1V59A

Crystal structure of yeast lipoamide dehydrogenase complexed with nad+
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
478
structure length
478
Chain Sequence
TINKSHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRGIDVNGDIKINVANFQKAKDDAVKQLTGGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEFQPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVVEDTKTNKQENLEAEVLLVAVGRRPYIAGLGAEKIGLEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVNYNNIPSVMYSHPEVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANMAAYDKAIHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoamide dehydrogenase
publication title Crystal structure of yeast lipoamide dehydrogenase complexed with NAD+
rcsb
molecule tags Oxidoreductase
total genus 160
structure length 478
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1v59A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1v59A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1v59A02
3UKHA 3II4A 1B8SA 3CTYA 4X9MA 2BS2A 4U8OA 1YQ4A 2CDUA 2EQ9A 1DXLA 1BGNA 5FS6A 1TDOA 1YY5A 2C70A 2XFQA 2YG4A 5KXJA 1ZOYA 5BVAA 3UKLA 3AYLA 4FK1C 4YTNA 2DKHA 3L1RA 5BUKA 3FPZA 3AD9B 3GDPA 3ALJA 3NYEA 4EQRA 4OPTA 1FCDA 2JB3A 3IHMA 1NHRA 3LXDA 5JCIA 4D03A 2BXRA 2ZZBA 2JBVA 2GAHB 1S2QA 4EM4A 3SFDA 3VQRA 2YR4A 3GD3A 1E1KA 3F8PA 2B9XA 4Z44A 3REDA 3QFAA 3SGLA 4WX1A 3AEGA 1BZLA 5J7XA 4XWRA 1NG3A 4Z24A 4NTEA 3T37A 4B64A 1PHHA 5U63A 5IQ4A 3L8KA 2YG7A 5EBKA 2X8GA 3K7MX 1O95A 1H83A 2C72A 5KWFA 1JNZA 3UKQA 2E4GA 1K4QA 1YKJA 3NT6A 1GT8A 4RG4A 4AOSA 1N1PA 3H8LA 2O9ZA 1NAAA 4C77A 5JCKA 3QJ4A 1BF3A 4LU6A 2R9ZA 1D4EA 1PBDA 2BK5A 3BNMA 1Q9IA 5DBJA 4J56A 1ELIA 1TDNA 3UCLA 2AR8A 4IV9A 4CRTA 4LA1A 2X50A 4BJYA 1NPXA 2C3CA 2BS3A 2C3DA 2C73A 4DSGA 5U25A 2WQYA 1LJ1A 2RGOA 4TM1A 4YSZA 4ZN0A 1GXFA 2R0PA 3P4PA 5CKUA 5IPYA 1S3EA 1MO9A 4B67A 3NK0X 3KVEA 3O0HA 2R45A 3CN8A 5M0ZA 1LVLA 4C74A 2GH5A 4E0VA 1TDEA 1S3BA 1ZMCA 1VRQB 4U2LA 2YWLA 4EMIA 2R46A 4Y4NA 4AP3A 3NG7X 3QVRA 3NTDA 1NG4A 5FS8A 1YQ3A 2XYOA 1GRBA 2YVFA 3R9UA 4X9NA 4Z26A 3H4KA 3DA1A 5C3JA 3ICRA 3NYCA 1DNCA 3KKJA 1GOSA 3DGHA 2XFUA 4J33A 4C3XA 2CFYA 2Y6QA 4OPLA 5EB5A 4Z2TA 2WPFA 1Q1RA 2C7GA 3ISHA 3AE1A 3ALLA 2W0HA 4EQSA 1DOBA 1GRFA 3HZLA 3P1WA 4NTCA 3IC9A 3GMBA 2VVLA 4H4RA 1NHPA 1BKWA 1L9EA 2OA1A 4RG3A 3V3NA 1N4WA 4H4ZA 3RP7A 1XANA 1IUWA 4EMJA 1CF3A 3AE8A 3AD7B 4MJWA 1H81A 4EIPA 2JK6A 1JRZA 3VRBA 3D8XA 4EQXA 3UTEA 1GSNA 2GR2A 4ECHA 2YLRA 2A8XA 3SQPA 2B9WA 4O5QA 3ZDNA 1XHCA 2XVIA 2WP5A 1ZX9A 1PBBA 1KSUA 2YR5A 3IF9A 1GEUA 5FS9A 1UKVG 1KFYA 5EB4A 2X8CA 2C65A 2R4JA 2YLTA 3BHFA 3OZ2A 3UTFA 3NHOX 4JNAA 3V3OA 1JU2A 2GF3A 2XFNA 2V6OA 1VG0A 4WCTA 3V76A 3P9UA 2B76A 3B3RA 2BK3A 3GYIA 1FL2A 2YQUA 1IUUA 3UOYA 3C4NA 3KU9A 2BCPA 3GWDA 4UP3A 1NHSA 1E1NA 2R4EA 1JEHA 1D5TA 2EQ7A 2C67A 5KOXA 2HQMA 2VRLA 3DJGX 3KPFA 1E39A 3NYFA 3RP6A 2ZZCA 1L9DA 2YAUA 2OLNA 4TM3A 2GB0A 1REOA 3BI2A 4H4QA 2ZBWA 2WU2A 4JY2A 1F8RA 3GWFA 4EMWA 2JB2A 1V59A 3JSKA 4FDCB 1M6IA 1JRYA 3DH9A 4GRTA 1K0LA 1PXCA 1RYIA 2CULA 3NIXA 3NN6X 3NLCA 1JOAA 2YG3A 4Z2UA 2F5ZA 3F8DA 3AEDA 4AT2A 4X4JA 1H7XA 4OPDA 1YQZA 4KPRA 2I0ZA 1TDFA 3M12A 2WESA 4Y4MA 4HA6A 3AE7A 1LV0A 5FS7A 3GRTA 5CQFA 4REKA 4B69A 4YSHA 2OLOA 3NNEA 4AP1A 4USRA 3QSMA 1EL8A 4IA6A 4NTDA 2V60A 3VRAA 2H89A 5HXIA 1PJ5A 3UKAA 1GRHA 2QA1A 2AQJA 3AECA 5J60A 1H6VA 2NPXA 2JB1A 4Z43A 1GNDA 1BGJA 2EQ8A 3RHAA 3CGEA 4BJZA 3CIRA 3NTAA 3QSEA 1PJ6A 2WOWA 4NZHA 4BK3A 2GR0A 1HYUA 5BRTA 1KDGA 1Z6LA 2XLRA 4A99A 3M0OA 1MXTA 2GV8A 2JKCA 4APNA 1F6MA 3CPHG 1D7YA 1GREA 4IVOB 2C64A 1IUSA 1K0IA 3CGDA 4B66A 1GERA 4TLXA 4CNKA 2XVJA 1QJDA 3F8RA 1PN0A 4JNQA 1NHQA 1F8SA 1GV4A 1KNRA 2BABA 4K5SA 1H7WA 2AAQA 1NDAA 1IJHA 4YKGA 4PABA 1CJCA 3AE2A 4JQ9A 1B37A 4B1BA 1E1LA 1GTEA 1CC6A 4IVMB 1RP0A 4J31A 4GR1A 4K22A 3PO7A 4I59A 4M52A 3BHKA 1Y56A 3GD4A 1PJ7A 4GF7A 1E1MA 3GDNA 1O5WA 4A65A 3BI5A 5KVIA 2BXSA 2YM1A 3NN0X 2WU5A 1D7LA 1GTHA 3OC4A 2FJEA 1COYA 4B65A 1QLBA 3LZXA 5M10A 4YXDA 3CGBA 1KF6A 4U2SA 3URHA 4DGKA 5JCLA 3FMWA 1RSGA 1L9CA 1TYTA 1B5QA 1D4DA 2VQBA 1ZP0A 2OALA 3AEBA 2IIDA 3DK8A 1ZOVA 4A9WA 3M13A 4GCMA 4UDQA 3QVPA 1Y56B 1VQWA 2XDOA 4EIQA 3CPIG 2R0GA 3VR8A 4FK1A 1Q1WA 1EL7A 2BK4A 2UZZA 4TM0A 1JNRA 2TMDA 3DJDA 4OPIA 2GR1A 3I3LA 1LQTA 3EAOA 4NEVA 2Q7VA 1FOHA 1O94A 2FJAA 1TDKA 4USQA 1S2YA 3AE6A 3FG2P 1F8WA 2VVMA 3AYIA 2E5VA 4YSXA 4J2WA 1M64A 1F3PA 1ZDLA 2VRMA 2APGA 3UP5A 2QAEA 3AE5A 3AE4A 4H2RA 2Q6UA 4A79A 4JY3A 1N4UA 4U8KA 3H8IA 2VQ7A 2XFOA 1H86A 1CBOA 1B4VA 2YVGA 1PS9A 2YR6A 4H4SA 3DK9A 2Z5XA 4U2TA 3AE3A 3CNSA 5HYMA 2XFPA 3PS9A 2R0CA 3S5WA 3AXBA 2ARDA 2YLXA 2OAMA 2QA2A 4H2PA 2GMJA 4H4WA 3G5RA 3G5QA 1OJCA 4IA5A 4YTPA 3P4RA 3UKKA 1LPFA 2XVFA 3LJPA 5IQ1A 4I58A 2GQFA 2WETA 2YG5A 3LZWA 2IVEA 2C75A 1L0VA 3DJEA 1FECA 3WE0A 4JDRA 3Q9TA 4H4VA 3KD9A 3LB8A 1XDIA 1PBCA 4CBQA 3NRNA 1FEAA 2BC1A 2WOVA 3CPJG 3E1TA 3G5SA 3LOVA 1PBFA 2WS3A 1PBEA 1CJ4A 1EBDA 1E6EA 1H82A 3UTHA 4AT0A 3KLJA 3RP8A 3IWAA 4ADWA 4YT0A 2V3AA 1BWCA 1IUXA 4K7ZA 1LQUA 1FEBA 1DOEA 2A87A 1PDHA 2GAGB 2XCGA 3NK1X 5LV9A 4YWOA 3EPTA 2NVKX 3K7QX 2WHDA 5GSNA 2PYXA 2XLPA 1CL0A 3UP4A 3UKPA 1MOKA 1SEZA 2B9YA 2EQ6A 2VOUA 2H88A 3AE9A 1OJ9A 4J34A 2X8HA 3NH3X 4CCRA 2WDQA 1IUVA 5GRTA 4OPCA 2V3BA 3ICTA 3VRDB 3UOXA 2WPCA 5L46A 3ITJA 3FBSA 4N9XA 4OPGA 1ONFA 3QSSA 1AOGA 2Q0KA 5KRQA 2FJBA 4U8MA 4XXGA 4OVIA 2B7SA 4C3YA 4P9SA 1VDCA 2BACA 1GESA 3GMCA 4J57A 4H4XA 1W4XA 4H4UA 2YVJA 3GRSA 2FBWA 5HY5A 4ZCDA 2WP9A 2BC0A 2VZ2A 1EL5A 2DKIA 3UKFA 3QFBA 3VR9A 1E7PA 4ZCCA 4Z25A 1QO8A 4B63A 4TLZA 2WDVA 3FIMB 4BK2A 2GVCA 1CJ2A 1PXBA 2QCUA 3ZYXA 2BCGG 3UOVA 2IVDA 2A89A 4UDPA 1CHUA 3P4SA 2WEUA 5FMHA 2XLUA 4EQWA 2BS4A 3SM8A 2Z5YA 2GQWA 3COXA 4H2QA 3S61A 1TRBA 5KOWA 5KVHA 2PHHA 1DJQA 1X31B 1ZMDA 3B6DA 2XLTA 1ZY8A 2WOIA 2V5ZA 3DMEA 4H4PA 4GDEA 3BNUA 2YLZA 4CCQA 2X3NA 3GSIA 1TYPA 2FJDA 2VVLG 3UOZA 5TR3A 2B7RA 1DJNA 5BULA 1GRAA 2C66A 4OCGA 2E1MA 5HHFA 3BI4A 3ICSA 1N4VA 1PXAA 4Y4LA 3EF6A 4YTMA 1CC4A 4K2XA 1GETA 4NEWA 4GDPA 4U8PA 3NGCX 2GMHA 4YSYA 1P2HA 1GRGA 3AYJA 4CY6A 2RABA 2XLSA 3CNDA 3PVCA 2WPEA 1JRXA 2YLWA 4H4YA 1KNPA 2ACZA 3K30A 1OJTA 4JN9A 3C4AA 4RSLA 3SFEA 4A6NA 2WBAA 2Q0LA 4U8IA 1DODA 3ATQA 4KX6A 2RGJA 4DNAA 1OJDA 4K8DA 3ADAB 2JAEA 4U8NA 4B68A 4H2NA 4FX9A 4PAAA 5ER0A 4Z2RA 3CGCA 3DK4A 1LTXR 2BA9A 2X99A 3ATRA 5C2TA 3I6DA 3LADA 2GEWA 4J36A 3DGZA 1GALA 4U8LA 4ICYA 3CNPA 3CNJA 3RNMA 4C5OA 3KA7A 1OJAA 3IHGA 3ALMA 2YLSA 4BURA 4YKFA 1H84A 5U1OA 1GRTA 4H7UA 3DJJA 2GR3A 5JCMA 2V61A 1GPEA 4O5UA 4A6NB 3UTGA 3CNTA 4A5LA 1CJ3A 5EOWA 3EANA 2J3NA 1NENA 1IUTA 1D4CA 3P4QA 4AOXA 4D04A 2WDRA 3D1CA 1ZKQA 2ZZ0A 1CC2A 4LIIA 4EM3A 3AB1A 4A7AA 2XVEA 3GYJA 4CNJA 2YG6A 1NEKA 3NKSA 3AWIA 2CVJA 2TPRA 2GRTA 4BV6A 1ZK7A 3Q6JA 2XVHA 2C76A 5JCNA 1K0JA 1VG9A 1KSSA 3K7TA 4K5RA 1XPQA 2WP6A 4H4TA 3AEFA 3NK2X 4CY8A 1P2EA 2BYBA 2YM2A 3ABVA 3AEEA 2RGHA 4UDRA 4U8JA 4TM4A 4HB9A 4BK1A 2Y6RA 3AEAA 4GUVA 4H50A 3AD8B 1DOCA 1EL9A 4XWZA 4DSHA 3C96A 4OPUA 1Y0PA
chains in the Genus database with same CATH superfamily
3II4A 3CTYA 1DXLA 1YY5A 5BVAA 3FPZA 3AD9B 1N62C 6ENLA 3GDPA 3NYEA 1FCDA 4F4RA 2BXRA 3Q45A 2JBVA 4EM4A 3SFDA 2YR4A 1E1KA 2B9XA 3T2ZA 3SGLA 5J7XA 1BZLA 4Z24A 5IQ4A 2AL2A 1H83A 1JNZA 3UKQA 1IYXA 3NT6A 1N1PA 2W3SA 2O9ZA 1NAAA 3L5OA 1BF3A 4G6HA 2BK5A 4J56A 4CRTA 4BJYA 1NPXA 5U25A 2GGIA 3P4PA 3OP2A 1S3EA 1MO9A 4B67A 3OZMA 2AL2B 1EBGA 1LVLA 4E0VA 4K8GA 1TDEA 4U2LA 3NG7X 3TCSA 3R9UA 2MNRA 3N6HA 3DA1A 3DGHA 2XFUA 4Z2TA 1EC8A 2CFYA 2Y6QA 4OPLA 2WPFA 3ALLA 2W0HA 3P1WA 1BKWA 3MKCA 1N60C 1IUWA 1CF3A 1NELA 3UTEA 1GSNA 2GR2A 1FHVA 2YLRA 2OFJA 3PG6A 2R4JA 3BHFA 3V3OA 2GF3A 1VG0A 4WCTA 2BK3A 2W55A 2PPGA 1FL2A 2QVHA 3KUMA 1IUUA 2OO6A 3KU9A 2HXTA 2C67A 2HQMA 3EEZA 3RP6A 2ZZCA 1L9DA 3HYVA 1REOA 2ZBWA 4IL0A 3P0WA 3GWFA 1F8RA 5FJRA 3JSKA 1V59A 3H12A 1RYIA 3NN6X 1PDZA 1JOAA 4Z2UA 2QJNA 3F8DA 3AEDA 4H83A 4H2HA 1TDFA 3D46A 4HA6A 5CQFA 3SBFA 2OQHA 3QSMA 4NTDA 2H89A 1H6VA 4JN7A 4Z43A 3MUCA 2OZ8A 4NZHA 1KDGA 1Z6LA 2GV8A 2JKCA 3CPHG 1D7YA 2C64A 1IUSA 4GMEA 3MZNA 5KMQA 4CNKA 1QJDA 3F8RA 3HRDC 1P43A 1NDAA 4YKGA 3CAWA 1Y56A 3GDNA 3BI5A 1D7LA 3DIPA 1X2HA 3FXGA 5JCLA 3FMWA 1RSGA 3OZYA 3DK8A 1ZOVA 3R0UA 1Y56B 4EIQA 4DX3A 4TM0A 1Q1WA 3UXKA 1EL7A 2UZZA 1JNRA 4OPIA 3EAOA 2Q7VA 3ZLFA 2FJAA 1O94A 1S2YA 2OZ3A 1ZDLA 5KMSA 3TQPA 4H2RA 2VQ7A 2XFOA 1CBOA 5KMRA 3DESA 3OW1A 3EUB3 3SY4A 2OAMA 4YTPA 3P4RA 4I58A 2GQFA 3U9IA 4CBQA 3NRNA 1JRPA 2BC1A 3E1TA 3NVYB 1CJ4A 1E6EA 1H82A 3RP8A 4GYPA 4ADWA 3V4BA 1IUXA 2AKZA 1DOEA 3DG7A 3EPTA 3K7QX 2WHDA 5GSNA 2XLPA 3UKPA 2EQ6A 2P8CA 3VRDB 3ICTA 2QDDA 3FBSA 3R0KA 1ONFA 4GIRA 4OVIA 4C3YA 5FJTA 2BACA 1GESA 3GMCA 3ETRB 2MUCA 3VR9A 4ZCCA 2GVCA 1CJ2A 1PXBA 3ZYXA 4E6MA 5BOEA 3K1GA 3UJEA 2WEUA 3SM8A 3COXA 2PHHA 3BNUA 4CCQA 1EBHA 3GD6A 1DJNA 5BULA 4OCGA 2E5AA 1N4VA 1N63C 3RO6A 4YTMA 4K2XA 1GETA 3NS1B 4U8PA 2OQYA 4YSYA 1P2HA 3SZ0A 4E5TA 1SJDA 3PVCA 3SN0A 5FJPA 2XH7A 3DK4A 2X99A 2QGYA 1S7MA 1WYGA 3TTEA 3DGZA 3SN1A 3CNPA 3CNJA 1OJAA 2XH0A 3IHGA 1DTNA 3I6TA 4IL2A 5J04A 3FJ4A 3VDGA 1MUCA 3DJJA 1BQGA 1TZZA 1MDLA 1NENA 3P3BA 4AOXA 2ZZ0A 4A7AA 4EM3A 3AB1A 2XVEA 1NEKA 3TOYA 2CVJA 2XVHA 4GISA 4E8GA 3VC6A 4CY8A 2XH2A 3T6CA 1P2EA 4UDRA 3AM9A 3AEAA 4ZCWA 4H50A 3AD8B 1EL9A 4XWZA 3C96A 4OPUA 1P48A 2CHRA 3OTRA 5KMPA 4U8OA 2CDUA 1TDOA 5FS6A 5KXJA 3AYLA 2PA6A 3UCCA 5BUKA 2PU0A 3H8AA 4D03A 2ZZBA 1S2QA 3F8PA 4WX1A 3AEGA 4XWRA 1NG3A 4B64A 2YG7A 3K7MX 2DW7A 3HPFA 1K4QA 1GT8A 1TE6A 3H8LA 4C77A 2PP1A 1L8PA 3FVDA 1TDNA 1ELIA 4IV9A 2C3CA 2BS3A 2WQYA 3T31A 3VCNA 4ZN0A 2R0PA 1R0MA 3DG3A 5M0ZA 4C74A 1ZMCA 2NQLA 3NTDA 1NG4A 4GYPC 4MKSA 1DNCA 3HW2A 3EKGA 4FP1A 2C7GA 3ISHA 1DOBA 4EQSA 3HZLA 1GRFA 1N4WA 2FKPA 1XANA 4MJWA 2JK6A 1JRZA 1XHCA 3VFCA 1KSUA 1ZXIC 1UKVG 2X8CA 3S5SA 3UTFA 1JU2A 3V76A 2V6OA 1FHUA 3B3RA 3GYIA 2YQUA 2PTZA 3UOYA 3C4NA 2BCPA 1N5WC 1NHSA 3SXIA 1D5TA 3DJGX 2XH4A 2GGGA 3DFYA 4DHGA 2PP3A 3CXBA 3DDMA 1M6IA 1PXCA 2CULA 2PSNA 2YG3A 4AT2A 1H7XA 4KPRA 2WESA 4G8TA 3GRTA 3T8QA 2OLOA 1N61C 2ONEA 4USRA 4IA6A 2GGJA 1PJ5A 3UKAA 2QA1A 2JB1A 1GNDA 1BGJA 4IHCA 3NTAA 1PJ6A 2GR0A 1MXTA 4APNA 2FYMA 1GREA 4JHMA 4IVOB 4IP4A 1K0IA 2XVJA 1KNRA 4K5SA 3R11A 2HZGA 3FV9A 4M52A 4GF7A 2OX4A 3GC2A 2YM1A 2HXUA 1COYA 1KF6A 4U2SA 3URHA 1N5XA 1TYTA 1L9CA 2VQBA 2IIDA 3M13A 4UDQA 3QVPA 2XDOA 2R0GA 2OLAA 4NEVA 1FOHA 1W6TA 4USQA 1F8WA 4J2WA 4IT1A 2APGA 2QAEA 4JY3A 4U8KA 3H8IA 1RM6B 3N4FA 4U2TA 3AXBA 4TVYA 2QA2A 4H4WA 3G5RA 3G5QA 4ENLA 1OJCA 4IA5A 3UKKA 1LPFA 3LJPA 3LZWA 1WUFA 1L0VA 3DJEA 3RCYA 4JDRA 3KD9A 3LB8A 1FEAA 2WOVA 3LOVA 1FFVC 4GAVA 4AT0A 4YT0A 1BWCA 4K7ZA 1FEBA 2A87A 4G9KA 2NVKX 3ZVHA 3NXLA 1MOKA 2B9YA 1KCZA 1RVKA 2H88A 4J34A 3A7UA 4CCRA 2WDQA 4YWSA 4OPCA 2V3BA 3D47A 3ITJA 4OPGA 7ENLA 3QSSA 2PP0A 3ENLA 2FJBA 4P9SA 3T0KA 1VDCA 5HY5A 3U4FA 1EC9A 2WP9A 3ZVHB 2BC0A 2VZ2A 1EL5A 4HCLA 3QFBA 1E7PA 4Z25A 1SJCA 4DXKA 4H19A 4TLZA 2WDVA 3UJSA 2A89A 4UDPA 1CHUA 3P4SA 4HCDA 1V97A 1KKOA 4EQWA 2W3RA 2PGEA 2Z5YA 4H2QA 2P8BA 1TRBA 5KOWA 3DFHA 3B6DA 2XLTA 1ZY8A 4H4PA 3GSIA 3AN1A 3UOZA 1MNSA 2B7RA 5HHFA 3ICSA 3JVAA 3MSYA 1KD0A 4IZGA 4B69A 3EF6A 1KN0A 3AYJA 4H4YA 2ACZA 4NWZA 1OJTA 3TJ4A 2PTXA 4A6NA 3A7AA 1DODA 3ATQA 4U8IA 1X2GA 3ADAB 4FX9A 4PAAA 4HCHA 5ER0A 4Z2RA 2BA9A 1GALA 3RNMA 2E3TA 3ALMA 3DEQA 3QPEA 4YKFA 2OZTA 1H84A 2GR3A 4ZA0A 1EC7A 4A6NB 3CNTA 5EOWA 3DG6A 3EANA 2J3NA 4D04A 1CC2A 3VCCA 3GYJA 2YG6A 4MMWA 3AWIA 2TPRA 1ZK7A 3Q6JA 1OEPA 2C76A 3K7TA 2WP6A 2BYBA 2YM2A 4HNCA 3GYXA 4HB9A 3V3WA 4GUVA 1DOCA 3H70A 3PFRA 4X9MA 1YQ4A 2EQ9A 1BGNA 2XFQA 2C70A 1ZOYA 3UKLA 4YTNA 2DKHA 3L1RA 3ZVIA 4EQRA 2JB3A 1NHRA 3LXDA 3GD3A 4Z44A 3IJQA 3QFAA 3REDA 3RRAA 4NTEA 1PHHA 3L8KA 2OG9A 5KWFA 3IK4A 1VDVA 4RG4A 4AOSA 4LU6A 2R9ZA 1D4EA 1PBDA 5DBJA 4LA1A 2X50A 4DSGA 3B9JB 3SZFA 5CKUA 3NK0X 3CN8A 2GH5A 4Y4NA 3TWAA 4Z26A 3H4KA 4DYEA 3NZGA 3HYXA 3AE1A 3UJRA 3IC9A 3GMBA 2VVLA 1NHPA 5EU9A 1L9EA 2OA1A 3V3NA 4EMJA 3AD7B 2OKTA 3D8XA 3SQPA 3ZDNA 3IJIA 1ZX9A 1PBBA 2YR5A 1GEUA 5EB4A 2C65A 4JNAA 2B76A 4GFIA 1JEHA 2VRLA 3KPFA 1E39A 1FFUC 2OLNA 2GB0A 2WU2A 4JY2A 2PTYA 3PWIA 4EMWA 2JB2A 4GAPA 4K1WA 3BOXA 1JRYA 3NLCA 2OPJA 3AMZA 4E4FA 1WUEA 3ES8A 4OPDA 4Y4MA 1LV0A 5FS7A 3N6JA 4AP1A 5HXIA 3UXLA 1GRHA 4ROPA 3ZLHA 2BRAA 2EQ8A 3DERA 3RHAA 2WOWA 3SZWA 3T9PA 4A99A 3M0OA 3NO1A 3R25A 4KPLA 1E9IA 3CGDA 4JNQA 1NHQA 3CXOA 2AKMA 1H7WA 1IJHA 4PABA 4JN8A 3AE2A 4JQ9A 1B37A 4B1BA 3CT2A 1E1LA 2XGZA 4KT2A 1RP0A 3T14A 3BHKA 3GD4A 1E1MA 1PDYA 1O5WA 4A65A 1SJBA 3JZUA 4A3RA 5KVIA 2BXSA 4X2PA 3NN0X 3T2YA 2PODA 4B65A 1QLBA 2QQ6A 5M10A 3D9XA 3CGBA 3R10A 4DGKA 4M0XA 2POZA 1ZP0A 2OALA 3AEBA 3QLDA 3SZCA 4A9WA 4GCMA 3VR8A 4FK1A 2BK4A 2TMDA 3DJDA 2GSHA 3I3LA 1LQTA 3FG2P 2E5VA 4YSXA 1M64A 1F3PA 2VRMA 3AE5A 4A79A 3RGTA 4MGGA 1H86A 1B4VA 2YVGA 5HYMA 3DK9A 1VQZA 3PS9A 4HNLA 3S5WA 3P93A 2ARDA 2YLXA 4H2PA 2GMJA 2XVFA 2WETA 2YG5A 2IVEA 2C75A 1FECA 3Q9TA 4HYRA 1PBCA 1XDIA 3CPJG 3G5SA 1EBDA 2PU1A 3KLJA 3IWAA 1LQUA 1PDHA 4M6UA 4YWOA 1ECQA 1CL0A 5IDZA 1SEZA 2VOUA 3NH3X 1IUVA 1ONEA 2WPCA 5G5GB 4N9XA 2QDEA 2ZC8A 2Q0KA 5KRQA 3BSMA 4XXGA 2B7SA 4KEMA 4H4XA 4H4UA 3GRSA 2FBWA 1MDRA 2DKIA 2BRYA 3UKFA 3NVWB 1QO8A 4B63A 3FIMB 2QCUA 2BCGG 3UOVA 2IVDA 4EWJA 3MQTA 5FMHA 2BS4A 3S61A 5KVHA 1DJQA 1X31B 1ZMDA 2WOIA 2X3NA 2FJDA 2VVLG 3SX6A 3QTPA 1GRAA 3QKEA 2C66A 2E1MA 2PS2A 4K2SA 1PXAA 4NEWA 5KNLA 3NGCX 1GRGA 4CY6A 5G5HB 1JRXA 4JN9A 3C4AA 2Q0LA 2RGJA 1OJDA 4K8DA 3B97A 3QN3A 1NU5A 4U8NA 4B68A 4H2NA 3CGCA 1LTXR 3ATRA 3ZLGA 3I6DA 3LADA 2GEWA 4J36A 4U8LA 3KA7A 2YLSA 3RITA 4BURA 1GRTA 2OVLA 3VA8A 5JCMA 2V61A 4O5UA 1SB3B 4A5LA 1D4CA 3P4QA 2WDRA 3D1CA 4LIIA 1KKRA 3Q4DA 4CNJA 3NKSA 3V5FA 2GRTA 4BV6A 1K0JA 4Z17A 1KSSA 1XPQA 4Z1YA 2W54A 3ABVA 2RGHA 4U8JA 4TM4A 3NVVB 4BK1A 2Y6RA 2I5QA 3RR1A 3GO2A 3UKHA 3R07C 3TW9A 1FIQB 1B8SA 2BS2A 3SR6B 2C4CA 2YG4A 4FK1C 3ALJA 4OPTA 3IHMA 5JCIA 2GAHB 3VQRA 4GGBA 3T37A 5U63A 2P0IA 3NFUA 1JDFA 2X8GA 5EBKA 4A35A 1O95A 3PWGA 2C72A 2E4GA 1YKJA 1H2IA 5JCKA 3QJ4A 3BNMA 1Q9IA 3UCLA 2AR8A 4G6GA 2C3DA 2C73A 1LJ1A 2RGOA 4TM1A 3FYYA 4YSZA 1GXFA 2RDXA 3T4WA 5IPYA 3IJLA 3KVEA 3TWBA 4TVWA 3O0HA 2R45A 1S3BA 1VRQB 2YWLA 4EMIA 2R46A 4AP3A 4H1ZA 3HYWA 3QVRA 5FS8A 1YQ3A 2XYOA 1GRBA 2YVFA 1ELSA 4X9NA 5C3JA 3ICRA 3NYCA 3KKJA 1GOSA 2QJJA 3H7VA 4J33A 4C3XA 5EB5A 1Q1RA 4NTCA 2GL5A 4H4RA 3DGBA 4RG3A 4H4ZA 3RP7A 3AE8A 1H81A 4EIPA 3VRBA 2P3ZA 4EQXA 4ECHA 2A8XA 2B9WA 4O5QA 2XVIA 2WP5A 3SN4A 3IF9A 5FS9A 1KFYA 2YLTA 3OZ2A 3NHOX 2XFNA 5ENLA 3P9UA 3OPSA 4FI4A 2PMQA 2PTWA 3GWDA 4UP3A 1E1NA 2R4EA 3CB3A 2EQ7A 5KOXA 3NYFA 4A6GA 2YAUA 4J3ZA 4TM3A 3BI2A 4H4QA 2QJMA 4G74A 4FDCB 3DH9A 4GRTA 1K0LA 3NIXA 2F5ZA 4X4JA 1BKHA 1YQZA 2I0ZA 3M12A 3AE7A 3I6EA 4REKA 4YSHA 3NNEA 1EL8A 3VRAA 2V60A 3CK5A 3V5CA 2AQJA 3AECA 5J60A 2NPXA 3CGEA 4BJZA 3CIRA 1T3QC 3QSEA 4BK3A 1F9CA 5BRTA 1HYUA 2XLRA 3FCPA 5JRBA 1F6MA 1YEYA 3MWCA 4B66A 1GERA 4TLXA 2HNEA 4J1OA 1PN0A 1F8SA 1GV4A 2BABA 2AAQA 1CJCA 4II2A 4KWSA 3SSZA 2O56A 1GTEA 1CC6A 1TKKA 4IVMB 4J31A 4GR1A 4E4UA 3PO7A 4K22A 4I59A 1JPDX 1PJ7A 3CMMA 1R6WA 2WU5A 2GGHA 1GTHA 3OC4A 2FJEA 3LZXA 2XSXA 4YXDA 4G73A 2DW6A 4DN1A 1B5QA 1D4DA 3UGVA 1VQWA 3R1ZA 3CPIG 3UJFA 2GR1A 5FJUA 3NVZB 1TDKA 3AE6A 2VVMA 3AYIA 1XS2A 5BOFA 3UP5A 3S47A 3AE4A 2Q6UA 1N4UA 2PCEA 2YR6A 1PS9A 4H4SA 2Z5XA 4HN8A 3AE3A 3CNSA 2XFPA 2R0CA 3GY1A 1MRAA 5FJOA 3UJ2A 5IQ1A 3WE0A 4H4VA 2AL1A 1PBFA 2WS3A 1PBEA 3MY9A 3N4EA 3UTHA 4II3A 2V3AA 2GAGB 2XCGA 5LV9A 3NK1X 3PK7A 2PYXA 3UP4A 3AE9A 1OJ9A 2X8HA 5GRTA 3SJNA 2P88A 3UOXA 5L46A 3TJIA 1AOGA 4U8MA 4GGHA 4J57A 1W4XA 2GGEA 2YVJA 4ZCDA 3SYIA 2GDQA 4DWDA 1JCTA 4BK2A 1JPMA 1SJAA 2XLUA 3I4KA 3CYJA 2GQWA 3KPKA 2V5ZA 3DMEA 4GDEA 2YLZA 3JW7A 1TYPA 3STPA 5TR3A 3T2KA 4NNJA 3BI4A 4Y4LA 1CC4A 4GDPA 3ES7A 2GMHA 2RABA 2XLSA 3CNDA 1STZA 2WPEA 2YLWA 3K30A 1KNPA 4RSLA 3SFEA 2WBAA 3UCDA 4KX6A 2PGWA 4DNAA 2JAEA 4G7FA 1JROA 5C2TA 4ICYA 4C5OA 1XPYA 3A7RA 3THUA 3VC5A 4HPNA 5U1OA 4H7UA 1GPEA 3UTGA 1CJ3A 2ZADA 3BJSA 1IUTA 1ZKQA 1FO4A 4IP5A 5JCNA 1VG9A 4K5RA 4H4TA 3AEFA 3NK2X 3SQSA 3NRZB 3AEEA 4ZOHB 4DSHA 1Y0PA
chains in the Genus database with same CATH topology
3UKHA 3II4A 1B8SA 3CTYA 4X9MA 2BS2A 5KMPA 4U8OA 1YQ4A 2CDUA 2EQ9A 1DXLA 1BGNA 5FS6A 1TDOA 1YY5A 2C4CA 2C70A 2XFQA 2YG4A 1ZOYA 5KXJA 5BVAA 3UKLA 3AYLA 4FK1C 4YTNA 2DKHA 3L1RA 5BUKA 3FPZA 3AD9B 3GDPA 3ALJA 3NYEA 4EQRA 4OPTA 1FCDA 2JB3A 3IHMA 1NHRA 3LXDA 5JCIA 4D03A 2BXRA 2ZZBA 2JBVA 2GAHB 1S2QA 4EM4A 3SFDA 3VQRA 2YR4A 3GD3A 1E1KA 3F8PA 3V3OA 2B9XA 3T2ZA 4Z44A 3REDA 3QFAA 3SGLA 4WX1A 3AEGA 1BZLA 5J7XA 4XWRA 1NG3A 4Z24A 4NTEA 3T37A 4B64A 1PHHA 5U63A 5IQ4A 3L8KA 2YG7A 5EBKA 2X8GA 3K7MX 1O95A 1H83A 2C72A 5KWFA 1JNZA 3UKQA 2E4GA 1K4QA 1YKJA 3NT6A 1GT8A 4RG4A 4AOSA 1H2IA 1N1PA 2O9ZA 1NAAA 3H8LA 4C77A 5JCKA 3QJ4A 3L5OA 1BF3A 4LU6A 2R9ZA 4G6HA 1D4EA 1PBDA 2BK5A 3BNMA 1Q9IA 5DBJA 4J56A 1ELIA 1TDNA 3UCLA 2AR8A 4IV9A 4G6GA 4CRTA 4LA1A 2X50A 4BJYA 1NPXA 2C3CA 2BS3A 2C3DA 2C73A 4DSGA 5U25A 2WQYA 3T31A 1LJ1A 2RGOA 3SZFA 4TM1A 4YSZA 4ZN0A 1GXFA 2R0PA 3P4PA 5CKUA 5IPYA 1S3EA 1MO9A 4B67A 3NK0X 3KVEA 3O0HA 2R45A 3CN8A 5M0ZA 1LVLA 4C74A 2GH5A 4E0VA 1TDEA 1S3BA 1ZMCA 1VRQB 4U2LA 2YWLA 4EMIA 2R46A 4Y4NA 4AP3A 3HYWA 3NG7X 3QVRA 3NTDA 1NG4A 5FS8A 1YQ3A 2XYOA 1GRBA 2YVFA 3R9UA 4X9NA 4Z26A 3H4KA 3DA1A 5C3JA 3ICRA 3NYCA 1DNCA 3KKJA 1GOSA 3DGHA 2XFUA 3HYXA 4J33A 4C3XA 2CFYA 2Y6QA 4OPLA 5EB5A 4Z2TA 2WPFA 1Q1RA 2C7GA 3ISHA 3AE1A 3ALLA 2W0HA 4EQSA 1DOBA 1GRFA 3HZLA 3P1WA 4NTCA 3IC9A 3GMBA 2VVLA 4H4RA 1NHPA 1BKWA 1L9EA 2OA1A 4RG3A 3V3NA 1N4WA 4H4ZA 3RP7A 1XANA 1IUWA 4EMJA 1CF3A 3AE8A 3AD7B 4MJWA 1H81A 4EIPA 2JK6A 1JRZA 3VRBA 3D8XA 4EQXA 3UTEA 1GSNA 2GR2A 4ECHA 2YLRA 2A8XA 3SQPA 2B9WA 4O5QA 3ZDNA 1XHCA 2XVIA 2WP5A 1ZX9A 1PBBA 1KSUA 2YR5A 3IF9A 1GEUA 5FS9A 1UKVG 1KFYA 5EB4A 2X8CA 3PG6A 2C65A 2R4JA 2YLTA 3BHFA 3OZ2A 3NHOX 4JNAA 3UTFA 1JU2A 2GF3A 2XFNA 2V6OA 1VG0A 4WCTA 3V76A 3P9UA 2B76A 3B3RA 2BK3A 3GYIA 1FL2A 2YQUA 1IUUA 3UOYA 3C4NA 3KU9A 2BCPA 3GWDA 4UP3A 1NHSA 1E1NA 2R4EA 1JEHA 1D5TA 2EQ7A 2C67A 3SXIA 2HQMA 5KOXA 2VRLA 3DJGX 3KPFA 1E39A 3NYFA 3RP6A 2ZZCA 1L9DA 2YAUA 3HYVA 2OLNA 4TM3A 2GB0A 1REOA 3BI2A 4H4QA 2ZBWA 2WU2A 4JY2A 1F8RA 3GWFA 4EMWA 2JB2A 1V59A 3JSKA 4FDCB 4G74A 4GAPA 1M6IA 1JRYA 3DH9A 4GRTA 1K0LA 1PXCA 1RYIA 2CULA 3NIXA 3NN6X 3NLCA 1JOAA 2YG3A 4Z2UA 2F5ZA 3F8DA 3AEDA 4AT2A 4X4JA 1H7XA 4OPDA 1YQZA 4KPRA 2I0ZA 1TDFA 3M12A 2WESA 4Y4MA 4HA6A 3AE7A 1LV0A 5FS7A 3GRTA 5CQFA 4REKA 4B69A 4YSHA 2OLOA 3NNEA 4AP1A 4USRA 3QSMA 1EL8A 4IA6A 4NTDA 2V60A 3VRAA 2H89A 5HXIA 1PJ5A 3UKAA 1GRHA 2QA1A 2AQJA 3AECA 5J60A 1H6VA 2NPXA 2JB1A 2BRAA 1GNDA 4Z43A 1BGJA 2EQ8A 3RHAA 3CGEA 4BJZA 3CIRA 3NTAA 3QSEA 1PJ6A 2WOWA 4NZHA 4BK3A 2GR0A 1HYUA 5BRTA 1KDGA 1Z6LA 3SZWA 2XLRA 4A99A 3M0OA 5JRBA 1MXTA 2GV8A 2JKCA 4APNA 1F6MA 3CPHG 1D7YA 1GREA 4IVOB 2C64A 1IUSA 1K0IA 5KMQA 3CGDA 4B66A 1GERA 4TLXA 4CNKA 2XVJA 1QJDA 3F8RA 1PN0A 4JNQA 1NHQA 1F8SA 1GV4A 1KNRA 2BABA 4K5SA 1H7WA 2AAQA 1NDAA 1IJHA 4YKGA 4PABA 1CJCA 3AE2A 4II2A 4JQ9A 1B37A 4B1BA 1E1LA 1GTEA 1CC6A 4IVMB 1RP0A 4J31A 4GR1A 4K22A 3PO7A 4I59A 3T14A 4M52A 3BHKA 1Y56A 3GD4A 1PJ7A 4GF7A 1E1MA 3GDNA 3CMMA 1O5WA 4A65A 3BI5A 5KVIA 2BXSA 2YM1A 3NN0X 2WU5A 1D7LA 3T2YA 1GTHA 3OC4A 2FJEA 1COYA 4B65A 1QLBA 3LZXA 5M10A 3D9XA 4YXDA 3CGBA 4G73A 1KF6A 4U2SA 3URHA 4DGKA 5JCLA 3FMWA 1RSGA 1L9CA 1TYTA 1B5QA 1D4DA 2VQBA 1ZP0A 2OALA 3AEBA 2IIDA 3DK8A 1ZOVA 3SZCA 4A9WA 3M13A 4GCMA 4UDQA 3QVPA 1Y56B 1VQWA 2XDOA 4EIQA 3CPIG 2R0GA 3VR8A 4FK1A 1Q1WA 1EL7A 2BK4A 2UZZA 4TM0A 1JNRA 2TMDA 3DJDA 4OPIA 2GR1A 3I3LA 1LQTA 3EAOA 4NEVA 2Q7VA 1FOHA 1O94A 2FJAA 1TDKA 4USQA 1S2YA 3AE6A 3FG2P 1F8WA 2VVMA 3AYIA 2E5VA 4YSXA 4J2WA 1M64A 1F3PA 1ZDLA 2VRMA 2APGA 3UP5A 2QAEA 5KMSA 3AE5A 3AE4A 4H2RA 2Q6UA 4A79A 4JY3A 1N4UA 4U8KA 3H8IA 2VQ7A 2XFOA 1H86A 1CBOA 5KMRA 1B4VA 2YVGA 1PS9A 2YR6A 4H4SA 3DK9A 2Z5XA 4U2TA 3AE3A 3CNSA 5HYMA 2XFPA 3PS9A 2R0CA 3S5WA 3AXBA 3SY4A 2ARDA 2YLXA 2OAMA 2QA2A 4H2PA 2GMJA 4H4WA 3G5RA 3G5QA 1OJCA 4IA5A 4YTPA 3P4RA 3UKKA 1LPFA 2XVFA 3LJPA 5IQ1A 4I58A 2GQFA 2WETA 2YG5A 3LZWA 2IVEA 2C75A 1L0VA 3DJEA 1FECA 3WE0A 4JDRA 3Q9TA 4H4VA 3KD9A 3LB8A 1XDIA 1PBCA 4CBQA 3NRNA 1FEAA 2BC1A 2WOVA 3CPJG 3E1TA 3G5SA 3LOVA 1PBFA 2WS3A 1PBEA 1CJ4A 1EBDA 1E6EA 1H82A 4GAVA 3UTHA 4AT0A 3KLJA 3RP8A 4II3A 3IWAA 4ADWA 4YT0A 2V3AA 1BWCA 1IUXA 4K7ZA 1LQUA 1FEBA 1DOEA 2A87A 1PDHA 2GAGB 2XCGA 3NK1X 5LV9A 4YWOA 3EPTA 4G9KA 2NVKX 3K7QX 2WHDA 5GSNA 2PYXA 2XLPA 1CL0A 3UP4A 3UKPA 1MOKA 1SEZA 2B9YA 2EQ6A 2VOUA 2H88A 3AE9A 1OJ9A 4J34A 2X8HA 3NH3X 4CCRA 2WDQA 1IUVA 5GRTA 4OPCA 2V3BA 3ICTA 3VRDB 3UOXA 2WPCA 5L46A 3ITJA 3FBSA 4N9XA 4OPGA 1ONFA 3QSSA 1AOGA 2Q0KA 5KRQA 2FJBA 4U8MA 4XXGA 4OVIA 2B7SA 4C3YA 4P9SA 3T0KA 1VDCA 2BACA 1GESA 3GMCA 4J57A 4H4XA 1W4XA 4H4UA 2YVJA 3GRSA 2FBWA 5HY5A 4ZCDA 2WP9A 3SYIA 2BC0A 2VZ2A 1EL5A 2DKIA 2BRYA 3UKFA 3QFBA 3VR9A 1E7PA 4ZCCA 4Z25A 1QO8A 4B63A 4TLZA 2WDVA 3FIMB 4BK2A 2GVCA 1CJ2A 1PXBA 2QCUA 3ZYXA 2BCGG 3UOVA 2IVDA 2A89A 4UDPA 1CHUA 3P4SA 2WEUA 5FMHA 2XLUA 4EQWA 2BS4A 3SM8A 2Z5YA 2GQWA 3COXA 4H2QA 3S61A 1TRBA 5KOWA 5KVHA 2PHHA 1DJQA 1X31B 1ZMDA 3B6DA 2XLTA 3KPKA 1ZY8A 2WOIA 2V5ZA 3DMEA 4H4PA 4GDEA 3BNUA 2YLZA 4CCQA 2X3NA 3GSIA 1TYPA 2FJDA 2VVLG 3UOZA 5TR3A 2B7RA 1DJNA 3SX6A 1GRAA 2C66A 3T2KA 5BULA 4OCGA 2E1MA 5HHFA 4NNJA 3BI4A 3ICSA 1N4VA 1PXAA 4Y4LA 3EF6A 4YTMA 1CC4A 4K2XA 1GETA 1KN0A 4NEWA 4GDPA 3NGCX 4U8PA 5KNLA 2GMHA 4YSYA 1P2HA 1GRGA 3AYJA 3SZ0A 4CY6A 2RABA 2XLSA 3CNDA 3PVCA 2WPEA 1JRXA 2YLWA 4H4YA 1KNPA 2ACZA 3K30A 4NWZA 1OJTA 4JN9A 3C4AA 4RSLA 3SFEA 4A6NA 2WBAA 2Q0LA 4U8IA 1DODA 3ATQA 4KX6A 2RGJA 4DNAA 1OJDA 4K8DA 3ADAB 2JAEA 4U8NA 4B68A 4H2NA 4FX9A 4PAAA 5ER0A 4Z2RA 3CGCA 3DK4A 1LTXR 2BA9A 2X99A 3ATRA 1S7MA 3I6DA 5C2TA 3LADA 2GEWA 4J36A 3DGZA 1GALA 4U8LA 4ICYA 3CNPA 3CNJA 3RNMA 4C5OA 3KA7A 1OJAA 3IHGA 3ALMA 2YLSA 4BURA 4YKFA 1H84A 5U1OA 1GRTA 4H7UA 3DJJA 2GR3A 5JCMA 2V61A 1GPEA 4O5UA 4A6NB 3UTGA 3CNTA 4A5LA 1CJ3A 5EOWA 3EANA 2J3NA 1NENA 1IUTA 1D4CA 3P4QA 4AOXA 4D04A 2WDRA 3D1CA 1ZKQA 2ZZ0A 1CC2A 4LIIA 4EM3A 3AB1A 4A7AA 2XVEA 3GYJA 4CNJA 2YG6A 1NEKA 3NKSA 3AWIA 2CVJA 2TPRA 2GRTA 4BV6A 1ZK7A 3Q6JA 2XVHA 2C76A 5JCNA 1K0JA 1VG9A 1KSSA 3K7TA 4K5RA 1XPQA 2WP6A 4H4TA 3AEFA 3NK2X 4CY8A 1P2EA 2BYBA 2YM2A 3ABVA 3GYXA 3AEEA 2RGHA 4UDRA 4U8JA 4TM4A 4HB9A 4BK1A 2Y6RA 3AEAA 4GUVA 4H50A 3AD8B 1DOCA 1EL9A 4XWZA 4DSHA 3C96A 4OPUA 1Y0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKH A;  3II4 A;  1B8S A;  3CTY A;  4X9M A;  2BS2 A;  4U8O A;  1YQ4 A;  2CDU A;  2EQ9 A;  1DXL A;  1BGN A;  5FS6 A;  1TDO A;  1YY5 A;  2C70 A;  2XFQ A;  2YG4 A;  5KXJ A;  1ZOY A;  5BVA A;  3UKL A;  3AYL A;  4FK1 C;  4YTN A;  2DKH A;  3L1R A;  5BUK A;  3FPZ A;  3AD9 B;  3GDP A;  3ALJ A;  3NYE A;  4EQR A;  4OPT A;  1FCD A;  2JB3 A;  3IHM A;  1NHR A;  3LXD A;  5JCI A;  4D03 A;  2BXR A;  2ZZB A;  2JBV A;  2GAH B;  1S2Q A;  4EM4 A;  3SFD A;  3VQR A;  2YR4 A;  3GD3 A;  1E1K A;  3F8P A;  2B9X A;  4Z44 A;  3RED A;  3QFA A;  3SGL A;  4WX1 A;  3AEG A;  1BZL A;  5J7X A;  4XWR A;  1NG3 A;  4Z24 A;  4NTE A;  3T37 A;  4B64 A;  1PHH A;  5U63 A;  5IQ4 A;  3L8K A;  2YG7 A;  5EBK A;  2X8G A;  3K7M X;  1O95 A;  1H83 A;  2C72 A;  5KWF A;  1JNZ A;  3UKQ A;  2E4G A;  1K4Q A;  1YKJ A;  3NT6 A;  1GT8 A;  4RG4 A;  4AOS A;  1N1P A;  3H8L A;  2O9Z A;  1NAA A;  4C77 A;  5JCK A;  3QJ4 A;  1BF3 A;  4LU6 A;  2R9Z A;  1D4E A;  1PBD A;  2BK5 A;  3BNM A;  1Q9I A;  5DBJ A;  4J56 A;  1ELI A;  1TDN A;  3UCL A;  2AR8 A;  4IV9 A;  4CRT A;  4LA1 A;  2X50 A;  4BJY A;  1NPX A;  2C3C A;  2BS3 A;  2C3D A;  2C73 A;  4DSG A;  5U25 A;  2WQY A;  1LJ1 A;  2RGO A;  4TM1 A;  4YSZ A;  4ZN0 A;  1GXF A;  2R0P A;  3P4P A;  5CKU A;  5IPY A;  1S3E A;  1MO9 A;  4B67 A;  3NK0 X;  3KVE A;  3O0H A;  2R45 A;  3CN8 A;  5M0Z A;  1LVL A;  4C74 A;  2GH5 A;  4E0V A;  1TDE A;  1S3B A;  1ZMC A;  1VRQ B;  4U2L A;  2YWL A;  4EMI A;  2R46 A;  4Y4N A;  4AP3 A;  3NG7 X;  3QVR A;  3NTD A;  1NG4 A;  5FS8 A;  1YQ3 A;  2XYO A;  1GRB A;  2YVF A;  3R9U A;  4X9N A;  4Z26 A;  3H4K A;  3DA1 A;  5C3J A;  3ICR A;  3NYC A;  1DNC A;  3KKJ A;  1GOS A;  3DGH A;  2XFU A;  4J33 A;  4C3X A;  2CFY A;  2Y6Q A;  4OPL A;  5EB5 A;  4Z2T A;  2WPF A;  1Q1R A;  2C7G A;  3ISH A;  3AE1 A;  3ALL A;  2W0H A;  4EQS A;  1DOB A;  1GRF A;  3HZL A;  3P1W A;  4NTC A;  3IC9 A;  3GMB A;  2VVL A;  4H4R A;  1NHP A;  1BKW A;  1L9E A;  2OA1 A;  4RG3 A;  3V3N A;  1N4W A;  4H4Z A;  3RP7 A;  1XAN A;  1IUW A;  4EMJ A;  1CF3 A;  3AE8 A;  3AD7 B;  4MJW A;  1H81 A;  4EIP A;  2JK6 A;  1JRZ A;  3VRB A;  3D8X A;  4EQX A;  3UTE A;  1GSN A;  2GR2 A;  4ECH A;  2YLR A;  2A8X A;  3SQP A;  2B9W A;  4O5Q A;  3ZDN A;  1XHC A;  2XVI A;  2WP5 A;  1ZX9 A;  1PBB A;  1KSU A;  2YR5 A;  3IF9 A;  1GEU A;  5FS9 A;  1UKV G;  1KFY A;  5EB4 A;  2X8C A;  2C65 A;  2R4J A;  2YLT A;  3BHF A;  3OZ2 A;  3UTF A;  3NHO X;  4JNA A;  3V3O A;  1JU2 A;  2GF3 A;  2XFN A;  2V6O A;  1VG0 A;  4WCT A;  3V76 A;  3P9U A;  2B76 A;  3B3R A;  2BK3 A;  3GYI A;  1FL2 A;  2YQU A;  1IUU A;  3UOY A;  3C4N A;  3KU9 A;  2BCP A;  3GWD A;  4UP3 A;  1NHS A;  1E1N A;  2R4E A;  1JEH A;  1D5T A;  2EQ7 A;  2C67 A;  5KOX A;  2HQM A;  2VRL A;  3DJG X;  3KPF A;  1E39 A;  3NYF A;  3RP6 A;  2ZZC A;  1L9D A;  2YAU A;  2OLN A;  4TM3 A;  2GB0 A;  1REO A;  3BI2 A;  4H4Q A;  2ZBW A;  2WU2 A;  4JY2 A;  1F8R A;  3GWF A;  4EMW A;  2JB2 A;  1V59 A;  3JSK A;  4FDC B;  1M6I A;  1JRY A;  3DH9 A;  4GRT A;  1K0L A;  1PXC A;  1RYI A;  2CUL A;  3NIX A;  3NN6 X;  3NLC A;  1JOA A;  2YG3 A;  4Z2U A;  2F5Z A;  3F8D A;  3AED A;  4AT2 A;  4X4J A;  1H7X A;  4OPD A;  1YQZ A;  4KPR A;  2I0Z A;  1TDF A;  3M12 A;  2WES A;  4Y4M A;  4HA6 A;  3AE7 A;  1LV0 A;  5FS7 A;  3GRT A;  5CQF A;  4REK A;  4B69 A;  4YSH A;  2OLO A;  3NNE A;  4AP1 A;  4USR A;  3QSM A;  1EL8 A;  4IA6 A;  4NTD A;  2V60 A;  3VRA A;  2H89 A;  5HXI A;  1PJ5 A;  3UKA A;  1GRH A;  2QA1 A;  2AQJ A;  3AEC A;  5J60 A;  1H6V A;  2NPX A;  2JB1 A;  4Z43 A;  1GND A;  1BGJ A;  2EQ8 A;  3RHA A;  3CGE A;  4BJZ A;  3CIR A;  3NTA A;  3QSE A;  1PJ6 A;  2WOW A;  4NZH A;  4BK3 A;  2GR0 A;  1HYU A;  5BRT A;  1KDG A;  1Z6L A;  2XLR A;  4A99 A;  3M0O A;  1MXT A;  2GV8 A;  2JKC A;  4APN A;  1F6M A;  3CPH G;  1D7Y A;  1GRE A;  4IVO B;  2C64 A;  1IUS A;  1K0I A;  3CGD A;  4B66 A;  1GER A;  4TLX A;  4CNK A;  2XVJ A;  1QJD A;  3F8R A;  1PN0 A;  4JNQ A;  1NHQ A;  1F8S A;  1GV4 A;  1KNR A;  2BAB A;  4K5S A;  1H7W A;  2AAQ A;  1NDA A;  1IJH A;  4YKG A;  4PAB A;  1CJC A;  3AE2 A;  4JQ9 A;  1B37 A;  4B1B A;  1E1L A;  1GTE A;  1CC6 A;  4IVM B;  1RP0 A;  4J31 A;  4GR1 A;  4K22 A;  3PO7 A;  4I59 A;  4M52 A;  3BHK A;  1Y56 A;  3GD4 A;  1PJ7 A;  4GF7 A;  1E1M A;  3GDN A;  1O5W A;  4A65 A;  3BI5 A;  5KVI A;  2BXS A;  2YM1 A;  3NN0 X;  2WU5 A;  1D7L A;  1GTH A;  3OC4 A;  2FJE A;  1COY A;  4B65 A;  1QLB A;  3LZX A;  5M10 A;  4YXD A;  3CGB A;  1KF6 A;  4U2S A;  3URH A;  4DGK A;  5JCL A;  3FMW A;  1RSG A;  1L9C A;  1TYT A;  1B5Q A;  1D4D A;  2VQB A;  1ZP0 A;  2OAL A;  3AEB A;  2IID A;  3DK8 A;  1ZOV A;  4A9W A;  3M13 A;  4GCM A;  4UDQ A;  3QVP A;  1Y56 B;  1VQW A;  2XDO A;  4EIQ A;  3CPI G;  2R0G A;  3VR8 A;  4FK1 A;  1Q1W A;  1EL7 A;  2BK4 A;  2UZZ A;  4TM0 A;  1JNR A;  2TMD A;  3DJD A;  4OPI A;  2GR1 A;  3I3L A;  1LQT A;  3EAO A;  4NEV A;  2Q7V A;  1FOH A;  1O94 A;  2FJA A;  1TDK A;  4USQ A;  1S2Y A;  3AE6 A;  3FG2 P;  1F8W A;  2VVM A;  3AYI A;  2E5V A;  4YSX A;  4J2W A;  1M64 A;  1F3P A;  1ZDL A;  2VRM A;  2APG A;  3UP5 A;  2QAE A;  3AE5 A;  3AE4 A;  4H2R A;  2Q6U A;  4A79 A;  4JY3 A;  1N4U A;  4U8K A;  3H8I A;  2VQ7 A;  2XFO A;  1H86 A;  1CBO A;  1B4V A;  2YVG A;  1PS9 A;  2YR6 A;  4H4S A;  3DK9 A;  2Z5X A;  4U2T A;  3AE3 A;  3CNS A;  5HYM A;  2XFP A;  3PS9 A;  2R0C A;  3S5W A;  3AXB A;  2ARD A;  2YLX A;  2OAM A;  2QA2 A;  4H2P A;  2GMJ A;  4H4W A;  3G5R A;  3G5Q A;  1OJC A;  4IA5 A;  4YTP A;  3P4R A;  3UKK A;  1LPF A;  2XVF A;  3LJP A;  5IQ1 A;  4I58 A;  2GQF A;  2WET A;  2YG5 A;  3LZW A;  2IVE A;  2C75 A;  1L0V A;  3DJE A;  1FEC A;  3WE0 A;  4JDR A;  3Q9T A;  4H4V A;  3KD9 A;  3LB8 A;  1XDI A;  1PBC A;  4CBQ A;  3NRN A;  1FEA A;  2BC1 A;  2WOV A;  3CPJ G;  3E1T A;  3G5S A;  3LOV A;  1PBF A;  2WS3 A;  1PBE A;  1CJ4 A;  1EBD A;  1E6E A;  1H82 A;  3UTH A;  4AT0 A;  3KLJ A;  3RP8 A;  3IWA A;  4ADW A;  4YT0 A;  2V3A A;  1BWC A;  1IUX A;  4K7Z A;  1LQU A;  1FEB A;  1DOE A;  2A87 A;  1PDH A;  2GAG B;  2XCG A;  3NK1 X;  5LV9 A;  4YWO A;  3EPT A;  2NVK X;  3K7Q X;  2WHD A;  5GSN A;  2PYX A;  2XLP A;  1CL0 A;  3UP4 A;  3UKP A;  1MOK A;  1SEZ A;  2B9Y A;  2EQ6 A;  2VOU A;  2H88 A;  3AE9 A;  1OJ9 A;  4J34 A;  2X8H A;  3NH3 X;  4CCR A;  2WDQ A;  1IUV A;  5GRT A;  4OPC A;  2V3B A;  3ICT A;  3VRD B;  3UOX A;  2WPC A;  5L46 A;  3ITJ A;  3FBS A;  4N9X A;  4OPG A;  1ONF A;  3QSS A;  1AOG A;  2Q0K A;  5KRQ A;  2FJB A;  4U8M A;  4XXG A;  4OVI A;  2B7S A;  4C3Y A;  4P9S A;  1VDC A;  2BAC A;  1GES A;  3GMC A;  4J57 A;  4H4X A;  1W4X A;  4H4U A;  2YVJ A;  3GRS A;  2FBW A;  5HY5 A;  4ZCD A;  2WP9 A;  2BC0 A;  2VZ2 A;  1EL5 A;  2DKI A;  3UKF A;  3QFB A;  3VR9 A;  1E7P A;  4ZCC A;  4Z25 A;  1QO8 A;  4B63 A;  4TLZ A;  2WDV A;  3FIM B;  4BK2 A;  2GVC A;  1CJ2 A;  1PXB A;  2QCU A;  3ZYX A;  2BCG G;  3UOV A;  2IVD A;  2A89 A;  4UDP A;  1CHU A;  3P4S A;  2WEU A;  5FMH A;  2XLU A;  4EQW A;  2BS4 A;  3SM8 A;  2Z5Y A;  2GQW A;  3COX A;  4H2Q A;  3S61 A;  1TRB A;  5KOW A;  5KVH A;  2PHH A;  1DJQ A;  1X31 B;  1ZMD A;  3B6D A;  2XLT A;  1ZY8 A;  2WOI A;  2V5Z A;  3DME A;  4H4P A;  4GDE A;  3BNU A;  2YLZ A;  4CCQ A;  2X3N A;  3GSI A;  1TYP A;  2FJD A;  2VVL G;  3UOZ A;  5TR3 A;  2B7R A;  1DJN A;  5BUL A;  1GRA A;  2C66 A;  4OCG A;  2E1M A;  5HHF A;  3BI4 A;  3ICS A;  1N4V A;  1PXA A;  4Y4L A;  3EF6 A;  4YTM A;  1CC4 A;  4K2X A;  1GET A;  4NEW A;  4GDP A;  4U8P A;  3NGC X;  2GMH A;  4YSY A;  1P2H A;  1GRG A;  3AYJ A;  4CY6 A;  2RAB A;  2XLS A;  3CND A;  3PVC A;  2WPE A;  1JRX A;  2YLW A;  4H4Y A;  1KNP A;  2ACZ A;  3K30 A;  1OJT A;  4JN9 A;  3C4A A;  4RSL A;  3SFE A;  4A6N A;  2WBA A;  2Q0L A;  4U8I A;  1DOD A;  3ATQ A;  4KX6 A;  2RGJ A;  4DNA A;  1OJD A;  4K8D A;  3ADA B;  2JAE A;  4U8N A;  4B68 A;  4H2N A;  4FX9 A;  4PAA A;  5ER0 A;  4Z2R A;  3CGC A;  3DK4 A;  1LTX R;  2BA9 A;  2X99 A;  3ATR A;  5C2T A;  3I6D A;  3LAD A;  2GEW A;  4J36 A;  3DGZ A;  1GAL A;  4U8L A;  4ICY A;  3CNP A;  3CNJ A;  3RNM A;  4C5O A;  3KA7 A;  1OJA A;  3IHG A;  3ALM A;  2YLS A;  4BUR A;  4YKF A;  1H84 A;  5U1O A;  1GRT A;  4H7U A;  3DJJ A;  2GR3 A;  5JCM A;  2V61 A;  1GPE A;  4O5U A;  4A6N B;  3UTG A;  3CNT A;  4A5L A;  1CJ3 A;  5EOW A;  3EAN A;  2J3N A;  1NEN A;  1IUT A;  1D4C A;  3P4Q A;  4AOX A;  4D04 A;  2WDR A;  3D1C A;  1ZKQ A;  2ZZ0 A;  1CC2 A;  4LII A;  4EM3 A;  3AB1 A;  4A7A A;  2XVE A;  3GYJ A;  4CNJ A;  2YG6 A;  1NEK A;  3NKS A;  3AWI A;  2CVJ A;  2TPR A;  2GRT A;  4BV6 A;  1ZK7 A;  3Q6J A;  2XVH A;  2C76 A;  5JCN A;  1K0J A;  1VG9 A;  1KSS A;  3K7T A;  4K5R A;  1XPQ A;  2WP6 A;  4H4T A;  3AEF A;  3NK2 X;  4CY8 A;  1P2E A;  2BYB A;  2YM2 A;  3ABV A;  3AEE A;  2RGH A;  4UDR A;  4U8J A;  4TM4 A;  4HB9 A;  4BK1 A;  2Y6R A;  3AEA A;  4GUV A;  4H50 A;  3AD8 B;  1DOC A;  1EL9 A;  4XWZ A;  4DSH A;  3C96 A;  4OPU A;  1Y0P A; 
#chains in the Genus database with same CATH topology
 3II4 A;  3CTY A;  1DXL A;  1YY5 A;  5BVA A;  3FPZ A;  3AD9 B;  1N62 C;  6ENL A;  3GDP A;  3NYE A;  1FCD A;  4F4R A;  2BXR A;  3Q45 A;  2JBV A;  4EM4 A;  3SFD A;  2YR4 A;  1E1K A;  2B9X A;  3T2Z A;  3SGL A;  5J7X A;  1BZL A;  4Z24 A;  5IQ4 A;  2AL2 A;  1H83 A;  1JNZ A;  3UKQ A;  1IYX A;  3NT6 A;  1N1P A;  2W3S A;  2O9Z A;  1NAA A;  3L5O A;  1BF3 A;  4G6H A;  2BK5 A;  4J56 A;  4CRT A;  4BJY A;  1NPX A;  5U25 A;  2GGI A;  3P4P A;  3OP2 A;  1S3E A;  1MO9 A;  4B67 A;  3OZM A;  2AL2 B;  1EBG A;  1LVL A;  4E0V A;  4K8G A;  1TDE A;  4U2L A;  3NG7 X;  3TCS A;  3R9U A;  2MNR A;  3N6H A;  3DA1 A;  3DGH A;  2XFU A;  4Z2T A;  1EC8 A;  2CFY A;  2Y6Q A;  4OPL A;  2WPF A;  3ALL A;  2W0H A;  3P1W A;  1BKW A;  3MKC A;  1N60 C;  1IUW A;  1CF3 A;  1NEL A;  3UTE A;  1GSN A;  2GR2 A;  1FHV A;  2YLR A;  2OFJ A;  3PG6 A;  2R4J A;  3BHF A;  3V3O A;  2GF3 A;  1VG0 A;  4WCT A;  2BK3 A;  2W55 A;  2PPG A;  1FL2 A;  2QVH A;  3KUM A;  1IUU A;  2OO6 A;  3KU9 A;  2HXT A;  2C67 A;  2HQM A;  3EEZ A;  3RP6 A;  2ZZC A;  1L9D A;  3HYV A;  1REO A;  2ZBW A;  4IL0 A;  3P0W A;  3GWF A;  1F8R A;  5FJR A;  3JSK A;  1V59 A;  3H12 A;  1RYI A;  3NN6 X;  1PDZ A;  1JOA A;  4Z2U A;  2QJN A;  3F8D A;  3AED A;  4H83 A;  4H2H A;  1TDF A;  3D46 A;  4HA6 A;  5CQF A;  3SBF A;  2OQH A;  3QSM A;  4NTD A;  2H89 A;  1H6V A;  4JN7 A;  4Z43 A;  3MUC A;  2OZ8 A;  4NZH A;  1KDG A;  1Z6L A;  2GV8 A;  2JKC A;  3CPH G;  1D7Y A;  2C64 A;  1IUS A;  4GME A;  3MZN A;  5KMQ A;  4CNK A;  1QJD A;  3F8R A;  3HRD C;  1P43 A;  1NDA A;  4YKG A;  3CAW A;  1Y56 A;  3GDN A;  3BI5 A;  1D7L A;  3DIP A;  1X2H A;  3FXG A;  5JCL A;  3FMW A;  1RSG A;  3OZY A;  3DK8 A;  1ZOV A;  3R0U A;  1Y56 B;  4EIQ A;  4DX3 A;  4TM0 A;  1Q1W A;  3UXK A;  1EL7 A;  2UZZ A;  1JNR A;  4OPI A;  3EAO A;  2Q7V A;  3ZLF A;  2FJA A;  1O94 A;  1S2Y A;  2OZ3 A;  1ZDL A;  5KMS A;  3TQP A;  4H2R A;  2VQ7 A;  2XFO A;  1CBO A;  5KMR A;  3DES A;  3OW1 A;  3EUB 3;  3SY4 A;  2OAM A;  4YTP A;  3P4R A;  4I58 A;  2GQF A;  3U9I A;  4CBQ A;  3NRN A;  1JRP A;  2BC1 A;  3E1T A;  3NVY B;  1CJ4 A;  1E6E A;  1H82 A;  3RP8 A;  4GYP A;  4ADW A;  3V4B A;  1IUX A;  2AKZ A;  1DOE A;  3DG7 A;  3EPT A;  3K7Q X;  2WHD A;  5GSN A;  2XLP A;  3UKP A;  2EQ6 A;  2P8C A;  3VRD B;  3ICT A;  2QDD A;  3FBS A;  3R0K A;  1ONF A;  4GIR A;  4OVI A;  4C3Y A;  5FJT A;  2BAC A;  1GES A;  3GMC A;  3ETR B;  2MUC A;  3VR9 A;  4ZCC A;  2GVC A;  1CJ2 A;  1PXB A;  3ZYX A;  4E6M A;  5BOE A;  3K1G A;  3UJE A;  2WEU A;  3SM8 A;  3COX A;  2PHH A;  3BNU A;  4CCQ A;  1EBH A;  3GD6 A;  1DJN A;  5BUL A;  4OCG A;  2E5A A;  1N4V A;  1N63 C;  3RO6 A;  4YTM A;  4K2X A;  1GET A;  3NS1 B;  4U8P A;  2OQY A;  4YSY A;  1P2H A;  3SZ0 A;  4E5T A;  1SJD A;  3PVC A;  3SN0 A;  5FJP A;  2XH7 A;  3DK4 A;  2X99 A;  2QGY A;  1S7M A;  1WYG A;  3TTE A;  3DGZ A;  3SN1 A;  3CNP A;  3CNJ A;  1OJA A;  2XH0 A;  3IHG A;  1DTN A;  3I6T A;  4IL2 A;  5J04 A;  3FJ4 A;  3VDG A;  1MUC A;  3DJJ A;  1BQG A;  1TZZ A;  1MDL A;  1NEN A;  3P3B A;  4AOX A;  2ZZ0 A;  4A7A A;  4EM3 A;  3AB1 A;  2XVE A;  1NEK A;  3TOY A;  2CVJ A;  2XVH A;  4GIS A;  4E8G A;  3VC6 A;  4CY8 A;  2XH2 A;  3T6C A;  1P2E A;  4UDR A;  3AM9 A;  3AEA A;  4ZCW A;  4H50 A;  3AD8 B;  1EL9 A;  4XWZ A;  3C96 A;  4OPU A;  1P48 A;  2CHR A;  3OTR A;  5KMP A;  4U8O A;  2CDU A;  1TDO A;  5FS6 A;  5KXJ A;  3AYL A;  2PA6 A;  3UCC A;  5BUK A;  2PU0 A;  3H8A A;  4D03 A;  2ZZB A;  1S2Q A;  3F8P A;  4WX1 A;  3AEG A;  4XWR A;  1NG3 A;  4B64 A;  2YG7 A;  3K7M X;  2DW7 A;  3HPF A;  1K4Q A;  1GT8 A;  1TE6 A;  3H8L A;  4C77 A;  2PP1 A;  1L8P A;  3FVD A;  1TDN A;  1ELI A;  4IV9 A;  2C3C A;  2BS3 A;  2WQY A;  3T31 A;  3VCN A;  4ZN0 A;  2R0P A;  1R0M A;  3DG3 A;  5M0Z A;  4C74 A;  1ZMC A;  2NQL A;  3NTD A;  1NG4 A;  4GYP C;  4MKS A;  1DNC A;  3HW2 A;  3EKG A;  4FP1 A;  2C7G A;  3ISH A;  1DOB A;  4EQS A;  3HZL A;  1GRF A;  1N4W A;  2FKP A;  1XAN A;  4MJW A;  2JK6 A;  1JRZ A;  1XHC A;  3VFC A;  1KSU A;  1ZXI C;  1UKV G;  2X8C A;  3S5S A;  3UTF A;  1JU2 A;  3V76 A;  2V6O A;  1FHU A;  3B3R A;  3GYI A;  2YQU A;  2PTZ A;  3UOY A;  3C4N A;  2BCP A;  1N5W C;  1NHS A;  3SXI A;  1D5T A;  3DJG X;  2XH4 A;  2GGG A;  3DFY A;  4DHG A;  2PP3 A;  3CXB A;  3DDM A;  1M6I A;  1PXC A;  2CUL A;  2PSN A;  2YG3 A;  4AT2 A;  1H7X A;  4KPR A;  2WES A;  4G8T A;  3GRT A;  3T8Q A;  2OLO A;  1N61 C;  2ONE A;  4USR A;  4IA6 A;  2GGJ A;  1PJ5 A;  3UKA A;  2QA1 A;  2JB1 A;  1GND A;  1BGJ A;  4IHC A;  3NTA A;  1PJ6 A;  2GR0 A;  1MXT A;  4APN A;  2FYM A;  1GRE A;  4JHM A;  4IVO B;  4IP4 A;  1K0I A;  2XVJ A;  1KNR A;  4K5S A;  3R11 A;  2HZG A;  3FV9 A;  4M52 A;  4GF7 A;  2OX4 A;  3GC2 A;  2YM1 A;  2HXU A;  1COY A;  1KF6 A;  4U2S A;  3URH A;  1N5X A;  1TYT A;  1L9C A;  2VQB A;  2IID A;  3M13 A;  4UDQ A;  3QVP A;  2XDO A;  2R0G A;  2OLA A;  4NEV A;  1FOH A;  1W6T A;  4USQ A;  1F8W A;  4J2W A;  4IT1 A;  2APG A;  2QAE A;  4JY3 A;  4U8K A;  3H8I A;  1RM6 B;  3N4F A;  4U2T A;  3AXB A;  4TVY A;  2QA2 A;  4H4W A;  3G5R A;  3G5Q A;  4ENL A;  1OJC A;  4IA5 A;  3UKK A;  1LPF A;  3LJP A;  3LZW A;  1WUF A;  1L0V A;  3DJE A;  3RCY A;  4JDR A;  3KD9 A;  3LB8 A;  1FEA A;  2WOV A;  3LOV A;  1FFV C;  4GAV A;  4AT0 A;  4YT0 A;  1BWC A;  4K7Z A;  1FEB A;  2A87 A;  4G9K A;  2NVK X;  3ZVH A;  3NXL A;  1MOK A;  2B9Y A;  1KCZ A;  1RVK A;  2H88 A;  4J34 A;  3A7U A;  4CCR A;  2WDQ A;  4YWS A;  4OPC A;  2V3B A;  3D47 A;  3ITJ A;  4OPG A;  7ENL A;  3QSS A;  2PP0 A;  3ENL A;  2FJB A;  4P9S A;  3T0K A;  1VDC A;  5HY5 A;  3U4F A;  1EC9 A;  2WP9 A;  3ZVH B;  2BC0 A;  2VZ2 A;  1EL5 A;  4HCL A;  3QFB A;  1E7P A;  4Z25 A;  1SJC A;  4DXK A;  4H19 A;  4TLZ A;  2WDV A;  3UJS A;  2A89 A;  4UDP A;  1CHU A;  3P4S A;  4HCD A;  1V97 A;  1KKO A;  4EQW A;  2W3R A;  2PGE A;  2Z5Y A;  4H2Q A;  2P8B A;  1TRB A;  5KOW A;  3DFH A;  3B6D A;  2XLT A;  1ZY8 A;  4H4P A;  3GSI A;  3AN1 A;  3UOZ A;  1MNS A;  2B7R A;  5HHF A;  3ICS A;  3JVA A;  3MSY A;  1KD0 A;  4IZG A;  4B69 A;  3EF6 A;  1KN0 A;  3AYJ A;  4H4Y A;  2ACZ A;  4NWZ A;  1OJT A;  3TJ4 A;  2PTX A;  4A6N A;  3A7A A;  1DOD A;  3ATQ A;  4U8I A;  1X2G A;  3ADA B;  4FX9 A;  4PAA A;  4HCH A;  5ER0 A;  4Z2R A;  2BA9 A;  1GAL A;  3RNM A;  2E3T A;  3ALM A;  3DEQ A;  3QPE A;  4YKF A;  2OZT A;  1H84 A;  2GR3 A;  4ZA0 A;  1EC7 A;  4A6N B;  3CNT A;  5EOW A;  3DG6 A;  3EAN A;  2J3N A;  4D04 A;  1CC2 A;  3VCC A;  3GYJ A;  2YG6 A;  4MMW A;  3AWI A;  2TPR A;  1ZK7 A;  3Q6J A;  1OEP A;  2C76 A;  3K7T A;  2WP6 A;  2BYB A;  2YM2 A;  4HNC A;  3GYX A;  4HB9 A;  3V3W A;  4GUV A;  1DOC A;  3H70 A;  3PFR A;  4X9M A;  1YQ4 A;  2EQ9 A;  1BGN A;  2XFQ A;  2C70 A;  1ZOY A;  3UKL A;  4YTN A;  2DKH A;  3L1R A;  3ZVI A;  4EQR A;  2JB3 A;  1NHR A;  3LXD A;  3GD3 A;  4Z44 A;  3IJQ A;  3QFA A;  3RED A;  3RRA A;  4NTE A;  1PHH A;  3L8K A;  2OG9 A;  5KWF A;  3IK4 A;  1VDV A;  4RG4 A;  4AOS A;  4LU6 A;  2R9Z A;  1D4E A;  1PBD A;  5DBJ A;  4LA1 A;  2X50 A;  4DSG A;  3B9J B;  3SZF A;  5CKU A;  3NK0 X;  3CN8 A;  2GH5 A;  4Y4N A;  3TWA A;  4Z26 A;  3H4K A;  4DYE A;  3NZG A;  3HYX A;  3AE1 A;  3UJR A;  3IC9 A;  3GMB A;  2VVL A;  1NHP A;  5EU9 A;  1L9E A;  2OA1 A;  3V3N A;  4EMJ A;  3AD7 B;  2OKT A;  3D8X A;  3SQP A;  3ZDN A;  3IJI A;  1ZX9 A;  1PBB A;  2YR5 A;  1GEU A;  5EB4 A;  2C65 A;  4JNA A;  2B76 A;  4GFI A;  1JEH A;  2VRL A;  3KPF A;  1E39 A;  1FFU C;  2OLN A;  2GB0 A;  2WU2 A;  4JY2 A;  2PTY A;  3PWI A;  4EMW A;  2JB2 A;  4GAP A;  4K1W A;  3BOX A;  1JRY A;  3NLC A;  2OPJ A;  3AMZ A;  4E4F A;  1WUE A;  3ES8 A;  4OPD A;  4Y4M A;  1LV0 A;  5FS7 A;  3N6J A;  4AP1 A;  5HXI A;  3UXL A;  1GRH A;  4ROP A;  3ZLH A;  2BRA A;  2EQ8 A;  3DER A;  3RHA A;  2WOW A;  3SZW A;  3T9P A;  4A99 A;  3M0O A;  3NO1 A;  3R25 A;  4KPL A;  1E9I A;  3CGD A;  4JNQ A;  1NHQ A;  3CXO A;  2AKM A;  1H7W A;  1IJH A;  4PAB A;  4JN8 A;  3AE2 A;  4JQ9 A;  1B37 A;  4B1B A;  3CT2 A;  1E1L A;  2XGZ A;  4KT2 A;  1RP0 A;  3T14 A;  3BHK A;  3GD4 A;  1E1M A;  1PDY A;  1O5W A;  4A65 A;  1SJB A;  3JZU A;  4A3R A;  5KVI A;  2BXS A;  4X2P A;  3NN0 X;  3T2Y A;  2POD A;  4B65 A;  1QLB A;  2QQ6 A;  5M10 A;  3D9X A;  3CGB A;  3R10 A;  4DGK A;  4M0X A;  2POZ A;  1ZP0 A;  2OAL A;  3AEB A;  3QLD A;  3SZC A;  4A9W A;  4GCM A;  3VR8 A;  4FK1 A;  2BK4 A;  2TMD A;  3DJD A;  2GSH A;  3I3L A;  1LQT A;  3FG2 P;  2E5V A;  4YSX A;  1M64 A;  1F3P A;  2VRM A;  3AE5 A;  4A79 A;  3RGT A;  4MGG A;  1H86 A;  1B4V A;  2YVG A;  5HYM A;  3DK9 A;  1VQZ A;  3PS9 A;  4HNL A;  3S5W A;  3P93 A;  2ARD A;  2YLX A;  4H2P A;  2GMJ A;  2XVF A;  2WET A;  2YG5 A;  2IVE A;  2C75 A;  1FEC A;  3Q9T A;  4HYR A;  1PBC A;  1XDI A;  3CPJ G;  3G5S A;  1EBD A;  2PU1 A;  3KLJ A;  3IWA A;  1LQU A;  1PDH A;  4M6U A;  4YWO A;  1ECQ A;  1CL0 A;  5IDZ A;  1SEZ A;  2VOU A;  3NH3 X;  1IUV A;  1ONE A;  2WPC A;  5G5G B;  4N9X A;  2QDE A;  2ZC8 A;  2Q0K A;  5KRQ A;  3BSM A;  4XXG A;  2B7S A;  4KEM A;  4H4X A;  4H4U A;  3GRS A;  2FBW A;  1MDR A;  2DKI A;  2BRY A;  3UKF A;  3NVW B;  1QO8 A;  4B63 A;  3FIM B;  2QCU A;  2BCG G;  3UOV A;  2IVD A;  4EWJ A;  3MQT A;  5FMH A;  2BS4 A;  3S61 A;  5KVH A;  1DJQ A;  1X31 B;  1ZMD A;  2WOI A;  2X3N A;  2FJD A;  2VVL G;  3SX6 A;  3QTP A;  1GRA A;  3QKE A;  2C66 A;  2E1M A;  2PS2 A;  4K2S A;  1PXA A;  4NEW A;  5KNL A;  3NGC X;  1GRG A;  4CY6 A;  5G5H B;  1JRX A;  4JN9 A;  3C4A A;  2Q0L A;  2RGJ A;  1OJD A;  4K8D A;  3B97 A;  3QN3 A;  1NU5 A;  4U8N A;  4B68 A;  4H2N A;  3CGC A;  1LTX R;  3ATR A;  3ZLG A;  3I6D A;  3LAD A;  2GEW A;  4J36 A;  4U8L A;  3KA7 A;  2YLS A;  3RIT A;  4BUR A;  1GRT A;  2OVL A;  3VA8 A;  5JCM A;  2V61 A;  4O5U A;  1SB3 B;  4A5L A;  1D4C A;  3P4Q A;  2WDR A;  3D1C A;  4LII A;  1KKR A;  3Q4D A;  4CNJ A;  3NKS A;  3V5F A;  2GRT A;  4BV6 A;  1K0J A;  4Z17 A;  1KSS A;  1XPQ A;  4Z1Y A;  2W54 A;  3ABV A;  2RGH A;  4U8J A;  4TM4 A;  3NVV B;  4BK1 A;  2Y6R A;  2I5Q A;  3RR1 A;  3GO2 A;  3UKH A;  3R07 C;  3TW9 A;  1FIQ B;  1B8S A;  2BS2 A;  3SR6 B;  2C4C A;  2YG4 A;  4FK1 C;  3ALJ A;  4OPT A;  3IHM A;  5JCI A;  2GAH B;  3VQR A;  4GGB A;  3T37 A;  5U63 A;  2P0I A;  3NFU A;  1JDF A;  2X8G A;  5EBK A;  4A35 A;  1O95 A;  3PWG A;  2C72 A;  2E4G A;  1YKJ A;  1H2I A;  5JCK A;  3QJ4 A;  3BNM A;  1Q9I A;  3UCL A;  2AR8 A;  4G6G A;  2C3D A;  2C73 A;  1LJ1 A;  2RGO A;  4TM1 A;  3FYY A;  4YSZ A;  1GXF A;  2RDX A;  3T4W A;  5IPY A;  3IJL A;  3KVE A;  3TWB A;  4TVW A;  3O0H A;  2R45 A;  1S3B A;  1VRQ B;  2YWL A;  4EMI A;  2R46 A;  4AP3 A;  4H1Z A;  3HYW A;  3QVR A;  5FS8 A;  1YQ3 A;  2XYO A;  1GRB A;  2YVF A;  1ELS A;  4X9N A;  5C3J A;  3ICR A;  3NYC A;  3KKJ A;  1GOS A;  2QJJ A;  3H7V A;  4J33 A;  4C3X A;  5EB5 A;  1Q1R A;  4NTC A;  2GL5 A;  4H4R A;  3DGB A;  4RG3 A;  4H4Z A;  3RP7 A;  3AE8 A;  1H81 A;  4EIP A;  3VRB A;  2P3Z A;  4EQX A;  4ECH A;  2A8X A;  2B9W A;  4O5Q A;  2XVI A;  2WP5 A;  3SN4 A;  3IF9 A;  5FS9 A;  1KFY A;  2YLT A;  3OZ2 A;  3NHO X;  2XFN A;  5ENL A;  3P9U A;  3OPS A;  4FI4 A;  2PMQ A;  2PTW A;  3GWD A;  4UP3 A;  1E1N A;  2R4E A;  3CB3 A;  2EQ7 A;  5KOX A;  3NYF A;  4A6G A;  2YAU A;  4J3Z A;  4TM3 A;  3BI2 A;  4H4Q A;  2QJM A;  4G74 A;  4FDC B;  3DH9 A;  4GRT A;  1K0L A;  3NIX A;  2F5Z A;  4X4J A;  1BKH A;  1YQZ A;  2I0Z A;  3M12 A;  3AE7 A;  3I6E A;  4REK A;  4YSH A;  3NNE A;  1EL8 A;  3VRA A;  2V60 A;  3CK5 A;  3V5C A;  2AQJ A;  3AEC A;  5J60 A;  2NPX A;  3CGE A;  4BJZ A;  3CIR A;  1T3Q C;  3QSE A;  4BK3 A;  1F9C A;  5BRT A;  1HYU A;  2XLR A;  3FCP A;  5JRB A;  1F6M A;  1YEY A;  3MWC A;  4B66 A;  1GER A;  4TLX A;  2HNE A;  4J1O A;  1PN0 A;  1F8S A;  1GV4 A;  2BAB A;  2AAQ A;  1CJC A;  4II2 A;  4KWS A;  3SSZ A;  2O56 A;  1GTE A;  1CC6 A;  1TKK A;  4IVM B;  4J31 A;  4GR1 A;  4E4U A;  3PO7 A;  4K22 A;  4I59 A;  1JPD X;  1PJ7 A;  3CMM A;  1R6W A;  2WU5 A;  2GGH A;  1GTH A;  3OC4 A;  2FJE A;  3LZX A;  2XSX A;  4YXD A;  4G73 A;  2DW6 A;  4DN1 A;  1B5Q A;  1D4D A;  3UGV A;  1VQW A;  3R1Z A;  3CPI G;  3UJF A;  2GR1 A;  5FJU A;  3NVZ B;  1TDK A;  3AE6 A;  2VVM A;  3AYI A;  1XS2 A;  5BOF A;  3UP5 A;  3S47 A;  3AE4 A;  2Q6U A;  1N4U A;  2PCE A;  2YR6 A;  1PS9 A;  4H4S A;  2Z5X A;  4HN8 A;  3AE3 A;  3CNS A;  2XFP A;  2R0C A;  3GY1 A;  1MRA A;  5FJO A;  3UJ2 A;  5IQ1 A;  3WE0 A;  4H4V A;  2AL1 A;  1PBF A;  2WS3 A;  1PBE A;  3MY9 A;  3N4E A;  3UTH A;  4II3 A;  2V3A A;  2GAG B;  2XCG A;  5LV9 A;  3NK1 X;  3PK7 A;  2PYX A;  3UP4 A;  3AE9 A;  1OJ9 A;  2X8H A;  5GRT A;  3SJN A;  2P88 A;  3UOX A;  5L46 A;  3TJI A;  1AOG A;  4U8M A;  4GGH A;  4J57 A;  1W4X A;  2GGE A;  2YVJ A;  4ZCD A;  3SYI A;  2GDQ A;  4DWD A;  1JCT A;  4BK2 A;  1JPM A;  1SJA A;  2XLU A;  3I4K A;  3CYJ A;  2GQW A;  3KPK A;  2V5Z A;  3DME A;  4GDE A;  2YLZ A;  3JW7 A;  1TYP A;  3STP A;  5TR3 A;  3T2K A;  4NNJ A;  3BI4 A;  4Y4L A;  1CC4 A;  4GDP A;  3ES7 A;  2GMH A;  2RAB A;  2XLS A;  3CND A;  1STZ A;  2WPE A;  2YLW A;  3K30 A;  1KNP A;  4RSL A;  3SFE A;  2WBA A;  3UCD A;  4KX6 A;  2PGW A;  4DNA A;  2JAE A;  4G7F A;  1JRO A;  5C2T A;  4ICY A;  4C5O A;  1XPY A;  3A7R A;  3THU A;  3VC5 A;  4HPN A;  5U1O A;  4H7U A;  1GPE A;  3UTG A;  1CJ3 A;  2ZAD A;  3BJS A;  1IUT A;  1ZKQ A;  1FO4 A;  4IP5 A;  5JCN A;  1VG9 A;  4K5R A;  4H4T A;  3AEF A;  3NK2 X;  3SQS A;  3NRZ B;  3AEE A;  4ZOH B;  4DSH A;  1Y0P A; 
#chains in the Genus database with same CATH homology
 3UKH A;  3II4 A;  1B8S A;  3CTY A;  4X9M A;  2BS2 A;  5KMP A;  4U8O A;  1YQ4 A;  2CDU A;  2EQ9 A;  1DXL A;  1BGN A;  5FS6 A;  1TDO A;  1YY5 A;  2C4C A;  2C70 A;  2XFQ A;  2YG4 A;  1ZOY A;  5KXJ A;  5BVA A;  3UKL A;  3AYL A;  4FK1 C;  4YTN A;  2DKH A;  3L1R A;  5BUK A;  3FPZ A;  3AD9 B;  3GDP A;  3ALJ A;  3NYE A;  4EQR A;  4OPT A;  1FCD A;  2JB3 A;  3IHM A;  1NHR A;  3LXD A;  5JCI A;  4D03 A;  2BXR A;  2ZZB A;  2JBV A;  2GAH B;  1S2Q A;  4EM4 A;  3SFD A;  3VQR A;  2YR4 A;  3GD3 A;  1E1K A;  3F8P A;  3V3O A;  2B9X A;  3T2Z A;  4Z44 A;  3RED A;  3QFA A;  3SGL A;  4WX1 A;  3AEG A;  1BZL A;  5J7X A;  4XWR A;  1NG3 A;  4Z24 A;  4NTE A;  3T37 A;  4B64 A;  1PHH A;  5U63 A;  5IQ4 A;  3L8K A;  2YG7 A;  5EBK A;  2X8G A;  3K7M X;  1O95 A;  1H83 A;  2C72 A;  5KWF A;  1JNZ A;  3UKQ A;  2E4G A;  1K4Q A;  1YKJ A;  3NT6 A;  1GT8 A;  4RG4 A;  4AOS A;  1H2I A;  1N1P A;  2O9Z A;  1NAA A;  3H8L A;  4C77 A;  5JCK A;  3QJ4 A;  3L5O A;  1BF3 A;  4LU6 A;  2R9Z A;  4G6H A;  1D4E A;  1PBD A;  2BK5 A;  3BNM A;  1Q9I A;  5DBJ A;  4J56 A;  1ELI A;  1TDN A;  3UCL A;  2AR8 A;  4IV9 A;  4G6G A;  4CRT A;  4LA1 A;  2X50 A;  4BJY A;  1NPX A;  2C3C A;  2BS3 A;  2C3D A;  2C73 A;  4DSG A;  5U25 A;  2WQY A;  3T31 A;  1LJ1 A;  2RGO A;  3SZF A;  4TM1 A;  4YSZ A;  4ZN0 A;  1GXF A;  2R0P A;  3P4P A;  5CKU A;  5IPY A;  1S3E A;  1MO9 A;  4B67 A;  3NK0 X;  3KVE A;  3O0H A;  2R45 A;  3CN8 A;  5M0Z A;  1LVL A;  4C74 A;  2GH5 A;  4E0V A;  1TDE A;  1S3B A;  1ZMC A;  1VRQ B;  4U2L A;  2YWL A;  4EMI A;  2R46 A;  4Y4N A;  4AP3 A;  3HYW A;  3NG7 X;  3QVR A;  3NTD A;  1NG4 A;  5FS8 A;  1YQ3 A;  2XYO A;  1GRB A;  2YVF A;  3R9U A;  4X9N A;  4Z26 A;  3H4K A;  3DA1 A;  5C3J A;  3ICR A;  3NYC A;  1DNC A;  3KKJ A;  1GOS A;  3DGH A;  2XFU A;  3HYX A;  4J33 A;  4C3X A;  2CFY A;  2Y6Q A;  4OPL A;  5EB5 A;  4Z2T A;  2WPF A;  1Q1R A;  2C7G A;  3ISH A;  3AE1 A;  3ALL A;  2W0H A;  4EQS A;  1DOB A;  1GRF A;  3HZL A;  3P1W A;  4NTC A;  3IC9 A;  3GMB A;  2VVL A;  4H4R A;  1NHP A;  1BKW A;  1L9E A;  2OA1 A;  4RG3 A;  3V3N A;  1N4W A;  4H4Z A;  3RP7 A;  1XAN A;  1IUW A;  4EMJ A;  1CF3 A;  3AE8 A;  3AD7 B;  4MJW A;  1H81 A;  4EIP A;  2JK6 A;  1JRZ A;  3VRB A;  3D8X A;  4EQX A;  3UTE A;  1GSN A;  2GR2 A;  4ECH A;  2YLR A;  2A8X A;  3SQP A;  2B9W A;  4O5Q A;  3ZDN A;  1XHC A;  2XVI A;  2WP5 A;  1ZX9 A;  1PBB A;  1KSU A;  2YR5 A;  3IF9 A;  1GEU A;  5FS9 A;  1UKV G;  1KFY A;  5EB4 A;  2X8C A;  3PG6 A;  2C65 A;  2R4J A;  2YLT A;  3BHF A;  3OZ2 A;  3NHO X;  4JNA A;  3UTF A;  1JU2 A;  2GF3 A;  2XFN A;  2V6O A;  1VG0 A;  4WCT A;  3V76 A;  3P9U A;  2B76 A;  3B3R A;  2BK3 A;  3GYI A;  1FL2 A;  2YQU A;  1IUU A;  3UOY A;  3C4N A;  3KU9 A;  2BCP A;  3GWD A;  4UP3 A;  1NHS A;  1E1N A;  2R4E A;  1JEH A;  1D5T A;  2EQ7 A;  2C67 A;  3SXI A;  2HQM A;  5KOX A;  2VRL A;  3DJG X;  3KPF A;  1E39 A;  3NYF A;  3RP6 A;  2ZZC A;  1L9D A;  2YAU A;  3HYV A;  2OLN A;  4TM3 A;  2GB0 A;  1REO A;  3BI2 A;  4H4Q A;  2ZBW A;  2WU2 A;  4JY2 A;  1F8R A;  3GWF A;  4EMW A;  2JB2 A;  1V59 A;  3JSK A;  4FDC B;  4G74 A;  4GAP A;  1M6I A;  1JRY A;  3DH9 A;  4GRT A;  1K0L A;  1PXC A;  1RYI A;  2CUL A;  3NIX A;  3NN6 X;  3NLC A;  1JOA A;  2YG3 A;  4Z2U A;  2F5Z A;  3F8D A;  3AED A;  4AT2 A;  4X4J A;  1H7X A;  4OPD A;  1YQZ A;  4KPR A;  2I0Z A;  1TDF A;  3M12 A;  2WES A;  4Y4M A;  4HA6 A;  3AE7 A;  1LV0 A;  5FS7 A;  3GRT A;  5CQF A;  4REK A;  4B69 A;  4YSH A;  2OLO A;  3NNE A;  4AP1 A;  4USR A;  3QSM A;  1EL8 A;  4IA6 A;  4NTD A;  2V60 A;  3VRA A;  2H89 A;  5HXI A;  1PJ5 A;  3UKA A;  1GRH A;  2QA1 A;  2AQJ A;  3AEC A;  5J60 A;  1H6V A;  2NPX A;  2JB1 A;  2BRA A;  1GND A;  4Z43 A;  1BGJ A;  2EQ8 A;  3RHA A;  3CGE A;  4BJZ A;  3CIR A;  3NTA A;  3QSE A;  1PJ6 A;  2WOW A;  4NZH A;  4BK3 A;  2GR0 A;  1HYU A;  5BRT A;  1KDG A;  1Z6L A;  3SZW A;  2XLR A;  4A99 A;  3M0O A;  5JRB A;  1MXT A;  2GV8 A;  2JKC A;  4APN A;  1F6M A;  3CPH G;  1D7Y A;  1GRE A;  4IVO B;  2C64 A;  1IUS A;  1K0I A;  5KMQ A;  3CGD A;  4B66 A;  1GER A;  4TLX A;  4CNK A;  2XVJ A;  1QJD A;  3F8R A;  1PN0 A;  4JNQ A;  1NHQ A;  1F8S A;  1GV4 A;  1KNR A;  2BAB A;  4K5S A;  1H7W A;  2AAQ A;  1NDA A;  1IJH A;  4YKG A;  4PAB A;  1CJC A;  3AE2 A;  4II2 A;  4JQ9 A;  1B37 A;  4B1B A;  1E1L A;  1GTE A;  1CC6 A;  4IVM B;  1RP0 A;  4J31 A;  4GR1 A;  4K22 A;  3PO7 A;  4I59 A;  3T14 A;  4M52 A;  3BHK A;  1Y56 A;  3GD4 A;  1PJ7 A;  4GF7 A;  1E1M A;  3GDN A;  3CMM A;  1O5W A;  4A65 A;  3BI5 A;  5KVI A;  2BXS A;  2YM1 A;  3NN0 X;  2WU5 A;  1D7L A;  3T2Y A;  1GTH A;  3OC4 A;  2FJE A;  1COY A;  4B65 A;  1QLB A;  3LZX A;  5M10 A;  3D9X A;  4YXD A;  3CGB A;  4G73 A;  1KF6 A;  4U2S A;  3URH A;  4DGK A;  5JCL A;  3FMW A;  1RSG A;  1L9C A;  1TYT A;  1B5Q A;  1D4D A;  2VQB A;  1ZP0 A;  2OAL A;  3AEB A;  2IID A;  3DK8 A;  1ZOV A;  3SZC A;  4A9W A;  3M13 A;  4GCM A;  4UDQ A;  3QVP A;  1Y56 B;  1VQW A;  2XDO A;  4EIQ A;  3CPI G;  2R0G A;  3VR8 A;  4FK1 A;  1Q1W A;  1EL7 A;  2BK4 A;  2UZZ A;  4TM0 A;  1JNR A;  2TMD A;  3DJD A;  4OPI A;  2GR1 A;  3I3L A;  1LQT A;  3EAO A;  4NEV A;  2Q7V A;  1FOH A;  1O94 A;  2FJA A;  1TDK A;  4USQ A;  1S2Y A;  3AE6 A;  3FG2 P;  1F8W A;  2VVM A;  3AYI A;  2E5V A;  4YSX A;  4J2W A;  1M64 A;  1F3P A;  1ZDL A;  2VRM A;  2APG A;  3UP5 A;  2QAE A;  5KMS A;  3AE5 A;  3AE4 A;  4H2R A;  2Q6U A;  4A79 A;  4JY3 A;  1N4U A;  4U8K A;  3H8I A;  2VQ7 A;  2XFO A;  1H86 A;  1CBO A;  5KMR A;  1B4V A;  2YVG A;  1PS9 A;  2YR6 A;  4H4S A;  3DK9 A;  2Z5X A;  4U2T A;  3AE3 A;  3CNS A;  5HYM A;  2XFP A;  3PS9 A;  2R0C A;  3S5W A;  3AXB A;  3SY4 A;  2ARD A;  2YLX A;  2OAM A;  2QA2 A;  4H2P A;  2GMJ A;  4H4W A;  3G5R A;  3G5Q A;  1OJC A;  4IA5 A;  4YTP A;  3P4R A;  3UKK A;  1LPF A;  2XVF A;  3LJP A;  5IQ1 A;  4I58 A;  2GQF A;  2WET A;  2YG5 A;  3LZW A;  2IVE A;  2C75 A;  1L0V A;  3DJE A;  1FEC A;  3WE0 A;  4JDR A;  3Q9T A;  4H4V A;  3KD9 A;  3LB8 A;  1XDI A;  1PBC A;  4CBQ A;  3NRN A;  1FEA A;  2BC1 A;  2WOV A;  3CPJ G;  3E1T A;  3G5S A;  3LOV A;  1PBF A;  2WS3 A;  1PBE A;  1CJ4 A;  1EBD A;  1E6E A;  1H82 A;  4GAV A;  3UTH A;  4AT0 A;  3KLJ A;  3RP8 A;  4II3 A;  3IWA A;  4ADW A;  4YT0 A;  2V3A A;  1BWC A;  1IUX A;  4K7Z A;  1LQU A;  1FEB A;  1DOE A;  2A87 A;  1PDH A;  2GAG B;  2XCG A;  3NK1 X;  5LV9 A;  4YWO A;  3EPT A;  4G9K A;  2NVK X;  3K7Q X;  2WHD A;  5GSN A;  2PYX A;  2XLP A;  1CL0 A;  3UP4 A;  3UKP A;  1MOK A;  1SEZ A;  2B9Y A;  2EQ6 A;  2VOU A;  2H88 A;  3AE9 A;  1OJ9 A;  4J34 A;  2X8H A;  3NH3 X;  4CCR A;  2WDQ A;  1IUV A;  5GRT A;  4OPC A;  2V3B A;  3ICT A;  3VRD B;  3UOX A;  2WPC A;  5L46 A;  3ITJ A;  3FBS A;  4N9X A;  4OPG A;  1ONF A;  3QSS A;  1AOG A;  2Q0K A;  5KRQ A;  2FJB A;  4U8M A;  4XXG A;  4OVI A;  2B7S A;  4C3Y A;  4P9S A;  3T0K A;  1VDC A;  2BAC A;  1GES A;  3GMC A;  4J57 A;  4H4X A;  1W4X A;  4H4U A;  2YVJ A;  3GRS A;  2FBW A;  5HY5 A;  4ZCD A;  2WP9 A;  3SYI A;  2BC0 A;  2VZ2 A;  1EL5 A;  2DKI A;  2BRY A;  3UKF A;  3QFB A;  3VR9 A;  1E7P A;  4ZCC A;  4Z25 A;  1QO8 A;  4B63 A;  4TLZ A;  2WDV A;  3FIM B;  4BK2 A;  2GVC A;  1CJ2 A;  1PXB A;  2QCU A;  3ZYX A;  2BCG G;  3UOV A;  2IVD A;  2A89 A;  4UDP A;  1CHU A;  3P4S A;  2WEU A;  5FMH A;  2XLU A;  4EQW A;  2BS4 A;  3SM8 A;  2Z5Y A;  2GQW A;  3COX A;  4H2Q A;  3S61 A;  1TRB A;  5KOW A;  5KVH A;  2PHH A;  1DJQ A;  1X31 B;  1ZMD A;  3B6D A;  2XLT A;  3KPK A;  1ZY8 A;  2WOI A;  2V5Z A;  3DME A;  4H4P A;  4GDE A;  3BNU A;  2YLZ A;  4CCQ A;  2X3N A;  3GSI A;  1TYP A;  2FJD A;  2VVL G;  3UOZ A;  5TR3 A;  2B7R A;  1DJN A;  3SX6 A;  1GRA A;  2C66 A;  3T2K A;  5BUL A;  4OCG A;  2E1M A;  5HHF A;  4NNJ A;  3BI4 A;  3ICS A;  1N4V A;  1PXA A;  4Y4L A;  3EF6 A;  4YTM A;  1CC4 A;  4K2X A;  1GET A;  1KN0 A;  4NEW A;  4GDP A;  3NGC X;  4U8P A;  5KNL A;  2GMH A;  4YSY A;  1P2H A;  1GRG A;  3AYJ A;  3SZ0 A;  4CY6 A;  2RAB A;  2XLS A;  3CND A;  3PVC A;  2WPE A;  1JRX A;  2YLW A;  4H4Y A;  1KNP A;  2ACZ A;  3K30 A;  4NWZ A;  1OJT A;  4JN9 A;  3C4A A;  4RSL A;  3SFE A;  4A6N A;  2WBA A;  2Q0L A;  4U8I A;  1DOD A;  3ATQ A;  4KX6 A;  2RGJ A;  4DNA A;  1OJD A;  4K8D A;  3ADA B;  2JAE A;  4U8N A;  4B68 A;  4H2N A;  4FX9 A;  4PAA A;  5ER0 A;  4Z2R A;  3CGC A;  3DK4 A;  1LTX R;  2BA9 A;  2X99 A;  3ATR A;  1S7M A;  3I6D A;  5C2T A;  3LAD A;  2GEW A;  4J36 A;  3DGZ A;  1GAL A;  4U8L A;  4ICY A;  3CNP A;  3CNJ A;  3RNM A;  4C5O A;  3KA7 A;  1OJA A;  3IHG A;  3ALM A;  2YLS A;  4BUR A;  4YKF A;  1H84 A;  5U1O A;  1GRT A;  4H7U A;  3DJJ A;  2GR3 A;  5JCM A;  2V61 A;  1GPE A;  4O5U A;  4A6N B;  3UTG A;  3CNT A;  4A5L A;  1CJ3 A;  5EOW A;  3EAN A;  2J3N A;  1NEN A;  1IUT A;  1D4C A;  3P4Q A;  4AOX A;  4D04 A;  2WDR A;  3D1C A;  1ZKQ A;  2ZZ0 A;  1CC2 A;  4LII A;  4EM3 A;  3AB1 A;  4A7A A;  2XVE A;  3GYJ A;  4CNJ A;  2YG6 A;  1NEK A;  3NKS A;  3AWI A;  2CVJ A;  2TPR A;  2GRT A;  4BV6 A;  1ZK7 A;  3Q6J A;  2XVH A;  2C76 A;  5JCN A;  1K0J A;  1VG9 A;  1KSS A;  3K7T A;  4K5R A;  1XPQ A;  2WP6 A;  4H4T A;  3AEF A;  3NK2 X;  4CY8 A;  1P2E A;  2BYB A;  2YM2 A;  3ABV A;  3GYX A;  3AEE A;  2RGH A;  4UDR A;  4U8J A;  4TM4 A;  4HB9 A;  4BK1 A;  2Y6R A;  3AEA A;  4GUV A;  4H50 A;  3AD8 B;  1DOC A;  1EL9 A;  4XWZ A;  4DSH A;  3C96 A;  4OPU A;  1Y0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...