPA 3UJSA 3OP2A 4GFIA 3ETRB 4IP4A 1BZLA 3QFAA 3S5WA 2AR8A 4H50A 3D8XA 4A6GA 2WOIA 2UZZA 3T2YA 3HW2A 1XHCA 2WEUA 4G8TA 3D46A 5KMQA 3CGDA 1TDEA 4AP1A 1GRFA 4G73A 1DOCA 4OPUA 2FKPA 1ZMCA 3UCLA 1JCTA 1N4VA 2E4GA 3AWIA 4MGGA 2GB0A 2GAHB 3AEEA 1W4XA 3DA1A 1DOBA 4DWDA 3NG7X 3VC6A 5HXIA 1GSNA 3UTFA 2GMJA 3ZYXA 3F8PA 1IJHA 3UP5A 1D7YA 2MUCA 3GWFA 3P4QA 3KVEA 1QJDA 1AOGA 4E0VA 4K8GA 3IHMA 2BS4A 3CB3A 4H4SA 4ADWA 1GOSA 3TCSA 4A35A 1CJ3A 4EMJA 4A6NA 4J34A 4CBQA 3FV9A 1LQTA 3RP6A 3MWCA 2C75A 3RRAA 4GAPA 3UKHA 2P0IA 3K7QX 1E39A 3UXLA 2X50A 3WE0A 3BJSA 3B6DA 3TJ4A 3H8IA 4OCGA 3BHFA 2EQ8A 3VCNA 2WDQA 3V3OA 3T2ZA 3AEBA 3T37A 2PTZA 3SN1A 1GRTA 5G5GB 2HNEA 2PTWA 3T9PA 1JRZA 5KRQA 4BV6A 2GR2A 3GSIA 2JKCA 4II3A 1CC4A 4YTMA 4E6MA 3V5FA 1LQUA 1E1LA 1E9IA 5FJOA 2YLZA 4HCHA 1EL7A 4Z2TA 1GETA 3IK4A 1E1KA 3T14A 3H8LA 3EANA 1DTNA 1ZOVA 4PAAA 4H4XA 5HYMA 4BJYA 1SJCA 3RO6A 3RCYA 4BK3A 2OFJA 2WBAA 4GIRA 5M0ZA 2IVDA 3CN8A 5FS6A 4K2XA 4F4RA 3SXIA 2XVFA 1KKOA 3NYFA 1BF3A 2AL2A 3CXBA 4X4JA 4KWSA 1VQZA 4J31A 2GGGA 4IZGA 2XVJA 2A8XA 4J56A 1Y56B 4GRTA 2YM1A 2RGJA 1OJAA 1PDYA 2C70A 5BOFA 4AT2A 2I5QA 1PBBA 5FJTA 2XDOA 5IQ4A 4NTEA 3QSSA 4AT0A 1JNRA 3PWIA 1PXBA 4REKA 3P4SA 3UXKA 3ISHA 1ZX9A 2C67A 2C3CA 3CAWA 2YG4A 1PXAA 1VQWA 3GYIA 2XLRA 4H2NA 3EPTA 1FFUC 1W6TA 3SBFA 3JW7A 1PBDA 2BYBA 1LVLA 3NK1X 3NZGA 1NU5A 3FJ4A 3AE3A 1VDCA 4H1ZA 3NO1A 4J33A 3HYVA 5IPYA 5BRTA 1F8SA 5JRBA 3R0UA 1REOA 2PP3A 2PMQA 4HYRA 1ZK7A 4U2SA 4IL0A 1FIQB 3IHGA 1IUVA 4TLXA 4I58A 3LB8A 3VA8A 2EQ7A 3UOYA 3DJJA 1S7MA 2ZC8A 4IT1A 1YEYA 1IYXA 3UKFA 2VQBA 4WCTA 4RG4A 2DKHA 2ZZ0A 3HYXA 2YG7A 2R4JA 3NIXA 4U2LA 3RNMA 2QJMA 3M12A 4G6HA 1GXFA 3UJEA 2GDQA 2WP5A 1X31B 3MKCA 5LV9A 2DW7A 3R25A 3L8KA 3NVVB 2GR0A 2V60A 1GRGA 2V6OA 4USRA 4G74A 1RP0A 2Q0KA 3BI5A 1XS2A 3CIRA 2PGWA 1FCDA 4IVOB 1ZDLA 3U4FA 2QGYA 2V3BA 3FIMB 1MDLA 2YAUA 3KLJA 5J60A 3VRDB 3AE1A 4DN1A 3H12A 3CMMA 4Z44A 1PJ6A 3BNMA 7ENLA 2Y6QA 2PS2A 1GTHA 3I6DA 1E7PA 1E1MA 3R10A 4EQRA 1KSUA 1XPQA 2OLAA 2POZA 3DDMA 4HCLA 2R46A 3BOXA 1Z6LA 3VC5A 3CNSA 4TVYA 3TWBA 1K0JA 4JQ9A 3QLDA 4APNA 2QA2A 3UCCA 3SR6B 1R0MA 3B3RA 4FX9A 1PJ7A 4YXDA 1PHHA 2P8CA 2XCGA 2DKIA 3KA7A 3PS9A 2YG5A 1EL5A 4GAVA 4GGHA 1SB3B 1XDIA 3UJFA 4FP1A 3NVWB 4EMIA 1SJAA 4H4YA 2BC1A 3Q9TA 3VRAA 2R4EA 2A87A 3GMCA 4GUVA 4HNCA 2C76A 2VVMA 3GMBA 3SZCA 4IVMB 2FYMA 5EU9A 2CDUA 2R0GA 2WETA 1H7XA 2AL2B 2VZ2A 1TDFA 2GQFA 2R9ZA 3D9XA 1L0VA 2PA6A 3DJEA 4M0XA 3AB1A 1FHUA 1EL9A 4EQSA 4ZA0A 5KOXA 1L9DA 1BGJA 1GRHA 3Q4DA 1GALA 2GVCA 3EEZA 4DYEA 2WU2A 3T31A 2VVLA 2AQJA 4CY6A 1PBFA 1E6EA 4AP3A 3R07C 1OJTA 4U8OA 4C77A 4ZCCA 2W0HA 5U63A 1JPMA 1GESA 3LZXA 1CF3A 2YLTA 5GRTA 3RP8A 4H2HA 3AEAA 1KKRA 4K5SA 5L46A 1WUFA 4H4WA 3AXBA 2GAGB 4OPGA 4A5LA 2PODA 2XFUA 1SEZA 4J57A 3TQPA 2FJBA 1N5WC 3D1CA 3GYJA 2WP6A 1ONEA 3NK2X 3DK8A 5KMPA 2OX4A 5IQ1A 3KPFA 1FL2A 3UTGA 4YTPA 2YLWA 3O0HA 1YQ3A 4D04A 2CFYA 4H7UA 2WS3A 5FMHA 3B97A 5JCKA 3NRZB 3NNEA 3PO7A 3CPHG 3V76A 2XH0A 3FG2P 3SFEA 4Z2UA 2PP0A 1RYIA 1S2QA 4USQA 4GYPC 4O5QA 4GGBA 4H4QA 2C4CA 3NT6A 2GGHA 1ZP0A 1MNSA 4H4ZA 4U8LA 4YT0A 1D5TA 2WPFA 1RSGA 3FBSA 3T0KA 1CC2A 4G9KA 3ADAB 2GGJA 5GSNA 1L8PA 3NYEA 4ZN0A 1GNDA 1BGNA 4JY3A 4UDPA 3CPIG 2C65A 1NHQA 4D03A 4A6NB 4B63A 1FHVA 2XVIA 3UKKA 5BULA 2BRAA 4XWRA 1ECQA 4BURA 2NPXA 2HXUA 2WPEA 4IA6A 2WOVA 1H7WA 3GD6A 4TLZA 1DJNA 1BWCA 4K22A 1CHUA 1GEUA 4E8GA 2YG6A 4X9NA 3HYWA 4ZCWA 4B68A 3QSEA 3GWDA 1EBDA 3AM9A 2FBWA 1IUXA 1ZXIC 3V3NA 4OPDA 2Z5XA 1GRBA 1CJ2A 2PU1A 3BHKA 3UTEA 1L9EA 4GMEA 2C7GA 3DGHA 3AE7A 4UP3A 5HY5A 5BOEA 3M13A 3P4RA 2PU0A 3ATQA 4O5UA 1GV4A 1PN0A 2CVJA 2OZ8A 2H89A 5U1OA 2MNRA 3TTEA 3R1ZA 3CNDA 2GRTA 3AYLA 2JK6A 2Q0LA 1Q1RA 3NS1B 1ZMDA 2P3ZA 3C4AA 4AOXA 4C3YA 4EIQA 2BACA 3FYYA 2RABA 3OC4A 3R11A 2QQ6A 3AD8B 1P43A 3K7TA 1PDHA 2J3NA 5HHFA 1E1NA 3CNPA 3IJIA 3GDPA 2QCUA 1EC8A 1LJ1A 4EMWA 5KXJA 2HXTA 2TPRA 3AE6A 4H4PA 2QDEA 4H4TA 3N4EA 3BSMA 1PBEA 1F8WA 2ZZBA 4H19A 1P2EA 5G5HB 3MQTA 1GREA 4FK1C 1MOKA 1FECA 4Y4LA 2WU5A 1F3PA 3B9JB 3DG3A 3GD4A 2W3RA 5KVIA 2OQYA 3IJQA 2XH2A 1B4VA 4K7ZA 1KCZA 1DOEA 3UP4A 2DW6A 4DX3A 2PTYA 4IL2A 4II2A 4BK1A 3GDNA 4P9SA 4H83A 1VG9A 3OZMA 4LA1A 1T3QC 3U9IA 3DMEA 2WP9A 5BUKA 3CPJG 1B5QA 3LOVA 2YLXA 3DGBA 5ENLA 5CQFA 2BK5A 3UOVA 4M52A 1GRAA 3NVZB 3CXOA 3FXGA 4YKFA 2VRMA 4E4FA 2XSXA 2C66A 4KPLA 4HCDA 4B66A 4MMWA 3UJ2A 3RITA 4LIIA 4CRTA 1EC7A 1EBHA 3R0KA 3NVYB 3SSZA 3GRTA 4NEWA 3OZ2A 3VFCA 3AMZA 2A89A 3AYIA 2BK3A 3RHAA 3EKGA 4ZCDA 1K4QA 3K7MX 5FS7A 3CNJA 3LZWA 4GF7A 4IP5A 2VOUA 2PYXA 4H2RA 2B7SA 3LADA 2JAEA 5TR3A 2XH4A 3R9UA 3SZWA 4TM1A 3P4PA 1KD0A 3HPFA 1Y0PA 4NEVA 3DK4A 3FMWA 1DODA 4CNJA 1MRAA 4JNAA 1FFVC 1TYTA 1N60C 3UGVA 2C3DA 1HYUA 1N5XA 3ZVHA 2XVEA 2GL5A 3DG6A 2PP1A 3UOXA 1OJCA 2I0ZA 3AE5A 2WESA 3JZUA 4Y4NA 2O56A 2OA1A 1V59A 1N62C 2BABA 2TMDA 5DBJA 3VCCA 2CULA 3T2KA 2RDXA 3NFUA 4CCQA 3ALJA 1EL8A 2OLOA 4J36A 4EIPA 2ZZCA 1B37A 3NTDA 4NTDA 3MY9A 2B7RA 3VRBA 4HB9A 3ZLGA 4B67A 2YG3A 1NHPA 2YQUA 3NKSA 3SM8A 2XH7A 2BS3A 4WX1A 4Z25A 2YR4A 3GY1A 3RR1A 3LXDA 4Z26A 3QTPA 1N1PA 1ELSA 2OPJA 1X2HA 3CGEA 3AEGA 2ZADA 1NENA 1CJCA 4HN8A 4A65A 3SQPA 3K1GA 4OPIA 3KUMA 4TM4A 3ALMA 2X8HA 1WYGA 2V5ZA 2YVJA 2HZGA 1BKWA 4K5RA 2R0CA 1EC9A 5BVAA 4E5TA 3TJIA 3VDGA 4XWZA 3COXA 4Y4MA 3AEDA 5KMRA 4ICYA 1OJ9A 5FJUA 3AE8A 2E5AA 4A3RA 3MUCA 1O5WA 2VRLA 2JB3A 2OZTA 3CK5A 5J04A 1ZOYA 1D4DA 1H82A 3EF6A 4CNKA 4GYPA 1QO8A 2C72A 3V3WA 1CBOA 2PGEA 3D47A 3QJ4A 4U8NA 4RSLA 4FK1A 4EQXA 3I6TA 3UOZA 2WDRA 4DGKA 4ECHA 1ONFA 1TZZA 4MKSA 2XLTA 1TYPA 2OZ3A 1JRXA 3SZFA 1MUCA 5CKUA 3UJRA 2BC0A 1NDAA 3AE4A 1F9CA 1VDVA 1H84A 3NRNA 4DHGA 4GDPA 1CJ4A 3SJNA 4AOSA 1CC6A 2OLNA 3VR9A 3TOYA 2FJEA 1TE6A 3OW1A 3A7UA 1UKVG 4Z43A 1LV0A 4EQWA 3MZNA 4I59A 3QFBA 3NK0X 4H4VA 3H7VA 1XPYA 2W55A 2OVLA 3TWAA 1MO9A 3ZVIA 1LPFA 3S5SA 2H88A 3JSKA 3THUA 3C96A 2BXSA 1DXLA 3I6EA 4DNAA 3H70A 2APGA 2QJJA 1Y56A 3GRSA 4TM0A 3MSYA 6ENLA 1V97A 1S3BA 3M0OA 1RM6B 2C73A 4IA5A 3ICTA 3UKAA 3UKLA 3QPEA 3AN1A 1NG4A 2XFNA 4BK2A 4GCMA 1TKKA 4U2TA 4NWZA 4Z24A 1NPXA 3Q6JA 4IV9A 4H2QA 3N4FA 5J7XA 2GEWA 1JROA 1H83A 3NGCX 1K0LA 2PCEA 3UKQA 2ONEA 1OJDA 2EQ9A 4DSHA 2AAQA 4UDRA 3OTRA 1PDZA 3SX6A 3SFDA 3AEFA 3QSMA 3AD9B 1GERA 1OEPA 3ZVHB 2GF3A 4GISA 2GR1A 2AL1A 3ZDNA 3OPSA 3KD9A 1COYA 4A9WA 2ARDA 2BA9A 1BQGA 2BS2A 3DIPA 1N4UA 3DFYA 3KPKA 4HNLA 1KDGA 2YR5A 1PJ5A 4X2PA 1IUWA 2F5ZA 3CNTA 2XVHA 1DJQA 2Y6RA 4J1OA 3T6CA 4OPTA 3AE9A 3NN0X 4JHMA 2B9WA 5IDZA 2BCPA 3RGTA 1ZKQA 1F6MA 1NG3A 4YSZA 1KFYA 3I3LA 3IWAA 3P1WA 1PBCA 2OALA 4H4RA 1TDOA 1KN0A 3ZLFA 3SQSA 3IJLA 3DEQA 2XYOA 1EBGA 2R45A 3P9UA 1N61C 4YKGA 3F8RA 3DG7A 4K2SA 3IC9A 3N6JA 3EAOA 1KNPA 3G5SA 2OG9A 4C5OA 3V5CA 1O94A 2ZBWA 4NTCA 5C2TA 3FPZA 4YSHA 3SY4A 1IUTA 2QVHA 1K0IA 3N6HA 2E1MA 2WQYA 4ZOHB 3ZLHA 5JCLA 3CT2A 1BKHA 3ICSA 3G5RA 2V3AA 3L1RA 3DK9A 4C3XA 1O95A 2AKZA 3ENLA 1B8SA 2XLSA 2PPGA 3QVRA 4EWJA 1IUSA 4JY2A 3UTHA 4Z17A 3ES8A 3IF9A 1NAAA 3P3BA 3URHA 1TRBA 1JU2A 4GR1A 5ER0A 1FEAA 3PG6A 3SN4A 1DNCA 4BJZA 3NXLA 2E5VA 3ES7A 2WOWA 3OZYA 2OQHA 3ALLA 3BNUA 3H8AA 3GYXA 2X99A 2XFPA 4U8MA 3DH9A 4E4UA 4OPLA 4JDRA 2GV8A 4LU6A 3NHOX 3L5OA 2B9XA 5U25A 4B1BA 2XFQA 2C64A 4A99A 3H4KA
chains in the Genus database with same CATH topology
4ZCCA 5U63A 3AECA 4CCQA 4H4SA 3ALJA 4ADWA 1EL8A 1GOSA 4U8JA 2OLOA 4J36A 4EIPA 2ZZCA 1B37A 3NTDA 1GESA 3LZXA 1CF3A 2YLTA 4NTDA 5GRTA 1CJ3A 4EMJA 4A6NA 3RP8A 4J34A 2B7RA 4CBQA 1GT8A 1LQTA 3RP6A 3AEAA 5L46A 2C75A 4JN9A 4K5SA 3VRBA 2XFOA 4HB9A 4H4WA 1VG0A 4B67A 1IUUA 2YG3A 4GAPA 1NHPA 3AXBA 2GAGB 2YQUA 3NKSA 4OPGA 3UKHA 2XFUA 1SEZA 3SM8A 4A5LA 3K7QX 4YSYA 4J57A 1E39A 4A7AA 2FJBA 2BS3A 2RGHA 3D1CA 3GYJA 4WX1A 2X50A 1S3EA 3WE0A 4Z25A 2WP6A 2YR4A 1XANA 3B6DA 3NK2X 3DK8A 5KMPA 3LXDA 5IQ1A 3H8IA 4OCGA 1ZY8A 3BHFA 3KPFA 2EQ8A 1FL2A 2WDQA 4Z26A 3UTGA 3V3OA 4YTPA 3T2ZA 2YLWA 3AEBA 3T37A 4HA6A 1N1PA 3O0HA 1GRTA 1YQ3A 1JRYA 2PHHA 5FS8A 3CGCA 4OPCA 4D04A 1JRZA 5KRQA 2CFYA 3ITJA 4H7UA 2IIDA 4BV6A 2GR2A 3CGEA 2WS3A 3AEGA 2JKCA 3GSIA 5KNLA 1NENA 5FMHA 1CJCA 2YVGA 4II3A 4A65A 1CC4A 5JCKA 4YTMA 3NNEA 3SQPA 3PO7A 1LQUA 3CPHG 1E1LA 4KX6A 3SYIA 4OPIA 3V76A 3FG2P 3SFEA 4Z2UA 2YLZA 4FDCB 4TM4A 3NN6X 3ALMA 1RYIA 1EL7A 2X8HA 1S2QA 2V5ZA 4Z2TA 2YVJA 1PS9A 5FS9A 2OAMA 4USQA 1YQZA 4O5QA 4A79A 1GETA 1BKWA 4K5RA 2R0CA 4YWOA 4H4QA 1E1KA 2C4CA 3H8LA 3SZ0A 3T14A 3NT6A 1NEKA 3EANA 4PAAA 1ZOVA 1FEBA 4H4XA 5BVAA 1ZP0A 1GPEA 4X9MA 4BJYA 5HYMA 2B9YA 4XWZA 4BK3A 4H4ZA 3COXA 1TDNA 4C77A 4U8LA 3CTYA 4Y4MA 1MXTA 3AEDA 4YT0A 2WBAA 1D5TA 2Z5YA 2WPFA 4ICYA 1OJ9A 3AE8A 5KMRA 1P2HA 1RSGA 1QLBA 4CCRA 1VRQB 3FBSA 3AE2A 4N9XA 5M0ZA 1CC2A 4G9KA 2IVDA 3T0KA 3ADAB 1O5WA 3CN8A 2V61A 5FS6A 2VRLA 4K2XA 5GSNA 2JB3A 3NYEA 3SXIA 4ZN0A 2XVFA 1GNDA 1BGNA 3NYFA 1BF3A 4JY3A 4UDPA 3CPIG 5EBKA 4X4JA 2C65A 1NHQA 4D03A 1ZOYA 1D4DA 1H82A 3EF6A 4A6NB 4B63A 2XVIA 4CNKA 1QO8A 3NH3X 4J31A 2C72A 3BI4A 1D4CA 5EB4A 3UKKA 3VQRA 1CBOA 2XVJA 2A8XA 3KU9A 4B69A 3QJ4A 4J56A 1Y56B 4U8NA 5BULA 2BRAA 1F8RA 4RSLA 1JOAA 4GRTA 4XWRA 1H2IA 2O9ZA 4FK1A 3SGLA 2YM1A 4BURA 2NPXA 4EQXA 2WPEA 2RGJA 4IA6A 4B64A 3UOZA 2WDRA 2WOVA 1OJAA 1H7WA 4DGKA 3G5QA 1S2YA 2GR3A 2C70A 4ECHA 4AT2A 4TLZA 1N4WA 1DJNA 3BI2A 1PBBA 5EB5A 3E1TA 1ONFA 2EQ6A 1BWCA 2XLTA 4K22A 1TYPA 1GEUA 1CHUA 2XDOA 5IQ4A 2YG6A 4NTEA 4X9NA 5C3JA 1NHSA 3HYWA 1JRXA 4U8IA 3SZFA 5CKUA 3QSSA 1NHRA 2YM2A 3QSEA 4B68A 4AT0A 2IVEA 1JNRA 4EM4A 3GWDA 1EBDA 1PXBA 2FBWA 4REKA 2BC0A 1NDAA 1IUXA 3AE4A 4PABA 3P4SA 2BK4A 4OPDA 3V3NA 2Z5XA 1GRBA 1H84A 3NRNA 3AD7B 1GTEA 1CJ2A 3BHKA 3UTEA 2BXRA 1LTXR 1L9EA 2C7GA 4GDPA 4B65A 2WDVA 3ISHA 3DGHA 1JNZA 3AE7A 4UP3A 3S61A 5HY5A 1ZX9A 1CJ4A 1D4EA 2C67A 2C3CA 4AOSA 3M13A 1CC6A 2OLNA 3P4RA 4KPRA 3VR9A 2YG4A 1PXAA 1VQWA 3GYIA 2FJEA 3ATRA 3ATQA 2XLRA 4O5UA 1UKVG 4H2NA 1GV4A 3DGZA 1PN0A 2CVJA 4Z43A 3EPTA 1KF6A 1LV0A 4EQWA 4I59A 2H89A 3QFBA 3NK0X 5U1OA 4H4VA 1PBDA 2BYBA 1LVLA 3NK1X 1MO9A 3CNDA 2GRTA 1LPFA 3AYLA 3AE3A 2JK6A 1VDCA 2Q0LA 1Q1RA 2H88A 3NTAA 4NNJA 1ZMDA 3JSKA 3C96A 2BXSA 4J33A 3HYVA 3C4AA 1DXLA 4DNAA 2APGA 4U8KA 1F8SA 4AOXA 1Y56A 2XLPA 3C4NA 3DJDA 4C3YA 3GRSA 5BRTA 2BRYA 1PXCA 4EIQA 2YLSA 4TM0A 5JRBA 2BACA 1S3BA 3M0OA 5KWFA 1CL0A 1REOA 3ZYXA 2FJDA 2C73A 4IA5A 3ICTA 3UKAA 1ZK7A 3UKLA 2RABA 3OC4A 4U2SA 1ELIA 5EOWA 4UDQA 3AD8B 3K7TA 1NG4A 3IHGA 1IUVA 1PDHA 2J3NA 2XFNA 4BK2A 4TLXA 4GCMA 3ICRA 4I58A 5HHFA 1E1NA 3CNPA 3LB8A 4GDEA 4U2TA 2YR6A 4NWZA 2FJAA 2EQ7A 2Q6UA 4Z24A 1NPXA 3Q6JA 4IV9A 3GDPA 4H2QA 3F8DA 2QCUA 3UOYA 3DJJA 1S7MA 1KSSA 1LJ1A 5J7XA 4YSXA 2GH5A 4EMWA 3UKFA 4U8PA 2GEWA 3DJGX 1H83A 5KXJA 1Q9IA 2TPRA 3NGCX 3AE6A 3AYJA 1K0LA 3CGBA 4H4PA 2ACZA 2VQBA 4WCTA 4RG4A 2DKHA 3UKQA 2ZZ0A 4H4TA 4DSGA 3HYXA 1PBEA 5KOWA 2YG7A 1OJDA 1F8WA 2EQ9A 2R4JA 3NIXA 2ZZBA 4DSHA 2NVKX 4U2LA 2AAQA 3RNMA 4UDRA 3M12A 2GQWA 1P2EA 4G6HA 3SX6A 1GXFA 4J2WA 2X8GA 3SFDA 3AEFA 3HZLA 4C74A 1GREA 2WP5A 1MOKA 4FK1C 3RP7A 1M6IA 3QSMA 1X31B 1FECA 3AD9B 4Y4LA 3GD3A 2HQMA 5LV9A 2WU5A 3PVCA 1H6VA 4XXGA 1F3PA 1GERA 1D7LA 3K30A 2GF3A 2RGOA 4RG3A 2BCGG 3L8KA 2GR0A 2GR1A 2V60A 3GD4A 4H2PA 3II4A 3ZDNA 3KD9A 1GRGA 2V6OA 5KVIA 1COYA 2ARDA 4OVIA 4USRA 4A9WA 2BA9A 4G74A 1RP0A 4CY8A 3NLCA 2JB1A 2X3NA 1B4VA 2Q0KA 5JCMA 4K7ZA 2JB2A 2BS2A 3BI5A 2XLUA 3CIRA 1FCDA 4IVOB 1YQ4A 3UP4A 1ZDLA 1DOEA 1N4UA 2V3BA 3FIMB 5KMSA 4II2A 4EM3A 4BK1A 2YAUA 3GDNA 3KKJA 3KLJA 3KPKA 5J60A 5JCIA 3VRDB 3AE1A 4Z2RA 4P9SA 1KDGA 2YR5A 3CMMA 4JNQA 1VG9A 3UKPA 4Z44A 1YY5A 4LA1A 1PJ5A 4TM3A 1PJ6A 3BNMA 3DMEA 1IUWA 2F5ZA 2WP9A 2XVHA 3CNTA 5BUKA 2YLRA 3CPJG 1DJQA 2Y6RA 2QA1A 2Y6QA 5KVHA 1B5QA 4OPTA 5JCNA 2JBVA 3AE9A 2QAEA 1GTHA 3LOVA 3NN0X 3I6DA 2YLXA 1E7PA 1E1MA 2B9WA 1TDKA 2R0PA 4EQRA 4NZHA 1M64A 2BCPA 1KNRA 1ZKQA 2YVFA 5CQFA 1F6MA 3VR8A 2BK5A 1NG3A 3UOVA 1KSUA 4YSZA 1XPQA 4M52A 1KFYA 2VQ7A 2VVLG 3REDA 4K8DA 3I3LA 1GRAA 2WHDA 2GMHA 3IWAA 3P1WA 4YKFA 2WPCA 1PBCA 2OALA 4H4RA 1L9CA 2VRMA 4G6GA 2R46A 2C66A 1TDOA 1KN0A 4MJWA 2Q7VA 4B66A 1Z6LA 4LIIA 3CNSA 1JEHA 1FOHA 3ABVA 2YWLA 4H4UA 2XYOA 1K0JA 4YTNA 4JQ9A 2R45A 4CRTA 3P9UA 4APNA 4YKGA 3NYCA 2QA2A 3F8RA 3GRTA 1Q1WA 4NEWA 3OZ2A 1H81A 3B3RA 3IC9A 2A89A 3QVPA 3EAOA 1H86A 4FX9A 1KNPA 3AYIA 2B76A 3G5SA 1PJ7A 2X8CA 4YXDA 1YKJA 4C5OA 2BK3A 1PHHA 1O94A 2ZBWA 3LJPA 4NTCA 5C2TA 3RHAA 2XCGA 2DKIA 3KA7A 3PS9A 4ZCDA 1K4QA 2YG5A 3FPZA 3K7MX 5FS7A 1EL5A 1BZLA 3CNJA 3LZWA 4GAVA 3SY4A 4YSHA 1IUTA 4GF7A 3QFAA 1K0IA 2VOUA 2E1MA 2WQYA 2PYXA 4H2RA 1XDIA 2B7SA 5JCLA 3S5WA 2AR8A 3LADA 2JAEA 4H50A 5TR3A 3D8XA 3ICSA 3G5RA 2WOIA 4EMIA 3R9UA 3SZWA 2V3AA 4H4YA 3L1RA 4TM1A 2BC1A 3DK9A 3Q9TA 4C3XA 1O95A 2UZZA 3P4PA 3VRAA 2R4EA 2A87A 3GMCA 4GUVA 3T2YA 1B8SA 2C76A 2XLSA 1XHCA 1Y0PA 4NEVA 3DK4A 2VVMA 3QVRA 3GMBA 2WEUA 3FMWA 3SZCA 1IUSA 4IVMB 4JY2A 3UTHA 2CDUA 2R0GA 1DODA 2WETA 4CNJA 5KMQA 1H7XA 3IF9A 4JNAA 1NAAA 2VZ2A 1TYTA 3CGDA 3URHA 1JU2A 1TDEA 1TRBA 1TDFA 2C3DA 1HYUA 2GQFA 2R9ZA 3D9XA 4AP1A 1GRFA 1L0VA 4G73A 4GR1A 1DOCA 5ER0A 4OPUA 1FEAA 3PG6A 3DJEA 2XVEA 1DNCA 1ZMCA 3AB1A 2E5VA 3UCLA 4BJZA 1N4VA 1EL9A 3UOXA 2WOWA 2E4GA 3AWIA 5IPYA 4EQSA 1OJCA 2GB0A 2W0HA 5KOXA 2I0ZA 1L9DA 3AE5A 3ALLA 2GAHB 1BGJA 5M10A 3AEEA 1GRHA 1W4XA 2WESA 3BNUA 3DA1A 1DOBA 1GALA 3GYXA 2GVCA 2X99A 3NG7X 4Y4NA 2XFPA 5HXIA 1GSNA 4U8MA 3UTFA 3DH9A 2GMJA 3F8PA 4OPLA 1IJHA 2WU2A 4JDRA 2VVLA 1D7YA 2AQJA 2GV8A 3T31A 3UP5A 4CY6A 3GWFA 2OA1A 1V59A 1PBFA 4LU6A 1E6EA 4AP3A 2BABA 3NHOX 3L5OA 2B9XA 2TMDA 5DBJA 5U25A 4B1BA 3P4QA 3KVEA 2XFQA 1OJTA 1QJDA 1AOGA 2CULA 4U8OA 4E0VA 3IHMA 2C64A 4A99A 3T2KA 2BS4A 3H4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCC A;  5U63 A;  3AEC A;  4CCQ A;  4H4S A;  3ALJ A;  4ADW A;  1EL8 A;  1GOS A;  4U8J A;  2OLO A;  4J36 A;  4EIP A;  2ZZC A;  1B37 A;  3NTD A;  1GES A;  3LZX A;  1CF3 A;  2YLT A;  4NTD A;  5GRT A;  1CJ3 A;  4EMJ A;  4A6N A;  3RP8 A;  4J34 A;  2B7R A;  4CBQ A;  1GT8 A;  1LQT A;  3RP6 A;  3AEA A;  5L46 A;  2C75 A;  4JN9 A;  4K5S A;  3VRB A;  2XFO A;  4HB9 A;  4H4W A;  1VG0 A;  4B67 A;  1IUU A;  2YG3 A;  1NHP A;  3AXB A;  2GAG B;  2YQU A;  3NKS A;  4OPG A;  3UKH A;  2XFU A;  1SEZ A;  3SM8 A;  4A5L A;  3K7Q X;  4YSY A;  4J57 A;  1E39 A;  4A7A A;  2FJB A;  2BS3 A;  2RGH A;  3D1C A;  3GYJ A;  4WX1 A;  2X50 A;  1S3E A;  3WE0 A;  4Z25 A;  2WP6 A;  2YR4 A;  1XAN A;  3B6D A;  3NK2 X;  3DK8 A;  3LXD A;  5IQ1 A;  3H8I A;  4OCG A;  1ZY8 A;  3BHF A;  3KPF A;  2EQ8 A;  1FL2 A;  2WDQ A;  4Z26 A;  3UTG A;  3V3O A;  4YTP A;  2YLW A;  3AEB A;  3T37 A;  4HA6 A;  1N1P A;  3O0H A;  1GRT A;  1YQ3 A;  1JRY A;  2PHH A;  5FS8 A;  3CGC A;  4OPC A;  4D04 A;  1JRZ A;  5KRQ A;  2CFY A;  3ITJ A;  4H7U A;  2IID A;  4BV6 A;  2GR2 A;  3CGE A;  2WS3 A;  3AEG A;  2JKC A;  3GSI A;  1NEN A;  5FMH A;  1CJC A;  2YVG A;  4A65 A;  1CC4 A;  5JCK A;  4YTM A;  3NNE A;  3SQP A;  3PO7 A;  1LQU A;  3CPH G;  1E1L A;  4KX6 A;  3V76 A;  4OPI A;  3FG2 P;  3SFE A;  4Z2U A;  2YLZ A;  4FDC B;  4TM4 A;  3NN6 X;  3ALM A;  1RYI A;  1EL7 A;  2X8H A;  1S2Q A;  2V5Z A;  4Z2T A;  2YVJ A;  1PS9 A;  5FS9 A;  2OAM A;  4USQ A;  1YQZ A;  4O5Q A;  4A79 A;  1GET A;  1BKW A;  4K5R A;  2R0C A;  4YWO A;  4H4Q A;  1E1K A;  3H8L A;  3NT6 A;  1NEK A;  3EAN A;  4PAA A;  1ZOV A;  1FEB A;  4H4X A;  5BVA A;  1ZP0 A;  1GPE A;  4X9M A;  4BJY A;  5HYM A;  2B9Y A;  4XWZ A;  4BK3 A;  4H4Z A;  3COX A;  1TDN A;  4C77 A;  4U8L A;  3CTY A;  4Y4M A;  1MXT A;  3AED A;  4YT0 A;  2WBA A;  1D5T A;  2Z5Y A;  2WPF A;  4ICY A;  1OJ9 A;  3AE8 A;  1P2H A;  1RSG A;  1QLB A;  4CCR A;  1VRQ B;  3FBS A;  3AE2 A;  4N9X A;  5M0Z A;  1CC2 A;  2IVD A;  3ADA B;  1O5W A;  3CN8 A;  2V61 A;  5FS6 A;  2VRL A;  4K2X A;  5GSN A;  2JB3 A;  3NYE A;  4ZN0 A;  2XVF A;  1GND A;  1BGN A;  3NYF A;  1BF3 A;  4JY3 A;  4UDP A;  3CPI G;  5EBK A;  4X4J A;  2C65 A;  1NHQ A;  4D03 A;  1ZOY A;  1D4D A;  1H82 A;  3EF6 A;  4A6N B;  4B63 A;  2XVI A;  4CNK A;  1QO8 A;  3NH3 X;  4J31 A;  2C72 A;  3BI4 A;  1D4C A;  5EB4 A;  3UKK A;  3VQR A;  1CBO A;  2XVJ A;  2A8X A;  3KU9 A;  4B69 A;  3QJ4 A;  4J56 A;  1Y56 B;  4U8N A;  5BUL A;  1F8R A;  4RSL A;  1JOA A;  4GRT A;  4XWR A;  2O9Z A;  4FK1 A;  3SGL A;  2YM1 A;  4BUR A;  2NPX A;  4EQX A;  2WPE A;  2RGJ A;  4IA6 A;  4B64 A;  3UOZ A;  2WDR A;  2WOV A;  1OJA A;  1H7W A;  4DGK A;  3G5Q A;  1S2Y A;  2GR3 A;  2C70 A;  4ECH A;  4AT2 A;  4TLZ A;  1N4W A;  1DJN A;  3BI2 A;  1PBB A;  5EB5 A;  3E1T A;  1ONF A;  2EQ6 A;  1BWC A;  2XLT A;  4K22 A;  1TYP A;  1GEU A;  1CHU A;  2XDO A;  5IQ4 A;  2YG6 A;  4NTE A;  4X9N A;  5C3J A;  1NHS A;  4U8I A;  1JRX A;  5CKU A;  3QSS A;  1NHR A;  2YM2 A;  3QSE A;  4B68 A;  4AT0 A;  2IVE A;  1JNR A;  4EM4 A;  3GWD A;  1EBD A;  1PXB A;  2FBW A;  4REK A;  2BC0 A;  1NDA A;  1IUX A;  3AE4 A;  4PAB A;  3P4S A;  2BK4 A;  4OPD A;  3V3N A;  2Z5X A;  1GRB A;  1H84 A;  3NRN A;  3AD7 B;  1GTE A;  1CJ2 A;  3BHK A;  3UTE A;  2BXR A;  1LTX R;  1L9E A;  2C7G A;  4GDP A;  4B65 A;  2WDV A;  3ISH A;  3DGH A;  1JNZ A;  3AE7 A;  4UP3 A;  3S61 A;  5HY5 A;  1ZX9 A;  1CJ4 A;  1D4E A;  2C67 A;  2C3C A;  4AOS A;  3M13 A;  1CC6 A;  2OLN A;  3P4R A;  4KPR A;  3VR9 A;  2YG4 A;  1PXA A;  1VQW A;  3GYI A;  2FJE A;  3ATR A;  3ATQ A;  2XLR A;  4O5U A;  1UKV G;  4H2N A;  1GV4 A;  3DGZ A;  1PN0 A;  2CVJ A;  4Z43 A;  3EPT A;  1KF6 A;  1LV0 A;  4EQW A;  4I59 A;  2H89 A;  3QFB A;  3NK0 X;  5U1O A;  4H4V A;  1PBD A;  2BYB A;  1LVL A;  3NK1 X;  1MO9 A;  3CND A;  2GRT A;  1LPF A;  3AYL A;  3AE3 A;  2JK6 A;  1VDC A;  2Q0L A;  1Q1R A;  2H88 A;  3NTA A;  1ZMD A;  3JSK A;  3C96 A;  2BXS A;  4J33 A;  5IPY A;  3C4A A;  1DXL A;  4DNA A;  2APG A;  4U8K A;  1F8S A;  4AOX A;  1Y56 A;  2XLP A;  3C4N A;  3DJD A;  4C3Y A;  3GRS A;  5BRT A;  1PXC A;  4EIQ A;  2YLS A;  4TM0 A;  2BAC A;  1S3B A;  3M0O A;  5KWF A;  1CL0 A;  1REO A;  3ZYX A;  2FJD A;  2C73 A;  4IA5 A;  3ICT A;  3UKA A;  1ZK7 A;  3UKL A;  2RAB A;  3OC4 A;  4U2S A;  1ELI A;  5EOW A;  4UDQ A;  3AD8 B;  3K7T A;  1NG4 A;  3IHG A;  1IUV A;  1PDH A;  2J3N A;  2XFN A;  4BK2 A;  4TLX A;  4GCM A;  3ICR A;  4I58 A;  5HHF A;  1E1N A;  3CNP A;  3LB8 A;  4GDE A;  4U2T A;  2YR6 A;  2FJA A;  2EQ7 A;  2Q6U A;  4Z24 A;  1NPX A;  3Q6J A;  4IV9 A;  3GDP A;  4H2Q A;  3F8D A;  2QCU A;  3UOY A;  3DJJ A;  1KSS A;  1LJ1 A;  5J7X A;  4YSX A;  2GH5 A;  4EMW A;  3UKF A;  4U8P A;  2GEW A;  3DJG X;  1H83 A;  5KXJ A;  1Q9I A;  2TPR A;  3NGC X;  3AE6 A;  3AYJ A;  1K0L A;  3CGB A;  4H4P A;  2ACZ A;  2VQB A;  4WCT A;  4RG4 A;  2DKH A;  3UKQ A;  2ZZ0 A;  4H4T A;  4DSG A;  5KOW A;  1PBE A;  2YG7 A;  1OJD A;  1F8W A;  2EQ9 A;  2R4J A;  3NIX A;  2ZZB A;  4DSH A;  2NVK X;  4U2L A;  2AAQ A;  3RNM A;  4UDR A;  3M12 A;  2GQW A;  1P2E A;  1GXF A;  4J2W A;  2X8G A;  3SFD A;  3AEF A;  3HZL A;  4C74 A;  1GRE A;  2WP5 A;  1MOK A;  4FK1 C;  3RP7 A;  1M6I A;  3QSM A;  1X31 B;  1FEC A;  3AD9 B;  4Y4L A;  3GD3 A;  2HQM A;  5LV9 A;  2WU5 A;  3PVC A;  1H6V A;  4XXG A;  1F3P A;  1GER A;  1D7L A;  3K30 A;  2GF3 A;  2RGO A;  4RG3 A;  2BCG G;  3L8K A;  2GR0 A;  2GR1 A;  2V60 A;  3GD4 A;  4H2P A;  3II4 A;  3ZDN A;  3KD9 A;  1GRG A;  2V6O A;  5KVI A;  1COY A;  2ARD A;  4OVI A;  4USR A;  4A9W A;  2BA9 A;  4CY8 A;  1RP0 A;  3NLC A;  2JB1 A;  2X3N A;  1B4V A;  2Q0K A;  5JCM A;  4K7Z A;  2JB2 A;  2BS2 A;  3BI5 A;  2XLU A;  3CIR A;  1FCD A;  4IVO B;  1YQ4 A;  3UP4 A;  1ZDL A;  1DOE A;  1N4U A;  2V3B A;  3FIM B;  4EM3 A;  4BK1 A;  2YAU A;  3GDN A;  3KKJ A;  3KLJ A;  5J60 A;  5JCI A;  3VRD B;  3AE1 A;  4Z2R A;  4P9S A;  1KDG A;  2YR5 A;  4JNQ A;  1VG9 A;  3UKP A;  4Z44 A;  1YY5 A;  4LA1 A;  1PJ5 A;  4TM3 A;  1PJ6 A;  3BNM A;  3DME A;  1IUW A;  2F5Z A;  2WP9 A;  2XVH A;  3CNT A;  5BUK A;  2YLR A;  3CPJ G;  1DJQ A;  2Y6R A;  2QA1 A;  2Y6Q A;  5KVH A;  1B5Q A;  4OPT A;  5JCN A;  2JBV A;  3AE9 A;  2QAE A;  1GTH A;  3LOV A;  3NN0 X;  3I6D A;  2YLX A;  1E7P A;  1E1M A;  2B9W A;  1TDK A;  2R0P A;  4EQR A;  4NZH A;  1M64 A;  2BCP A;  1KNR A;  1ZKQ A;  2YVF A;  5CQF A;  1F6M A;  3VR8 A;  2BK5 A;  1NG3 A;  3UOV A;  1KSU A;  4YSZ A;  1XPQ A;  4M52 A;  1KFY A;  2VQ7 A;  2VVL G;  3RED A;  4K8D A;  3I3L A;  1GRA A;  2WHD A;  2GMH A;  3IWA A;  3P1W A;  4YKF A;  2WPC A;  1PBC A;  2OAL A;  4H4R A;  1L9C A;  2VRM A;  2R46 A;  2C66 A;  1TDO A;  4MJW A;  2Q7V A;  4B66 A;  1Z6L A;  4LII A;  3CNS A;  1JEH A;  1FOH A;  3ABV A;  2YWL A;  4H4U A;  2XYO A;  1K0J A;  4YTN A;  4JQ9 A;  2R45 A;  4CRT A;  3P9U A;  4APN A;  4YKG A;  3NYC A;  2QA2 A;  3F8R A;  3GRT A;  1Q1W A;  4NEW A;  3OZ2 A;  1H81 A;  3B3R A;  3IC9 A;  2A89 A;  3QVP A;  3EAO A;  1H86 A;  4FX9 A;  1KNP A;  3AYI A;  2B76 A;  3G5S A;  1PJ7 A;  2X8C A;  4YXD A;  1YKJ A;  4C5O A;  2BK3 A;  1PHH A;  1O94 A;  2ZBW A;  3LJP A;  4NTC A;  5C2T A;  3RHA A;  2XCG A;  2DKI A;  3KA7 A;  3PS9 A;  4ZCD A;  1K4Q A;  2YG5 A;  3FPZ A;  3K7M X;  5FS7 A;  1EL5 A;  1BZL A;  3CNJ A;  3LZW A;  4YSH A;  1IUT A;  4GF7 A;  3QFA A;  1K0I A;  2VOU A;  2E1M A;  2WQY A;  2PYX A;  4H2R A;  1XDI A;  2B7S A;  5JCL A;  3S5W A;  2AR8 A;  3LAD A;  2JAE A;  4H50 A;  5TR3 A;  3D8X A;  3ICS A;  3G5R A;  2WOI A;  4EMI A;  3R9U A;  4H4Y A;  2V3A A;  3L1R A;  4TM1 A;  2BC1 A;  3DK9 A;  3Q9T A;  4C3X A;  1O95 A;  2UZZ A;  3P4P A;  3VRA A;  2R4E A;  2A87 A;  3GMC A;  4GUV A;  1B8S A;  2C76 A;  2XLS A;  1XHC A;  1Y0P A;  4NEV A;  3DK4 A;  2VVM A;  3QVR A;  3GMB A;  2WEU A;  3FMW A;  1IUS A;  4IVM B;  4JY2 A;  3UTH A;  2CDU A;  2R0G A;  1DOD A;  2WET A;  4CNJ A;  1H7X A;  3IF9 A;  4JNA A;  1NAA A;  2VZ2 A;  1TYT A;  3CGD A;  3URH A;  1JU2 A;  1TDE A;  1TRB A;  1TDF A;  2C3D A;  1HYU A;  2GQF A;  2R9Z A;  4AP1 A;  1GRF A;  1L0V A;  4GR1 A;  1DOC A;  5ER0 A;  4OPU A;  1FEA A;  3DJE A;  2XVE A;  1DNC A;  1ZMC A;  3AB1 A;  2E5V A;  3UCL A;  4BJZ A;  1N4V A;  1EL9 A;  3UOX A;  2WOW A;  2E4G A;  3AWI A;  4EQS A;  1OJC A;  2GB0 A;  2W0H A;  5KOX A;  2I0Z A;  1L9D A;  3AE5 A;  3ALL A;  2GAH B;  1BGJ A;  5M10 A;  3AEE A;  1GRH A;  1W4X A;  2WES A;  3BNU A;  3DA1 A;  1DOB A;  1GAL A;  4Y4N A;  2GVC A;  2X99 A;  3NG7 X;  2XFP A;  5HXI A;  1GSN A;  4U8M A;  3UTF A;  3DH9 A;  2GMJ A;  3F8P A;  4OPL A;  1IJH A;  2WU2 A;  4JDR A;  2VVL A;  1D7Y A;  2AQJ A;  2GV8 A;  3UP5 A;  4CY6 A;  3GWF A;  2OA1 A;  1V59 A;  1PBF A;  4LU6 A;  1E6E A;  4AP3 A;  2BAB A;  3NHO X;  2B9X A;  2TMD A;  5DBJ A;  5U25 A;  4B1B A;  3P4Q A;  3KVE A;  2XFQ A;  1OJT A;  1QJD A;  1AOG A;  2CUL A;  4U8O A;  4E0V A;  3IHM A;  2C64 A;  4A99 A;  2BS4 A;  3H4K A; 
#chains in the Genus database with same CATH topology
 3AEC A;  2GGI A;  4Z1Y A;  4U8J A;  3PWG A;  1GT8 A;  4JN9 A;  3S47 A;  3EUB 3;  2XFO A;  1VG0 A;  1IUU A;  3FVD A;  3Q45 A;  3CYJ A;  4YSY A;  4A7A A;  2RGH A;  1S3E A;  3JVA A;  1XAN A;  2OKT A;  5FJP A;  3V4B A;  1ZY8 A;  3PFR A;  4HA6 A;  1JRY A;  4G7F A;  2PHH A;  5FS8 A;  3CGC A;  4OPC A;  3ITJ A;  2IID A;  5KNL A;  2YVG A;  2W3S A;  4FI4 A;  3FCP A;  3I4K A;  4KX6 A;  3SYI A;  3QKE A;  2CHR A;  4FDC B;  3NN6 X;  4ROP A;  2QDD A;  1PS9 A;  5FS9 A;  2OAM A;  1YQZ A;  3HRD C;  4A79 A;  4YWO A;  3SZ0 A;  4ENL A;  1NEK A;  1FEB A;  3TW9 A;  1GPE A;  4X9M A;  2B9Y A;  1TDN A;  3CTY A;  1MXT A;  1JDF A;  1RVK A;  2Z5Y A;  1P2H A;  1QLB A;  4CCR A;  1VRQ B;  2P8B A;  3AE2 A;  4N9X A;  2V61 A;  2AKM A;  5EBK A;  2QJN A;  4KT2 A;  1JPD X;  3NH3 X;  3BI4 A;  1D4C A;  5EB4 A;  3VQR A;  3KU9 A;  4B69 A;  1SJB A;  3STP A;  1F8R A;  1JOA A;  1H2I A;  2O9Z A;  5M10 A;  3SGL A;  4B64 A;  1JRP A;  3G5Q A;  1S2Y A;  2GR3 A;  3DER A;  4JN8 A;  1N4W A;  3BI2 A;  5EB5 A;  3E1T A;  2EQ6 A;  5C3J A;  1NHS A;  4U8I A;  1NHR A;  2YM2 A;  3DES A;  2IVE A;  4EM4 A;  4J3Z A;  4JN7 A;  4PAB A;  2BK4 A;  3AD7 B;  1GTE A;  2BXR A;  1LTX R;  4B65 A;  2WDV A;  1JNZ A;  3S61 A;  3GO2 A;  1D4E A;  4KPR A;  3SN0 A;  3A7A A;  3ATR A;  5FJR A;  3DGZ A;  1KF6 A;  3A7R A;  2W54 A;  4KEM A;  2E3T A;  2PSN A;  3NTA A;  4NNJ A;  4U8K A;  3C4N A;  2XLP A;  3DJD A;  2BRY A;  1PXC A;  2YLS A;  3GC2 A;  5KWF A;  1CL0 A;  2FJD A;  1WUE A;  2NQL A;  1ELI A;  5EOW A;  4UDQ A;  3ICR A;  1P48 A;  4GDE A;  2YR6 A;  2XGZ A;  2FJA A;  2Q6U A;  3T8Q A;  3F8D A;  1KSS A;  4YSX A;  2GH5 A;  4U8P A;  3DJG X;  1Q9I A;  4DXK A;  2OO6 A;  3AYJ A;  3PK7 A;  3CGB A;  2ACZ A;  4DSG A;  5KOW A;  3P0W A;  1N63 C;  4TVW A;  2NVK X;  2GQW A;  4J2W A;  2X8G A;  3HZL A;  4C74 A;  3RP7 A;  1M6I A;  1NEL A;  3GD3 A;  2P88 A;  2HQM A;  2GSH A;  3PVC A;  1H6V A;  4XXG A;  3K30 A;  1D7L A;  4RG3 A;  2RGO A;  2BCG G;  2PTX A;  1MDR A;  4H2P A;  3II4 A;  4HPN A;  4CY8 A;  4OVI A;  1FO4 A;  1SJD A;  1R6W A;  3NLC A;  2JB1 A;  2X3N A;  1STZ A;  5JCM A;  2JB2 A;  2XLU A;  1X2G A;  4K1W A;  1YQ4 A;  5KMS A;  4EM3 A;  3KKJ A;  5JCI A;  4Z2R A;  4JNQ A;  3UKP A;  1YY5 A;  4TM3 A;  3T4W A;  2YLR A;  2QA1 A;  5KVH A;  5JCN A;  2JBV A;  2QAE A;  4YWS A;  2R0P A;  1TDK A;  4IHC A;  4NZH A;  1KNR A;  1M64 A;  2YVF A;  3VR8 A;  3P93 A;  2VVL G;  3RED A;  2VQ7 A;  4K8D A;  2WHD A;  2GMH A;  2WPC A;  4M6U A;  1L9C A;  3UCD A;  4G6G A;  4MJW A;  2Q7V A;  1JEH A;  1FOH A;  3ABV A;  2YWL A;  4H4U A;  4YTN A;  3NYC A;  1Q1W A;  3QN3 A;  1H81 A;  3QVP A;  1H86 A;  2B76 A;  2X8C A;  2GGE A;  3DFH A;  1YKJ A;  3LJP A;  3UJS A;  3OP2 A;  4GFI A;  3ETR B;  4IP4 A;  1BZL A;  3QFA A;  3S5W A;  2AR8 A;  4H50 A;  3D8X A;  4A6G A;  2WOI A;  2UZZ A;  3T2Y A;  3HW2 A;  1XHC A;  2WEU A;  4G8T A;  3D46 A;  5KMQ A;  3CGD A;  1TDE A;  4AP1 A;  1GRF A;  4G73 A;  1DOC A;  4OPU A;  2FKP A;  1ZMC A;  3UCL A;  1JCT A;  1N4V A;  2E4G A;  3AWI A;  4MGG A;  2GB0 A;  2GAH B;  3AEE A;  1W4X A;  3DA1 A;  1DOB A;  4DWD A;  3NG7 X;  3VC6 A;  5HXI A;  1GSN A;  3UTF A;  2GMJ A;  3ZYX A;  3F8P A;  1IJH A;  3UP5 A;  1D7Y A;  2MUC A;  3GWF A;  3P4Q A;  3KVE A;  1QJD A;  1AOG A;  4E0V A;  4K8G A;  3IHM A;  2BS4 A;  3CB3 A;  4H4S A;  4ADW A;  1GOS A;  3TCS A;  4A35 A;  1CJ3 A;  4EMJ A;  4A6N A;  4J34 A;  4CBQ A;  3FV9 A;  1LQT A;  3RP6 A;  3MWC A;  2C75 A;  3RRA A;  4GAP A;  3UKH A;  2P0I A;  3K7Q X;  1E39 A;  3UXL A;  2X50 A;  3WE0 A;  3BJS A;  3B6D A;  3TJ4 A;  3H8I A;  4OCG A;  3BHF A;  2EQ8 A;  3VCN A;  2WDQ A;  3V3O A;  3T2Z A;  3AEB A;  3T37 A;  2PTZ A;  3SN1 A;  1GRT A;  5G5G B;  2HNE A;  2PTW A;  3T9P A;  1JRZ A;  5KRQ A;  4BV6 A;  2GR2 A;  3GSI A;  2JKC A;  4II3 A;  1CC4 A;  4YTM A;  4E6M A;  3V5F A;  1LQU A;  1E1L A;  1E9I A;  5FJO A;  2YLZ A;  4HCH A;  1EL7 A;  4Z2T A;  1GET A;  3IK4 A;  1E1K A;  3T14 A;  3H8L A;  3EAN A;  1DTN A;  1ZOV A;  4PAA A;  4H4X A;  5HYM A;  4BJY A;  1SJC A;  3RO6 A;  3RCY A;  4BK3 A;  2OFJ A;  2WBA A;  4GIR A;  5M0Z A;  2IVD A;  3CN8 A;  5FS6 A;  4K2X A;  4F4R A;  3SXI A;  2XVF A;  1KKO A;  3NYF A;  1BF3 A;  2AL2 A;  3CXB A;  4X4J A;  4KWS A;  1VQZ A;  4J31 A;  2GGG A;  4IZG A;  2XVJ A;  2A8X A;  4J56 A;  1Y56 B;  4GRT A;  2YM1 A;  2RGJ A;  1OJA A;  1PDY A;  2C70 A;  5BOF A;  4AT2 A;  2I5Q A;  1PBB A;  5FJT A;  2XDO A;  5IQ4 A;  4NTE A;  3QSS A;  4AT0 A;  1JNR A;  3PWI A;  1PXB A;  4REK A;  3P4S A;  3UXK A;  3ISH A;  1ZX9 A;  2C67 A;  2C3C A;  3CAW A;  2YG4 A;  1PXA A;  1VQW A;  3GYI A;  2XLR A;  4H2N A;  3EPT A;  1FFU C;  1W6T A;  3SBF A;  3JW7 A;  1PBD A;  2BYB A;  1LVL A;  3NK1 X;  3NZG A;  1NU5 A;  3FJ4 A;  3AE3 A;  1VDC A;  4H1Z A;  3NO1 A;  4J33 A;  3HYV A;  5IPY A;  5BRT A;  1F8S A;  5JRB A;  3R0U A;  1REO A;  2PP3 A;  2PMQ A;  4HYR A;  1ZK7 A;  4U2S A;  4IL0 A;  1FIQ B;  3IHG A;  1IUV A;  4TLX A;  4I58 A;  3LB8 A;  3VA8 A;  2EQ7 A;  3UOY A;  3DJJ A;  1S7M A;  2ZC8 A;  4IT1 A;  1YEY A;  1IYX A;  3UKF A;  2VQB A;  4WCT A;  4RG4 A;  2DKH A;  2ZZ0 A;  3HYX A;  2YG7 A;  2R4J A;  3NIX A;  4U2L A;  3RNM A;  2QJM A;  3M12 A;  4G6H A;  1GXF A;  3UJE A;  2GDQ A;  2WP5 A;  1X31 B;  3MKC A;  5LV9 A;  2DW7 A;  3R25 A;  3L8K A;  3NVV B;  2GR0 A;  2V60 A;  1GRG A;  2V6O A;  4USR A;  4G74 A;  1RP0 A;  2Q0K A;  3BI5 A;  1XS2 A;  3CIR A;  2PGW A;  1FCD A;  4IVO B;  1ZDL A;  3U4F A;  2QGY A;  2V3B A;  3FIM B;  1MDL A;  2YAU A;  3KLJ A;  5J60 A;  3VRD B;  3AE1 A;  4DN1 A;  3H12 A;  3CMM A;  4Z44 A;  1PJ6 A;  3BNM A;  7ENL A;  2Y6Q A;  2PS2 A;  1GTH A;  3I6D A;  1E7P A;  1E1M A;  3R10 A;  4EQR A;  1KSU A;  1XPQ A;  2OLA A;  2POZ A;  3DDM A;  4HCL A;  2R46 A;  3BOX A;  1Z6L A;  3VC5 A;  3CNS A;  4TVY A;  3TWB A;  1K0J A;  4JQ9 A;  3QLD A;  4APN A;  2QA2 A;  3UCC A;  3SR6 B;  1R0M A;  3B3R A;  4FX9 A;  1PJ7 A;  4YXD A;  1PHH A;  2P8C A;  2XCG A;  2DKI A;  3KA7 A;  3PS9 A;  2YG5 A;  1EL5 A;  4GAV A;  4GGH A;  1SB3 B;  1XDI A;  3UJF A;  4FP1 A;  3NVW B;  4EMI A;  1SJA A;  4H4Y A;  2BC1 A;  3Q9T A;  3VRA A;  2R4E A;  2A87 A;  3GMC A;  4GUV A;  4HNC A;  2C76 A;  2VVM A;  3GMB A;  3SZC A;  4IVM B;  2FYM A;  5EU9 A;  2CDU A;  2R0G A;  2WET A;  1H7X A;  2AL2 B;  2VZ2 A;  1TDF A;  2GQF A;  2R9Z A;  3D9X A;  1L0V A;  2PA6 A;  3DJE A;  4M0X A;  3AB1 A;  1FHU A;  1EL9 A;  4EQS A;  4ZA0 A;  5KOX A;  1L9D A;  1BGJ A;  1GRH A;  3Q4D A;  1GAL A;  2GVC A;  3EEZ A;  4DYE A;  2WU2 A;  3T31 A;  2VVL A;  2AQJ A;  4CY6 A;  1PBF A;  1E6E A;  4AP3 A;  3R07 C;  1OJT A;  4U8O A;  4C77 A;  4ZCC A;  2W0H A;  5U63 A;  1JPM A;  1GES A;  3LZX A;  1CF3 A;  2YLT A;  5GRT A;  3RP8 A;  4H2H A;  3AEA A;  1KKR A;  4K5S A;  5L46 A;  1WUF A;  4H4W A;  3AXB A;  2GAG B;  4OPG A;  4A5L A;  2POD A;  2XFU A;  1SEZ A;  4J57 A;  3TQP A;  2FJB A;  1N5W C;  3D1C A;  3GYJ A;  2WP6 A;  1ONE A;  3NK2 X;  3DK8 A;  5KMP A;  2OX4 A;  5IQ1 A;  3KPF A;  1FL2 A;  3UTG A;  4YTP A;  2YLW A;  3O0H A;  1YQ3 A;  4D04 A;  2CFY A;  4H7U A;  2WS3 A;  5FMH A;  3B97 A;  5JCK A;  3NRZ B;  3NNE A;  3PO7 A;  3CPH G;  3V76 A;  2XH0 A;  3FG2 P;  3SFE A;  4Z2U A;  2PP0 A;  1RYI A;  1S2Q A;  4USQ A;  4GYP C;  4O5Q A;  4GGB A;  4H4Q A;  2C4C A;  3NT6 A;  2GGH A;  1ZP0 A;  1MNS A;  4H4Z A;  4U8L A;  4YT0 A;  1D5T A;  2WPF A;  1RSG A;  3FBS A;  3T0K A;  1CC2 A;  4G9K A;  3ADA B;  2GGJ A;  5GSN A;  1L8P A;  3NYE A;  4ZN0 A;  1GND A;  1BGN A;  4JY3 A;  4UDP A;  3CPI G;  2C65 A;  1NHQ A;  4D03 A;  4A6N B;  4B63 A;  1FHV A;  2XVI A;  3UKK A;  5BUL A;  2BRA A;  4XWR A;  1ECQ A;  4BUR A;  2NPX A;  2HXU A;  2WPE A;  4IA6 A;  2WOV A;  1H7W A;  3GD6 A;  4TLZ A;  1DJN A;  1BWC A;  4K22 A;  1CHU A;  1GEU A;  4E8G A;  2YG6 A;  4X9N A;  3HYW A;  4ZCW A;  4B68 A;  3QSE A;  3GWD A;  1EBD A;  3AM9 A;  2FBW A;  1IUX A;  1ZXI C;  3V3N A;  4OPD A;  2Z5X A;  1GRB A;  1CJ2 A;  2PU1 A;  3BHK A;  3UTE A;  1L9E A;  4GME A;  2C7G A;  3DGH A;  3AE7 A;  4UP3 A;  5HY5 A;  5BOE A;  3M13 A;  3P4R A;  2PU0 A;  3ATQ A;  4O5U A;  1GV4 A;  1PN0 A;  2CVJ A;  2OZ8 A;  2H89 A;  5U1O A;  2MNR A;  3TTE A;  3R1Z A;  3CND A;  2GRT A;  3AYL A;  2JK6 A;  2Q0L A;  1Q1R A;  3NS1 B;  1ZMD A;  2P3Z A;  3C4A A;  4AOX A;  4C3Y A;  4EIQ A;  2BAC A;  3FYY A;  2RAB A;  3OC4 A;  3R11 A;  2QQ6 A;  3AD8 B;  1P43 A;  3K7T A;  1PDH A;  2J3N A;  5HHF A;  1E1N A;  3CNP A;  3IJI A;  3GDP A;  2QCU A;  1EC8 A;  1LJ1 A;  4EMW A;  5KXJ A;  2HXT A;  2TPR A;  3AE6 A;  4H4P A;  2QDE A;  4H4T A;  3N4E A;  3BSM A;  1PBE A;  1F8W A;  2ZZB A;  4H19 A;  1P2E A;  5G5H B;  3MQT A;  1GRE A;  4FK1 C;  1MOK A;  1FEC A;  4Y4L A;  2WU5 A;  1F3P A;  3B9J B;  3DG3 A;  3GD4 A;  2W3R A;  5KVI A;  2OQY A;  3IJQ A;  2XH2 A;  1B4V A;  4K7Z A;  1KCZ A;  1DOE A;  3UP4 A;  2DW6 A;  4DX3 A;  2PTY A;  4IL2 A;  4II2 A;  4BK1 A;  3GDN A;  4P9S A;  4H83 A;  1VG9 A;  3OZM A;  4LA1 A;  1T3Q C;  3U9I A;  3DME A;  2WP9 A;  5BUK A;  3CPJ G;  1B5Q A;  3LOV A;  2YLX A;  3DGB A;  5ENL A;  5CQF A;  2BK5 A;  3UOV A;  4M52 A;  1GRA A;  3NVZ B;  3CXO A;  3FXG A;  4YKF A;  2VRM A;  4E4F A;  2XSX A;  2C66 A;  4KPL A;  4HCD A;  4B66 A;  4MMW A;  3UJ2 A;  3RIT A;  4LII A;  4CRT A;  1EC7 A;  1EBH A;  3R0K A;  3NVY B;  3SSZ A;  3GRT A;  4NEW A;  3OZ2 A;  3VFC A;  3AMZ A;  2A89 A;  3AYI A;  2BK3 A;  3RHA A;  3EKG A;  4ZCD A;  1K4Q A;  3K7M X;  5FS7 A;  3CNJ A;  3LZW A;  4GF7 A;  4IP5 A;  2VOU A;  2PYX A;  4H2R A;  2B7S A;  3LAD A;  2JAE A;  5TR3 A;  2XH4 A;  3R9U A;  3SZW A;  4TM1 A;  3P4P A;  1KD0 A;  3HPF A;  1Y0P A;  4NEV A;  3DK4 A;  3FMW A;  1DOD A;  4CNJ A;  1MRA A;  4JNA A;  1FFV C;  1TYT A;  1N60 C;  3UGV A;  2C3D A;  1HYU A;  1N5X A;  3ZVH A;  2XVE A;  2GL5 A;  3DG6 A;  2PP1 A;  3UOX A;  1OJC A;  2I0Z A;  3AE5 A;  2WES A;  3JZU A;  4Y4N A;  2O56 A;  2OA1 A;  1V59 A;  1N62 C;  2BAB A;  2TMD A;  5DBJ A;  3VCC A;  2CUL A;  3T2K A;  2RDX A;  3NFU A;  4CCQ A;  3ALJ A;  1EL8 A;  2OLO A;  4J36 A;  4EIP A;  2ZZC A;  1B37 A;  3NTD A;  4NTD A;  3MY9 A;  2B7R A;  3VRB A;  4HB9 A;  3ZLG A;  4B67 A;  2YG3 A;  1NHP A;  2YQU A;  3NKS A;  3SM8 A;  2XH7 A;  2BS3 A;  4WX1 A;  4Z25 A;  2YR4 A;  3GY1 A;  3RR1 A;  3LXD A;  4Z26 A;  3QTP A;  1N1P A;  1ELS A;  2OPJ A;  1X2H A;  3CGE A;  3AEG A;  2ZAD A;  1NEN A;  1CJC A;  4HN8 A;  4A65 A;  3SQP A;  3K1G A;  4OPI A;  3KUM A;  4TM4 A;  3ALM A;  2X8H A;  1WYG A;  2V5Z A;  2YVJ A;  2HZG A;  1BKW A;  4K5R A;  2R0C A;  1EC9 A;  5BVA A;  4E5T A;  3TJI A;  3VDG A;  4XWZ A;  3COX A;  4Y4M A;  3AED A;  5KMR A;  4ICY A;  1OJ9 A;  5FJU A;  3AE8 A;  2E5A A;  4A3R A;  3MUC A;  1O5W A;  2VRL A;  2JB3 A;  2OZT A;  3CK5 A;  5J04 A;  1ZOY A;  1D4D A;  1H82 A;  3EF6 A;  4CNK A;  4GYP A;  1QO8 A;  2C72 A;  3V3W A;  1CBO A;  2PGE A;  3D47 A;  3QJ4 A;  4U8N A;  4RSL A;  4FK1 A;  4EQX A;  3I6T A;  3UOZ A;  2WDR A;  4DGK A;  4ECH A;  1ONF A;  1TZZ A;  4MKS A;  2XLT A;  1TYP A;  2OZ3 A;  1JRX A;  3SZF A;  1MUC A;  5CKU A;  3UJR A;  2BC0 A;  1NDA A;  3AE4 A;  1F9C A;  1VDV A;  1H84 A;  3NRN A;  4DHG A;  4GDP A;  1CJ4 A;  3SJN A;  4AOS A;  1CC6 A;  2OLN A;  3VR9 A;  3TOY A;  2FJE A;  1TE6 A;  3OW1 A;  3A7U A;  1UKV G;  4Z43 A;  1LV0 A;  4EQW A;  3MZN A;  4I59 A;  3QFB A;  3NK0 X;  4H4V A;  3H7V A;  1XPY A;  2W55 A;  2OVL A;  3TWA A;  1MO9 A;  3ZVI A;  1LPF A;  3S5S A;  2H88 A;  3JSK A;  3THU A;  3C96 A;  2BXS A;  1DXL A;  3I6E A;  4DNA A;  3H70 A;  2APG A;  2QJJ A;  1Y56 A;  3GRS A;  4TM0 A;  3MSY A;  6ENL A;  1V97 A;  1S3B A;  3M0O A;  1RM6 B;  2C73 A;  4IA5 A;  3ICT A;  3UKA A;  3UKL A;  3QPE A;  3AN1 A;  1NG4 A;  2XFN A;  4BK2 A;  4GCM A;  1TKK A;  4U2T A;  4NWZ A;  4Z24 A;  1NPX A;  3Q6J A;  4IV9 A;  4H2Q A;  3N4F A;  5J7X A;  2GEW A;  1JRO A;  1H83 A;  3NGC X;  1K0L A;  2PCE A;  3UKQ A;  2ONE A;  1OJD A;  2EQ9 A;  4DSH A;  2AAQ A;  4UDR A;  3OTR A;  1PDZ A;  3SX6 A;  3SFD A;  3AEF A;  3QSM A;  3AD9 B;  1GER A;  1OEP A;  3ZVH B;  2GF3 A;  4GIS A;  2GR1 A;  2AL1 A;  3ZDN A;  3OPS A;  3KD9 A;  1COY A;  4A9W A;  2ARD A;  2BA9 A;  1BQG A;  2BS2 A;  3DIP A;  1N4U A;  3DFY A;  3KPK A;  4HNL A;  1KDG A;  2YR5 A;  1PJ5 A;  4X2P A;  1IUW A;  2F5Z A;  3CNT A;  2XVH A;  1DJQ A;  2Y6R A;  4J1O A;  3T6C A;  4OPT A;  3AE9 A;  3NN0 X;  4JHM A;  2B9W A;  5IDZ A;  2BCP A;  3RGT A;  1ZKQ A;  1F6M A;  1NG3 A;  4YSZ A;  1KFY A;  3I3L A;  3IWA A;  3P1W A;  1PBC A;  2OAL A;  4H4R A;  1TDO A;  1KN0 A;  3ZLF A;  3SQS A;  3IJL A;  3DEQ A;  2XYO A;  1EBG A;  2R45 A;  3P9U A;  1N61 C;  4YKG A;  3F8R A;  3DG7 A;  4K2S A;  3IC9 A;  3N6J A;  3EAO A;  1KNP A;  3G5S A;  2OG9 A;  4C5O A;  3V5C A;  1O94 A;  2ZBW A;  4NTC A;  5C2T A;  3FPZ A;  4YSH A;  3SY4 A;  1IUT A;  2QVH A;  1K0I A;  3N6H A;  2E1M A;  2WQY A;  4ZOH B;  3ZLH A;  5JCL A;  3CT2 A;  1BKH A;  3ICS A;  3G5R A;  2V3A A;  3L1R A;  3DK9 A;  4C3X A;  1O95 A;  2AKZ A;  3ENL A;  1B8S A;  2XLS A;  2PPG A;  3QVR A;  4EWJ A;  1IUS A;  4JY2 A;  3UTH A;  4Z17 A;  3ES8 A;  3IF9 A;  1NAA A;  3P3B A;  3URH A;  1TRB A;  1JU2 A;  4GR1 A;  5ER0 A;  1FEA A;  3PG6 A;  3SN4 A;  1DNC A;  4BJZ A;  3NXL A;  2E5V A;  3ES7 A;  2WOW A;  3OZY A;  2OQH A;  3ALL A;  3BNU A;  3H8A A;  3GYX A;  2X99 A;  2XFP A;  4U8M A;  3DH9 A;  4E4U A;  4OPL A;  4JDR A;  2GV8 A;  4LU6 A;  3NHO X;  3L5O A;  2B9X A;  5U25 A;  4B1B A;  2XFQ A;  2C64 A;  4A99 A;  3H4K A; 
#chains in the Genus database with same CATH homology
 4ZCC A;  5U63 A;  3AEC A;  4CCQ A;  4H4S A;  3ALJ A;  4ADW A;  1EL8 A;  1GOS A;  4U8J A;  2OLO A;  4J36 A;  4EIP A;  2ZZC A;  1B37 A;  3NTD A;  1GES A;  3LZX A;  1CF3 A;  2YLT A;  4NTD A;  5GRT A;  1CJ3 A;  4EMJ A;  4A6N A;  3RP8 A;  4J34 A;  2B7R A;  4CBQ A;  1GT8 A;  1LQT A;  3RP6 A;  3AEA A;  5L46 A;  2C75 A;  4JN9 A;  4K5S A;  3VRB A;  2XFO A;  4HB9 A;  4H4W A;  1VG0 A;  4B67 A;  1IUU A;  2YG3 A;  4GAP A;  1NHP A;  3AXB A;  2GAG B;  2YQU A;  3NKS A;  4OPG A;  3UKH A;  2XFU A;  1SEZ A;  3SM8 A;  4A5L A;  3K7Q X;  4YSY A;  4J57 A;  1E39 A;  4A7A A;  2FJB A;  2BS3 A;  2RGH A;  3D1C A;  3GYJ A;  4WX1 A;  2X50 A;  1S3E A;  3WE0 A;  4Z25 A;  2WP6 A;  2YR4 A;  1XAN A;  3B6D A;  3NK2 X;  3DK8 A;  5KMP A;  3LXD A;  5IQ1 A;  3H8I A;  4OCG A;  1ZY8 A;  3BHF A;  3KPF A;  2EQ8 A;  1FL2 A;  2WDQ A;  4Z26 A;  3UTG A;  3V3O A;  4YTP A;  3T2Z A;  2YLW A;  3AEB A;  3T37 A;  4HA6 A;  1N1P A;  3O0H A;  1GRT A;  1YQ3 A;  1JRY A;  2PHH A;  5FS8 A;  3CGC A;  4OPC A;  4D04 A;  1JRZ A;  5KRQ A;  2CFY A;  3ITJ A;  4H7U A;  2IID A;  4BV6 A;  2GR2 A;  3CGE A;  2WS3 A;  3AEG A;  2JKC A;  3GSI A;  5KNL A;  1NEN A;  5FMH A;  1CJC A;  2YVG A;  4II3 A;  4A65 A;  1CC4 A;  5JCK A;  4YTM A;  3NNE A;  3SQP A;  3PO7 A;  1LQU A;  3CPH G;  1E1L A;  4KX6 A;  3SYI A;  4OPI A;  3V76 A;  3FG2 P;  3SFE A;  4Z2U A;  2YLZ A;  4FDC B;  4TM4 A;  3NN6 X;  3ALM A;  1RYI A;  1EL7 A;  2X8H A;  1S2Q A;  2V5Z A;  4Z2T A;  2YVJ A;  1PS9 A;  5FS9 A;  2OAM A;  4USQ A;  1YQZ A;  4O5Q A;  4A79 A;  1GET A;  1BKW A;  4K5R A;  2R0C A;  4YWO A;  4H4Q A;  1E1K A;  2C4C A;  3H8L A;  3SZ0 A;  3T14 A;  3NT6 A;  1NEK A;  3EAN A;  4PAA A;  1ZOV A;  1FEB A;  4H4X A;  5BVA A;  1ZP0 A;  1GPE A;  4X9M A;  4BJY A;  5HYM A;  2B9Y A;  4XWZ A;  4BK3 A;  4H4Z A;  3COX A;  1TDN A;  4C77 A;  4U8L A;  3CTY A;  4Y4M A;  1MXT A;  3AED A;  4YT0 A;  2WBA A;  1D5T A;  2Z5Y A;  2WPF A;  4ICY A;  1OJ9 A;  3AE8 A;  5KMR A;  1P2H A;  1RSG A;  1QLB A;  4CCR A;  1VRQ B;  3FBS A;  3AE2 A;  4N9X A;  5M0Z A;  1CC2 A;  4G9K A;  2IVD A;  3T0K A;  3ADA B;  1O5W A;  3CN8 A;  2V61 A;  5FS6 A;  2VRL A;  4K2X A;  5GSN A;  2JB3 A;  3NYE A;  3SXI A;  4ZN0 A;  2XVF A;  1GND A;  1BGN A;  3NYF A;  1BF3 A;  4JY3 A;  4UDP A;  3CPI G;  5EBK A;  4X4J A;  2C65 A;  1NHQ A;  4D03 A;  1ZOY A;  1D4D A;  1H82 A;  3EF6 A;  4A6N B;  4B63 A;  2XVI A;  4CNK A;  1QO8 A;  3NH3 X;  4J31 A;  2C72 A;  3BI4 A;  1D4C A;  5EB4 A;  3UKK A;  3VQR A;  1CBO A;  2XVJ A;  2A8X A;  3KU9 A;  4B69 A;  3QJ4 A;  4J56 A;  1Y56 B;  4U8N A;  5BUL A;  2BRA A;  1F8R A;  4RSL A;  1JOA A;  4GRT A;  4XWR A;  1H2I A;  2O9Z A;  4FK1 A;  3SGL A;  2YM1 A;  4BUR A;  2NPX A;  4EQX A;  2WPE A;  2RGJ A;  4IA6 A;  4B64 A;  3UOZ A;  2WDR A;  2WOV A;  1OJA A;  1H7W A;  4DGK A;  3G5Q A;  1S2Y A;  2GR3 A;  2C70 A;  4ECH A;  4AT2 A;  4TLZ A;  1N4W A;  1DJN A;  3BI2 A;  1PBB A;  5EB5 A;  3E1T A;  1ONF A;  2EQ6 A;  1BWC A;  2XLT A;  4K22 A;  1TYP A;  1GEU A;  1CHU A;  2XDO A;  5IQ4 A;  2YG6 A;  4NTE A;  4X9N A;  5C3J A;  1NHS A;  3HYW A;  1JRX A;  4U8I A;  3SZF A;  5CKU A;  3QSS A;  1NHR A;  2YM2 A;  3QSE A;  4B68 A;  4AT0 A;  2IVE A;  1JNR A;  4EM4 A;  3GWD A;  1EBD A;  1PXB A;  2FBW A;  4REK A;  2BC0 A;  1NDA A;  1IUX A;  3AE4 A;  4PAB A;  3P4S A;  2BK4 A;  4OPD A;  3V3N A;  2Z5X A;  1GRB A;  1H84 A;  3NRN A;  3AD7 B;  1GTE A;  1CJ2 A;  3BHK A;  3UTE A;  2BXR A;  1LTX R;  1L9E A;  2C7G A;  4GDP A;  4B65 A;  2WDV A;  3ISH A;  3DGH A;  1JNZ A;  3AE7 A;  4UP3 A;  3S61 A;  5HY5 A;  1ZX9 A;  1CJ4 A;  1D4E A;  2C67 A;  2C3C A;  4AOS A;  3M13 A;  1CC6 A;  2OLN A;  3P4R A;  4KPR A;  3VR9 A;  2YG4 A;  1PXA A;  1VQW A;  3GYI A;  2FJE A;  3ATR A;  3ATQ A;  2XLR A;  4O5U A;  1UKV G;  4H2N A;  1GV4 A;  3DGZ A;  1PN0 A;  2CVJ A;  4Z43 A;  3EPT A;  1KF6 A;  1LV0 A;  4EQW A;  4I59 A;  2H89 A;  3QFB A;  3NK0 X;  5U1O A;  4H4V A;  1PBD A;  2BYB A;  1LVL A;  3NK1 X;  1MO9 A;  3CND A;  2GRT A;  1LPF A;  3AYL A;  3AE3 A;  2JK6 A;  1VDC A;  2Q0L A;  1Q1R A;  2H88 A;  3NTA A;  4NNJ A;  1ZMD A;  3JSK A;  3C96 A;  2BXS A;  4J33 A;  3HYV A;  3C4A A;  1DXL A;  4DNA A;  2APG A;  4U8K A;  1F8S A;  4AOX A;  1Y56 A;  2XLP A;  3C4N A;  3DJD A;  4C3Y A;  3GRS A;  5BRT A;  2BRY A;  1PXC A;  4EIQ A;  2YLS A;  4TM0 A;  5JRB A;  2BAC A;  1S3B A;  3M0O A;  5KWF A;  1CL0 A;  1REO A;  3ZYX A;  2FJD A;  2C73 A;  4IA5 A;  3ICT A;  3UKA A;  1ZK7 A;  3UKL A;  2RAB A;  3OC4 A;  4U2S A;  1ELI A;  5EOW A;  4UDQ A;  3AD8 B;  3K7T A;  1NG4 A;  3IHG A;  1IUV A;  1PDH A;  2J3N A;  2XFN A;  4BK2 A;  4TLX A;  4GCM A;  3ICR A;  4I58 A;  5HHF A;  1E1N A;  3CNP A;  3LB8 A;  4GDE A;  4U2T A;  2YR6 A;  4NWZ A;  2FJA A;  2EQ7 A;  2Q6U A;  4Z24 A;  1NPX A;  3Q6J A;  4IV9 A;  3GDP A;  4H2Q A;  3F8D A;  2QCU A;  3UOY A;  3DJJ A;  1S7M A;  1KSS A;  1LJ1 A;  5J7X A;  4YSX A;  2GH5 A;  4EMW A;  3UKF A;  4U8P A;  2GEW A;  3DJG X;  1H83 A;  5KXJ A;  1Q9I A;  2TPR A;  3NGC X;  3AE6 A;  3AYJ A;  1K0L A;  3CGB A;  4H4P A;  2ACZ A;  2VQB A;  4WCT A;  4RG4 A;  2DKH A;  3UKQ A;  2ZZ0 A;  4H4T A;  4DSG A;  3HYX A;  1PBE A;  5KOW A;  2YG7 A;  1OJD A;  1F8W A;  2EQ9 A;  2R4J A;  3NIX A;  2ZZB A;  4DSH A;  2NVK X;  4U2L A;  2AAQ A;  3RNM A;  4UDR A;  3M12 A;  2GQW A;  1P2E A;  4G6H A;  3SX6 A;  1GXF A;  4J2W A;  2X8G A;  3SFD A;  3AEF A;  3HZL A;  4C74 A;  1GRE A;  2WP5 A;  1MOK A;  4FK1 C;  3RP7 A;  1M6I A;  3QSM A;  1X31 B;  1FEC A;  3AD9 B;  4Y4L A;  3GD3 A;  2HQM A;  5LV9 A;  2WU5 A;  3PVC A;  1H6V A;  4XXG A;  1F3P A;  1GER A;  1D7L A;  3K30 A;  2GF3 A;  2RGO A;  4RG3 A;  2BCG G;  3L8K A;  2GR0 A;  2GR1 A;  2V60 A;  3GD4 A;  4H2P A;  3II4 A;  3ZDN A;  3KD9 A;  1GRG A;  2V6O A;  5KVI A;  1COY A;  2ARD A;  4OVI A;  4USR A;  4A9W A;  2BA9 A;  4G74 A;  1RP0 A;  4CY8 A;  3NLC A;  2JB1 A;  2X3N A;  1B4V A;  2Q0K A;  5JCM A;  4K7Z A;  2JB2 A;  2BS2 A;  3BI5 A;  2XLU A;  3CIR A;  1FCD A;  4IVO B;  1YQ4 A;  3UP4 A;  1ZDL A;  1DOE A;  1N4U A;  2V3B A;  3FIM B;  5KMS A;  4II2 A;  4EM3 A;  4BK1 A;  2YAU A;  3GDN A;  3KKJ A;  3KLJ A;  3KPK A;  5J60 A;  5JCI A;  3VRD B;  3AE1 A;  4Z2R A;  4P9S A;  1KDG A;  2YR5 A;  3CMM A;  4JNQ A;  1VG9 A;  3UKP A;  4Z44 A;  1YY5 A;  4LA1 A;  1PJ5 A;  4TM3 A;  1PJ6 A;  3BNM A;  3DME A;  1IUW A;  2F5Z A;  2WP9 A;  2XVH A;  3CNT A;  5BUK A;  2YLR A;  3CPJ G;  1DJQ A;  2Y6R A;  2QA1 A;  2Y6Q A;  5KVH A;  1B5Q A;  4OPT A;  5JCN A;  2JBV A;  3AE9 A;  2QAE A;  1GTH A;  3LOV A;  3NN0 X;  3I6D A;  2YLX A;  1E7P A;  1E1M A;  2B9W A;  1TDK A;  2R0P A;  4EQR A;  4NZH A;  1M64 A;  2BCP A;  1KNR A;  1ZKQ A;  2YVF A;  5CQF A;  1F6M A;  3VR8 A;  2BK5 A;  1NG3 A;  3UOV A;  1KSU A;  4YSZ A;  1XPQ A;  4M52 A;  1KFY A;  2VQ7 A;  2VVL G;  3RED A;  4K8D A;  3I3L A;  1GRA A;  2WHD A;  2GMH A;  3IWA A;  3P1W A;  4YKF A;  2WPC A;  1PBC A;  2OAL A;  4H4R A;  1L9C A;  2VRM A;  4G6G A;  2R46 A;  2C66 A;  1TDO A;  1KN0 A;  4MJW A;  2Q7V A;  4B66 A;  1Z6L A;  4LII A;  3CNS A;  1JEH A;  1FOH A;  3ABV A;  2YWL A;  4H4U A;  2XYO A;  1K0J A;  4YTN A;  4JQ9 A;  2R45 A;  4CRT A;  3P9U A;  4APN A;  4YKG A;  3NYC A;  2QA2 A;  3F8R A;  3GRT A;  1Q1W A;  4NEW A;  3OZ2 A;  1H81 A;  3B3R A;  3IC9 A;  2A89 A;  3QVP A;  3EAO A;  1H86 A;  4FX9 A;  1KNP A;  3AYI A;  2B76 A;  3G5S A;  1PJ7 A;  2X8C A;  4YXD A;  1YKJ A;  4C5O A;  2BK3 A;  1PHH A;  1O94 A;  2ZBW A;  3LJP A;  4NTC A;  5C2T A;  3RHA A;  2XCG A;  2DKI A;  3KA7 A;  3PS9 A;  4ZCD A;  1K4Q A;  2YG5 A;  3FPZ A;  3K7M X;  5FS7 A;  1EL5 A;  1BZL A;  3CNJ A;  3LZW A;  4GAV A;  3SY4 A;  4YSH A;  1IUT A;  4GF7 A;  3QFA A;  1K0I A;  2VOU A;  2E1M A;  2WQY A;  2PYX A;  4H2R A;  1XDI A;  2B7S A;  5JCL A;  3S5W A;  2AR8 A;  3LAD A;  2JAE A;  4H50 A;  5TR3 A;  3D8X A;  3ICS A;  3G5R A;  2WOI A;  4EMI A;  3R9U A;  3SZW A;  2V3A A;  4H4Y A;  3L1R A;  4TM1 A;  2BC1 A;  3DK9 A;  3Q9T A;  4C3X A;  1O95 A;  2UZZ A;  3P4P A;  3VRA A;  2R4E A;  2A87 A;  3GMC A;  4GUV A;  3T2Y A;  1B8S A;  2C76 A;  2XLS A;  1XHC A;  1Y0P A;  4NEV A;  3DK4 A;  2VVM A;  3QVR A;  3GMB A;  2WEU A;  3FMW A;  3SZC A;  1IUS A;  4IVM B;  4JY2 A;  3UTH A;  2CDU A;  2R0G A;  1DOD A;  2WET A;  4CNJ A;  5KMQ A;  1H7X A;  3IF9 A;  4JNA A;  1NAA A;  2VZ2 A;  1TYT A;  3CGD A;  3URH A;  1JU2 A;  1TDE A;  1TRB A;  1TDF A;  2C3D A;  1HYU A;  2GQF A;  2R9Z A;  3D9X A;  4AP1 A;  1GRF A;  1L0V A;  4G73 A;  4GR1 A;  1DOC A;  5ER0 A;  4OPU A;  1FEA A;  3PG6 A;  3DJE A;  2XVE A;  1DNC A;  1ZMC A;  3AB1 A;  2E5V A;  3UCL A;  4BJZ A;  1N4V A;  1EL9 A;  3UOX A;  2WOW A;  2E4G A;  3AWI A;  5IPY A;  4EQS A;  1OJC A;  2GB0 A;  2W0H A;  5KOX A;  2I0Z A;  1L9D A;  3AE5 A;  3ALL A;  2GAH B;  1BGJ A;  5M10 A;  3AEE A;  1GRH A;  1W4X A;  2WES A;  3BNU A;  3DA1 A;  1DOB A;  1GAL A;  3GYX A;  2GVC A;  2X99 A;  3NG7 X;  4Y4N A;  2XFP A;  5HXI A;  1GSN A;  4U8M A;  3UTF A;  3DH9 A;  2GMJ A;  3F8P A;  4OPL A;  1IJH A;  2WU2 A;  4JDR A;  2VVL A;  1D7Y A;  2AQJ A;  2GV8 A;  3T31 A;  3UP5 A;  4CY6 A;  3GWF A;  2OA1 A;  1V59 A;  1PBF A;  4LU6 A;  1E6E A;  4AP3 A;  2BAB A;  3NHO X;  3L5O A;  2B9X A;  2TMD A;  5DBJ A;  5U25 A;  4B1B A;  3P4Q A;  3KVE A;  2XFQ A;  1OJT A;  1QJD A;  1AOG A;  2CUL A;  4U8O A;  4E0V A;  3IHM A;  2C64 A;  4A99 A;  3T2K A;  2BS4 A;  3H4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...