1V5CA

The crystal structure of the inactive form chitosanase from bacillus sp. k17 at ph3.7
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
386
structure length
386
Chain Sequence
b'AKEMKPFPQQVNYAGVIKPNHVTQESLNASVRSYYDNWKKKYLKNDLSSLPGGYYVKGEITGDADGFKPLGTSEGQGYGMIITVLMAGYDSNAQKIYDGLFKTARTFKSSQNPNLMGWVVADSKKAQGHFDSATDGDLDIAYSLLLAHKQWGSNGTVNYLKEAQDMITKGIKASNVTNNNQLNLGDWDSKSSLDTRPSDWMMSHLRAFYEFTGDKTWLTVINNLYDVYTQFSNKYSPNTGLISDFVVKNPPQPAPKDFLDESEYTNAYYYNASRVPLRIVMDYAMYGEKRSKVISDKVSSWIQNKTNGNPSKIVDGYQLNGSNIGSYPTAVFVSPFIAASITSSNNQKWVNSGWDWMKNKRERYFSDSYNLLTMLFITGNWWKPVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitosanase
publication title Crystal structure of family GH-8 chitosanase with subclass II specificity from Bacillus sp. K17
pubmed doi rcsb
molecule tags Hydrolase
total genus 154
structure length 386
sequence length 386
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2003-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1v5cA01
2VN7A 1V5CA 3WKFA 3QXFA 1WU5A 1V7VA 3ACTA 3H2WA 2F6DA 4ZH5A 3WKGA 3TF4A 4XUVA 3H3KA 3PMMA 3WIRA 3K11A 3WC3A 1V5DA 4L6XA 3RX7A 5KKBA 3QT3A 1WU4A 2ZBLA 2D8LA 3EQAA 3QFZA 1XWQA 3W7TA 1KREA 3QT9A 2FBAA 2EADA 4Q2BA 1CEMA 1XWTA 1LF9A 2WYNA 3CIHA 4WU0A 1FO2A 4JJJA 1L2AA 3QSPA 3WKHA 1IA6A 1KKTA 2CQTA 1JS4A 2DRRA 3WKIA 1CLCA 1G9JA 2OKXA 3GT5A 2QNOA 3S4BA 1G87A 1GAIA 2B4FA 1NXCA 2D5JA 1NC5A 3S4CA 1GLMA 4FUSA 3GZKA 3WIQA 4ZG8A 4CE7A 1K72A 3QPFA 4L0GA 3RX8A 3S4AA 4AYPA 4Z4LA 1LF6A 1UT9A 1GA2A 4Z4JA 4KTPA 5CZLA 4AYOA 1FP3A 2AHGA 3GLYA 1V7XA 3E6UA 1KRFA 4CJ0A 3X17A 1WZZA 2RI9A 3QG0A 1TF4A 4AYQA 2YIKA 2P0VA 3W7UA 1FCEA 5MEHA 1FMIA 1FO3A 2A8ZA 2NVPA 1V7WA 1IA7A 1AYXA 1FBOA 2XFGA 3RENA 1KFGA 3D3IA 2JF4A 4Q88A 4CJ1A 1VD5A 3T33A 1FBWA 3WIWA 2FV1A 3ANKA 2EACA 3ANIA 4WVAA 1XW2A 4WVBA 3E73A 4DODA 1G6IA 2AHFA 1DOGA 3S4DA 3RX5A 4TF4A 5GW7A 5M7YA 1X9DA 2RI8A 2Z07A 1F9DA 1AGMA 1DL2A 1H14A 3W5NA 3W7WA 3W7XA 2RGKA 2GH4A 3WUXA 1KSDA 4WVCA 3VW5A 3W5MA 4TXTA 1UG9A 1KWFA 3H7LA 1GAHA 1KS8A 1H13A 2CQSA 5CA3A 4J5TA 3QXQA 3W7SA 4EL8A 1RQ5A 3EZ8A 5DGRA 2EAEA 2FV0A 1HCUA 1IS9A 2ZZRA 3A3VA 2DROA 3VXDA 2DRQA 5M7IA 3RRSA 3P2CA 3ON6A 1G9GA 3RSYA 5DGQA 4AYRA 1L1YA 2FUZA 1H12A 2JJBA 2DRSA 3QDEA 1FAEA 3QWTA 5E2JA 5GY3A 1KSCA 3ACSA 3QFYA 3AFJA 2VN4A 2JG0A 4DOEA 1H54A 2EABA 2AFAA 1F9OA 4KTRA 3QRYA 1WU6A 2GZ6A 3ANJA 5CD2A 1ULVA
chains in the Genus database with same CATH superfamily
3E32B 3S9VA 1RWFA 1UMPA 2VN7A 1WU5A 1V7VA 3ACTA 2F6DA 3WKGA 4XUVA 3PMMA 4MMHA 3RX7A 2D8LA 3EQAA 3CU7A 1KREA 2FBAA 4Q2BA 3M7LA 1MZCB 3PZ4B 3QSPA 3WKHA 4EHMB 3EU5B 3AFLA 1NI1B 3M71A 4DI5A 1N20A 5IK0A 1JS4A 3WKIA 2R2LB 1QQFA 2NOJA 3GT5A 3S4BA 1G87A 3DRAB 3SDVA 2ZIRB 3M7BA 5FO7B 3WIQA 4ZG8A 2J5CA 3RX8A 4MMIA 1UT9A 4F13A 1RWGA 2BRVX 1TN6B 3QG0A 4ZRQA 3E80A 2P0VA 1TNOB 4LIXA 3DSXB 2A8ZA 1JCRB 1IA7A 2XFGA 3RENA 3D3IA 4CJ1A 1VD5A 2B39A 1FBWA 2V8JA 3M76A 3ANKA 1LOHA 1QAZA 4D94A 3E73A 3HXCB 1TN7B 4GTPB 4MBGB 1N94B 3N0FA 1LXKA 5EASA 5M7YA 1X9DA 1CB8A 1F9DA 1AGMA 1FT2B 4D4DA 5JPMB 2GH4A 5GZKA 1KSDA 4WVCA 3VSNA 1SQCA 3M02A 4J5TA 4F10A 3DPYB 3EZ8A 3VXDA 5DGRA 1HCUA 3A3VA 1HZFA 2DRQA 5M7IA 5ILKA 5C05A 5JPNB 3DSVB 5EAUA 2JJBA 2BBCA 1FAEA 3EU8A 2VN4A 1LD8B 3OXUA 4DOEA 3Q7FB 4GTRB 2EABA 3NFVA 3G4DA 1F9GA 3D5RA 3H2WA 4BOJA 1TNBB 3H3KA 5KKBA 1WU4A 2ZBLA 3M7CA 2WDAA 3QFZA 1N7QA 3HXDB 1OJOA 1XWTA 3HXFB 1LF9A 3CIHA 1J0MA 1N7PA 1GHQA 3SQCA 3M7EA 3M72A 1IA6A 2X03A 2V3NA 3DSUB 1I8QA 3EUVB 1CLCA 1TNZB 2QNOA 1GAIA 1HM3A 1NXCA 1NC5A 3PYBA 3E7JA 4L0GA 4AYPA 3M01A 1KZPB 4D4BA 1LF6A 1GA2A 5CZLA 4AYOA 1FP3A 2AHGA 1V7XA 3E6UA 4YDEB 4CJ0A 1WZZA 2RI9A 5IKAA 1F1SA 3W7UA 1N24A 1H3CA 1O6RA 1FMIA 2NVPA 5IK9A 1OJNA 1H37A 1N4PB 3ANIA 1XW2A 2XWJB 4DODA 1G6IA 1SA5B 5JMDA 2AHFA 3Q75B 1DCEB 1J0NA 2V8IA 3RX5A 4TF4A 4E1YA 3M74A 1DL2A 3W7WA 3W7XA 1GXOA 3M78A 4YDOB 1UG9A 4OZWA 5IL3A 3E33B 4QT9A 3P5PA 2CQSA 5CA3A 3W7SA 3KLSA 1NL4B 2EAEA 2FV0A 1LD7B 3SFXB 3RRSA 1N7NA 4ZH1A 3ON6A 1G9GA 4V1SA 2V3PA 3RSYA 4AYRA 1H12A 2E24A 1HN0A 2DRSA 1C82A 2BB6A 3QDEA 3QWTA 4OK4A 5E2JA 2H6FB 4FXKB 1N21A 1S63B 1O1SB 3AFJA 1S64B 3N0GA 2JG0A 1O6HA 2BRPA 2AFAA 1W6KA 5ILZA 4KTRA 3Q73B 1HM2A 5IK6A 1WU6A 4MU9A 1ULVA 2ZISB 1V5CA 3DSTB 2F0YB 3Q78B 3TF4A 3WIRA 4L6XA 1N7RA 4LNVA 5EATA 3PYAA 2H6GB 2SQCA 4ZRPA 1XWQA 3HXEB 3W7TA 3E30B 2EADA 4D4AA 1N1BA 2WYNA 1FO2A 4JJJA 1L2AA 3DSSB 5FO9B 1X1JA 3D5SA 3KQ4A 2H6HB 3PZ3B 4GL3A 2XQWA 2DRRA 3SFYB 1G9JA 2OKXA 2I07B 1H36A 1HX9A 1O5MB 2D5JA 1GLMA 3S4CA 4FUSA 2H6IB 3RJ3A 1GXMA 4CE7A 1K72A 3G4FA 1TNUB 4GAXA 4Z4LA 4ONTA 3E34B 1N4RB 1KRFA 1TF4A 4AYQA 1W6JA 1RWHA 2WCOA 1D8DB 3P5RA 4L9PB 1FCEA 1FPPB 1C3DA 1O79A 5MEHA 1FO3A 1FT1B 1AYXA 1FBOA 3OEDA 3SDUA 1X1HA 3M73A 4D4CA 4GTOB 1RW9A 2ONHA 3T33A 2FV1A 3C72B 2IEJB 4WVAA 5IL8A 3G6JB 3KSLB 3SDTA 1HV6A 5FOBB 1DOGA 1N1ZA 1H3AA 4C1SA 1HXAA 1H14A 3M00A 3W5NA 3WUXA 2WIIB 3W5MA 4GTMB 4TXTA 1GAHA 1N22A 1KS8A 1H13A 4BOKA 1N23A 4LNBB 2DROA 5ILHA 1RWAA 2BB5A 3P2CA 5DHKA 5DGQA 3SAEA 1L1YA 1JCQB 3PZ2B 1TN8B 1KZOB 3LZ9A 3M75A 4RNQA 1H3BA 1KSCA 1X1IA 3KSQB 3ACSA 2G02A 3A0OA 2GOXA 5ILIA 4KKJA 5DHIA 1HMWA 1X81B 5GY3A 4EL8A 4Q88A 1N7OA 1LXMA 1O6QA 2Q1FA 3HXBB 1H39A 3WKFA 3QXFA 4ZH5A 2BEDB 2PN5A 3K11A 3WC3A 1V5DA 1N9AB 2PMVA 3QT3A 4LNGB 1QBQB 3VSMA 2V8KA 2XWBB 3PZ1B 3QT9A 4GTQB 2WY7A 1OJPA 1HXCA 1CEMA 4WU0A 3SDRA 3SDQA 5FO8B 4V1RA 1KKTA 2BRWA 2CQTA 1N4SB 1HMUA 1EGUA 5ILDA 2A73B 2B4FA 5AGDA 4NEIA 1SA4B 1O1TB 1N4QB 3GZKA 3QPFA 4GTVB 3S4AA 4M76A 4FJQA 1D8EB 2WINB 4Z4JA 1W3YA 4KTPA 2FUQA 3GLYA 3NNBA 1JCSB 3X17A 2YIKA 2WY8A 4KKIA 1GXNA 4FNVA 5JMFA 3M77A 1V7WA 1KFGA 5ILJA 1R76A 2JF4A 1OJMA 4GTTB 3WIWA 2EACA 5IKHA 1QSJA 1H35A 4WVBA 1LTXB 4OZVA 2FUTA 5ILYA 3S4DA 2ONGA 2E22A 1HXGA 4GTSB 5GW7A 2RI8A 2Z07A 3K7XA 2RGKA 3VW5A 1KWFA 3H7LA 3Q7AB 3Q79B 4OJZA 1RWCA 3QXQA 4OK2A 4YCRA 1RQ5A 2ZZRA 1IS9A 5IM1A 1TNYB 2FUZA 4FXGB 1O1RB 3DSWB 1GSZA 3QFYA 2G0DA 1H54A 1F9OA 1N95B 3E37B 3QRYA 2GZ6A 3ANJA 5CD2A
chains in the Genus database with same CATH topology
3E32B 3S9VA 1UMPA 2VN7A 1WU5A 1V7VA 3ACTA 2F6DA 3WKGA 4XUVA 3PMMA 3RX7A 2D8LA 3EQAA 3CU7A 1KREA 2FBAA 4Q2BA 3M7LA 1MZCB 3PZ4B 3QSPA 3WKHA 4EHMB 3EU5B 1NI1B 3M71A 1JS4A 3WKIA 2R2LB 1QQFA 2NOJA 3GT5A 3S4BA 1G87A 3DRAB 3SDVA 2ZIRB 3M7BA 5FO7B 3WIQA 4ZG8A 3RX8A 1UT9A 1TN6B 3QG0A 4ZRQA 2P0VA 1TNOB 4LIXA 3DSXB 2A8ZA 1JCRB 1IA7A 2XFGA 3RENA 3D3IA 4CJ1A 1VD5A 2B39A 1FBWA 2V8JA 3M76A 3ANKA 4D94A 3E73A 3HXCB 1TN7B 4GTPB 4MBGB 1N94B 5M7YA 1X9DA 1F9DA 1AGMA 1FT2B 4D4DA 5JPMB 2GH4A 5GZKA 1KSDA 4WVCA 1SQCA 4J5TA 3DPYB 3EZ8A 3VXDA 5DGRA 1HCUA 3A3VA 1HZFA 2DRQA 5M7IA 5JPNB 3DSVB 2JJBA 2BBCA 1FAEA 3EU8A 2VN4A 1LD8B 3OXUA 2GZ6A 4DOEA 3Q7FB 4GTRB 2EABA 3D5RA 3H2WA 4BOJA 1TNBB 3H3KA 5KKBA 1WU4A 2ZBLA 3M7CA 3QFZA 3HXDB 1XWTA 3HXFB 1LF9A 3CIHA 1GHQA 3SQCA 3M7EA 1IA6A 2V3NA 3DSUB 3EUVB 1CLCA 1TNZB 2QNOA 1GAIA 1NXCA 1NC5A 3PYBA 4L0GA 4AYPA 1KZPB 4D4BA 1LF6A 1GA2A 5CZLA 4AYOA 1FP3A 2AHGA 1V7XA 3E6UA 4YDEB 4CJ0A 1WZZA 2RI9A 3W7UA 1H3CA 1O6RA 1FMIA 2NVPA 1H37A 1N4PB 3ANIA 1XW2A 2XWJB 4DODA 1G6IA 1SA5B 2AHFA 3Q75B 1DCEB 2V8IA 3RX5A 4TF4A 3M74A 1DL2A 3W7WA 3W7XA 1GXOA 3M78A 4YDOB 1UG9A 3E33B 4QT9A 3P5PA 2CQSA 5CA3A 3W7SA 3KLSA 1NL4B 2EAEA 2FV0A 1LD7B 3SFXB 3RRSA 4ZH1A 3ON6A 1G9GA 4V1SA 2V3PA 3RSYA 4AYRA 1H12A 2DRSA 2BB6A 3QDEA 3QWTA 5E2JA 2H6FB 4FXKB 1S63B 1O1SB 3AFJA 1S64B 2JG0A 1O6HA 2AFAA 1W6KA 4KTRA 3Q73B 1WU6A 4MU9A 1ULVA 2ZISB 1V5CA 3DSTB 2F0YB 3Q78B 3TF4A 3WIRA 4L6XA 4LNVA 3PYAA 2H6GB 2SQCA 4ZRPA 1XWQA 3HXEB 3W7TA 3E30B 2EADA 4D4AA 2WYNA 1FO2A 4JJJA 1L2AA 3DSSB 5FO9B 3D5SA 3KQ4A 2H6HB 3PZ3B 4GL3A 2XQWA 2DRRA 3SFYB 1G9JA 2OKXA 2I07B 1H36A 1O5MB 2D5JA 3S4CA 1GLMA 4FUSA 2H6IB 3RJ3A 1GXMA 4CE7A 1K72A 1TNUB 4Z4LA 4ONTA 3E34B 1N4RB 1KRFA 1TF4A 4AYQA 1W6JA 1D8DB 3P5RA 4L9PB 1FCEA 1FPPB 1C3DA 1O79A 5MEHA 1FO3A 1FT1B 1AYXA 1FBOA 3OEDA 3SDUA 3M73A 4D4CA 4GTOB 3T33A 2FV1A 3C72B 2IEJB 4WVAA 3G6JB 3KSLB 3SDTA 5FOBB 1DOGA 1H3AA 4C1SA 1H14A 3W5NA 3WUXA 2WIIB 3W5MA 4GTMB 4TXTA 1GAHA 1KS8A 1H13A 4BOKA 4LNBB 2DROA 2BB5A 3P2CA 5DGQA 3SAEA 1L1YA 1JCQB 3PZ2B 1TN8B 1KZOB 3M75A 1H3BA 1KSCA 3KSQB 3ACSA 2G02A 2GOXA 4KKJA 1X81B 5GY3A 4EL8A 4Q88A 1O6QA 3HXBB 1H39A 3WKFA 3QXFA 4ZH5A 2BEDB 2PN5A 3K11A 3WC3A 1V5DA 1N9AB 2PMVA 3QT3A 4LNGB 1QBQB 2V8KA 2XWBB 3PZ1B 3QT9A 4GTQB 2WY7A 1CEMA 4WU0A 3SDRA 3SDQA 5FO8B 4V1RA 1KKTA 2CQTA 1N4SB 2A73B 2B4FA 5AGDA 1SA4B 1O1TB 1N4QB 3GZKA 3QPFA 4GTVB 3S4AA 4M76A 1D8EB 2WINB 4Z4JA 4KTPA 3GLYA 1JCSB 3X17A 2YIKA 2WY8A 4KKIA 1GXNA 3M77A 1V7WA 1KFGA 1R76A 2JF4A 4GTTB 3WIWA 2EACA 1QSJA 1H35A 4WVBA 1LTXB 3S4DA 4GTSB 5GW7A 2RI8A 2Z07A 3K7XA 2RGKA 3VW5A 1KWFA 3H7LA 3Q7AB 3Q79B 3QXQA 4YCRA 1RQ5A 2ZZRA 1IS9A 1TNYB 2FUZA 4FXGB 1O1RB 3DSWB 1GSZA 3QFYA 2G0DA 1H54A 1F9OA 1N95B 3E37B 3QRYA 3M72A 3ANJA 5CD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN7 A;  1V5C A;  3WKF A;  3QXF A;  1WU5 A;  1V7V A;  3ACT A;  3H2W A;  2F6D A;  4ZH5 A;  3WKG A;  3TF4 A;  4XUV A;  3H3K A;  3PMM A;  3WIR A;  3K11 A;  3WC3 A;  1V5D A;  4L6X A;  3RX7 A;  5KKB A;  3QT3 A;  1WU4 A;  2ZBL A;  2D8L A;  3EQA A;  3QFZ A;  1XWQ A;  3W7T A;  1KRE A;  3QT9 A;  2FBA A;  2EAD A;  4Q2B A;  1CEM A;  1XWT A;  1LF9 A;  2WYN A;  3CIH A;  4WU0 A;  1FO2 A;  4JJJ A;  1L2A A;  3QSP A;  3WKH A;  1IA6 A;  1KKT A;  2CQT A;  1JS4 A;  2DRR A;  3WKI A;  1CLC A;  1G9J A;  2OKX A;  3GT5 A;  2QNO A;  3S4B A;  1G87 A;  1GAI A;  2B4F A;  1NXC A;  2D5J A;  1NC5 A;  3S4C A;  1GLM A;  4FUS A;  3GZK A;  3WIQ A;  4ZG8 A;  4CE7 A;  1K72 A;  3QPF A;  4L0G A;  3RX8 A;  3S4A A;  4AYP A;  4Z4L A;  1LF6 A;  1UT9 A;  1GA2 A;  4Z4J A;  4KTP A;  5CZL A;  4AYO A;  1FP3 A;  2AHG A;  3GLY A;  1V7X A;  3E6U A;  1KRF A;  4CJ0 A;  3X17 A;  1WZZ A;  2RI9 A;  3QG0 A;  1TF4 A;  4AYQ A;  2YIK A;  2P0V A;  3W7U A;  1FCE A;  5MEH A;  1FMI A;  1FO3 A;  2A8Z A;  2NVP A;  1V7W A;  1IA7 A;  1AYX A;  1FBO A;  2XFG A;  3REN A;  1KFG A;  3D3I A;  2JF4 A;  4Q88 A;  4CJ1 A;  1VD5 A;  3T33 A;  1FBW A;  3WIW A;  2FV1 A;  3ANK A;  2EAC A;  3ANI A;  4WVA A;  1XW2 A;  4WVB A;  3E73 A;  4DOD A;  1G6I A;  2AHF A;  1DOG A;  3S4D A;  3RX5 A;  4TF4 A;  5GW7 A;  5M7Y A;  1X9D A;  2RI8 A;  2Z07 A;  1F9D A;  1AGM A;  1DL2 A;  1H14 A;  3W5N A;  3W7W A;  3W7X A;  2RGK A;  2GH4 A;  3WUX A;  1KSD A;  4WVC A;  3VW5 A;  3W5M A;  4TXT A;  1UG9 A;  1KWF A;  3H7L A;  1GAH A;  1KS8 A;  1H13 A;  2CQS A;  5CA3 A;  4J5T A;  3QXQ A;  3W7S A;  4EL8 A;  1RQ5 A;  3EZ8 A;  5DGR A;  2EAE A;  2FV0 A;  1HCU A;  1IS9 A;  2ZZR A;  3A3V A;  2DRO A;  3VXD A;  2DRQ A;  5M7I A;  3RRS A;  3P2C A;  3ON6 A;  1G9G A;  3RSY A;  5DGQ A;  4AYR A;  1L1Y A;  2FUZ A;  1H12 A;  2JJB A;  2DRS A;  3QDE A;  1FAE A;  3QWT A;  5E2J A;  5GY3 A;  1KSC A;  3ACS A;  3QFY A;  3AFJ A;  2VN4 A;  2JG0 A;  4DOE A;  1H54 A;  2EAB A;  2AFA A;  1F9O A;  4KTR A;  3QRY A;  1WU6 A;  2GZ6 A;  3ANJ A;  5CD2 A;  1ULV A; 
#chains in the Genus database with same CATH topology
 3E32 B;  3S9V A;  1RWF A;  1UMP A;  2VN7 A;  1WU5 A;  1V7V A;  3ACT A;  2F6D A;  3WKG A;  4XUV A;  3PMM A;  4MMH A;  3RX7 A;  2D8L A;  3EQA A;  3CU7 A;  1KRE A;  2FBA A;  4Q2B A;  3M7L A;  1MZC B;  3PZ4 B;  3QSP A;  3WKH A;  4EHM B;  3EU5 B;  3AFL A;  1NI1 B;  3M71 A;  4DI5 A;  1N20 A;  5IK0 A;  1JS4 A;  3WKI A;  2R2L B;  1QQF A;  2NOJ A;  3GT5 A;  3S4B A;  1G87 A;  3DRA B;  3SDV A;  2ZIR B;  3M7B A;  5FO7 B;  3WIQ A;  4ZG8 A;  2J5C A;  3RX8 A;  4MMI A;  1UT9 A;  4F13 A;  1RWG A;  2BRV X;  1TN6 B;  3QG0 A;  4ZRQ A;  3E80 A;  2P0V A;  1TNO B;  4LIX A;  3DSX B;  2A8Z A;  1JCR B;  1IA7 A;  2XFG A;  3REN A;  3D3I A;  4CJ1 A;  1VD5 A;  2B39 A;  1FBW A;  2V8J A;  3M76 A;  3ANK A;  1LOH A;  1QAZ A;  4D94 A;  3E73 A;  3HXC B;  1TN7 B;  4GTP B;  4MBG B;  1N94 B;  3N0F A;  1LXK A;  5EAS A;  5M7Y A;  1X9D A;  1CB8 A;  1F9D A;  1AGM A;  1FT2 B;  4D4D A;  5JPM B;  2GH4 A;  5GZK A;  1KSD A;  4WVC A;  3VSN A;  1SQC A;  3M02 A;  4J5T A;  4F10 A;  3DPY B;  3EZ8 A;  3VXD A;  5DGR A;  1HCU A;  3A3V A;  1HZF A;  2DRQ A;  5M7I A;  5ILK A;  5C05 A;  5JPN B;  3DSV B;  5EAU A;  2JJB A;  2BBC A;  1FAE A;  3EU8 A;  2VN4 A;  1LD8 B;  3OXU A;  4DOE A;  3Q7F B;  4GTR B;  2EAB A;  3NFV A;  3G4D A;  1F9G A;  3D5R A;  3H2W A;  4BOJ A;  1TNB B;  3H3K A;  5KKB A;  1WU4 A;  2ZBL A;  3M7C A;  2WDA A;  3QFZ A;  1N7Q A;  3HXD B;  1OJO A;  1XWT A;  3HXF B;  1LF9 A;  3CIH A;  1J0M A;  1N7P A;  1GHQ A;  3SQC A;  3M7E A;  3M72 A;  1IA6 A;  2X03 A;  2V3N A;  3DSU B;  1I8Q A;  3EUV B;  1CLC A;  1TNZ B;  2QNO A;  1GAI A;  1HM3 A;  1NXC A;  1NC5 A;  3PYB A;  3E7J A;  4L0G A;  4AYP A;  3M01 A;  1KZP B;  4D4B A;  1LF6 A;  1GA2 A;  5CZL A;  4AYO A;  1FP3 A;  2AHG A;  1V7X A;  3E6U A;  4YDE B;  4CJ0 A;  1WZZ A;  2RI9 A;  5IKA A;  1F1S A;  3W7U A;  1N24 A;  1H3C A;  1O6R A;  1FMI A;  2NVP A;  5IK9 A;  1OJN A;  1H37 A;  1N4P B;  3ANI A;  1XW2 A;  2XWJ B;  4DOD A;  1G6I A;  1SA5 B;  5JMD A;  2AHF A;  3Q75 B;  1DCE B;  1J0N A;  2V8I A;  3RX5 A;  4TF4 A;  4E1Y A;  3M74 A;  1DL2 A;  3W7W A;  3W7X A;  1GXO A;  3M78 A;  4YDO B;  1UG9 A;  4OZW A;  5IL3 A;  3E33 B;  4QT9 A;  3P5P A;  2CQS A;  5CA3 A;  3W7S A;  3KLS A;  1NL4 B;  2EAE A;  2FV0 A;  1LD7 B;  3SFX B;  3RRS A;  1N7N A;  4ZH1 A;  3ON6 A;  1G9G A;  4V1S A;  2V3P A;  3RSY A;  4AYR A;  1H12 A;  2E24 A;  1HN0 A;  2DRS A;  1C82 A;  2BB6 A;  3QDE A;  3QWT A;  4OK4 A;  5E2J A;  2H6F B;  4FXK B;  1N21 A;  1S63 B;  1O1S B;  3AFJ A;  1S64 B;  3N0G A;  2JG0 A;  1O6H A;  2BRP A;  2AFA A;  1W6K A;  5ILZ A;  4KTR A;  3Q73 B;  1HM2 A;  5IK6 A;  1WU6 A;  4MU9 A;  1ULV A;  2ZIS B;  1V5C A;  3DST B;  2F0Y B;  3Q78 B;  3TF4 A;  3WIR A;  4L6X A;  1N7R A;  4LNV A;  5EAT A;  3PYA A;  2H6G B;  2SQC A;  4ZRP A;  1XWQ A;  3HXE B;  3W7T A;  3E30 B;  2EAD A;  4D4A A;  1N1B A;  2WYN A;  1FO2 A;  4JJJ A;  1L2A A;  3DSS B;  5FO9 B;  1X1J A;  3D5S A;  3KQ4 A;  2H6H B;  3PZ3 B;  4GL3 A;  2XQW A;  2DRR A;  3SFY B;  1G9J A;  2OKX A;  2I07 B;  1H36 A;  1HX9 A;  1O5M B;  2D5J A;  1GLM A;  3S4C A;  4FUS A;  2H6I B;  3RJ3 A;  1GXM A;  4CE7 A;  1K72 A;  3G4F A;  1TNU B;  4GAX A;  4Z4L A;  4ONT A;  3E34 B;  1N4R B;  1KRF A;  1TF4 A;  4AYQ A;  1W6J A;  1RWH A;  2WCO A;  1D8D B;  3P5R A;  4L9P B;  1FCE A;  1FPP B;  1C3D A;  1O79 A;  5MEH A;  1FO3 A;  1FT1 B;  1AYX A;  1FBO A;  3OED A;  3SDU A;  1X1H A;  3M73 A;  4D4C A;  4GTO B;  1RW9 A;  2ONH A;  3T33 A;  2FV1 A;  3C72 B;  2IEJ B;  4WVA A;  5IL8 A;  3G6J B;  3KSL B;  3SDT A;  1HV6 A;  5FOB B;  1DOG A;  1N1Z A;  1H3A A;  4C1S A;  1HXA A;  1H14 A;  3M00 A;  3W5N A;  3WUX A;  2WII B;  3W5M A;  4GTM B;  4TXT A;  1GAH A;  1N22 A;  1KS8 A;  1H13 A;  4BOK A;  1N23 A;  4LNB B;  2DRO A;  5ILH A;  1RWA A;  2BB5 A;  3P2C A;  5DHK A;  5DGQ A;  3SAE A;  1L1Y A;  1JCQ B;  3PZ2 B;  1TN8 B;  1KZO B;  3LZ9 A;  3M75 A;  4RNQ A;  1H3B A;  1KSC A;  1X1I A;  3KSQ B;  3ACS A;  2G02 A;  3A0O A;  2GOX A;  5ILI A;  4KKJ A;  5DHI A;  1HMW A;  1X81 B;  5GY3 A;  4EL8 A;  4Q88 A;  1N7O A;  1LXM A;  1O6Q A;  2Q1F A;  3HXB B;  1H39 A;  3WKF A;  3QXF A;  4ZH5 A;  2BED B;  2PN5 A;  3K11 A;  3WC3 A;  1V5D A;  1N9A B;  2PMV A;  3QT3 A;  4LNG B;  1QBQ B;  3VSM A;  2V8K A;  2XWB B;  3PZ1 B;  3QT9 A;  4GTQ B;  2WY7 A;  1OJP A;  1HXC A;  1CEM A;  4WU0 A;  3SDR A;  3SDQ A;  5FO8 B;  4V1R A;  1KKT A;  2BRW A;  2CQT A;  1N4S B;  1HMU A;  1EGU A;  5ILD A;  2A73 B;  2B4F A;  5AGD A;  4NEI A;  1SA4 B;  1O1T B;  1N4Q B;  3GZK A;  3QPF A;  4GTV B;  3S4A A;  4M76 A;  4FJQ A;  1D8E B;  2WIN B;  4Z4J A;  1W3Y A;  4KTP A;  2FUQ A;  3GLY A;  3NNB A;  1JCS B;  3X17 A;  2YIK A;  2WY8 A;  4KKI A;  1GXN A;  4FNV A;  5JMF A;  3M77 A;  1V7W A;  1KFG A;  5ILJ A;  1R76 A;  2JF4 A;  1OJM A;  4GTT B;  3WIW A;  2EAC A;  5IKH A;  1QSJ A;  1H35 A;  4WVB A;  1LTX B;  4OZV A;  2FUT A;  5ILY A;  3S4D A;  2ONG A;  2E22 A;  1HXG A;  4GTS B;  5GW7 A;  2RI8 A;  2Z07 A;  3K7X A;  2RGK A;  3VW5 A;  1KWF A;  3H7L A;  3Q7A B;  3Q79 B;  4OJZ A;  1RWC A;  3QXQ A;  4OK2 A;  4YCR A;  1RQ5 A;  2ZZR A;  1IS9 A;  5IM1 A;  1TNY B;  2FUZ A;  4FXG B;  1O1R B;  3DSW B;  1GSZ A;  3QFY A;  2G0D A;  1H54 A;  1F9O A;  1N95 B;  3E37 B;  3QRY A;  2GZ6 A;  3ANJ A;  5CD2 A; 
#chains in the Genus database with same CATH homology
 3E32 B;  3S9V A;  1UMP A;  2VN7 A;  1WU5 A;  1V7V A;  3ACT A;  2F6D A;  3WKG A;  4XUV A;  3PMM A;  3RX7 A;  2D8L A;  3EQA A;  3CU7 A;  1KRE A;  2FBA A;  4Q2B A;  3M7L A;  1MZC B;  3PZ4 B;  3QSP A;  3WKH A;  4EHM B;  3EU5 B;  1NI1 B;  3M71 A;  1JS4 A;  3WKI A;  2R2L B;  1QQF A;  2NOJ A;  3GT5 A;  3S4B A;  1G87 A;  3DRA B;  3SDV A;  2ZIR B;  3M7B A;  5FO7 B;  3WIQ A;  4ZG8 A;  3RX8 A;  1UT9 A;  1TN6 B;  3QG0 A;  4ZRQ A;  2P0V A;  1TNO B;  4LIX A;  3DSX B;  2A8Z A;  1JCR B;  1IA7 A;  2XFG A;  3REN A;  3D3I A;  4CJ1 A;  1VD5 A;  2B39 A;  1FBW A;  2V8J A;  3M76 A;  3ANK A;  4D94 A;  3E73 A;  3HXC B;  1TN7 B;  4GTP B;  4MBG B;  1N94 B;  5M7Y A;  1X9D A;  1F9D A;  1AGM A;  1FT2 B;  4D4D A;  5JPM B;  2GH4 A;  5GZK A;  1KSD A;  4WVC A;  1SQC A;  4J5T A;  3DPY B;  3EZ8 A;  3VXD A;  5DGR A;  1HCU A;  3A3V A;  1HZF A;  2DRQ A;  5M7I A;  5JPN B;  3DSV B;  2JJB A;  2BBC A;  1FAE A;  3EU8 A;  2VN4 A;  1LD8 B;  3OXU A;  2GZ6 A;  4DOE A;  3Q7F B;  4GTR B;  2EAB A;  3D5R A;  3H2W A;  4BOJ A;  1TNB B;  3H3K A;  5KKB A;  1WU4 A;  2ZBL A;  3M7C A;  3QFZ A;  3HXD B;  1XWT A;  3HXF B;  1LF9 A;  3CIH A;  1GHQ A;  3SQC A;  3M7E A;  1IA6 A;  2V3N A;  3DSU B;  3EUV B;  1CLC A;  1TNZ B;  2QNO A;  1GAI A;  1NXC A;  1NC5 A;  3PYB A;  4L0G A;  4AYP A;  1KZP B;  4D4B A;  1LF6 A;  1GA2 A;  5CZL A;  4AYO A;  1FP3 A;  2AHG A;  1V7X A;  3E6U A;  4YDE B;  4CJ0 A;  1WZZ A;  2RI9 A;  3W7U A;  1H3C A;  1O6R A;  1FMI A;  2NVP A;  1H37 A;  1N4P B;  3ANI A;  1XW2 A;  2XWJ B;  4DOD A;  1G6I A;  1SA5 B;  2AHF A;  3Q75 B;  1DCE B;  2V8I A;  3RX5 A;  4TF4 A;  3M74 A;  1DL2 A;  3W7W A;  3W7X A;  1GXO A;  3M78 A;  4YDO B;  1UG9 A;  3E33 B;  4QT9 A;  3P5P A;  2CQS A;  5CA3 A;  3W7S A;  3KLS A;  1NL4 B;  2EAE A;  2FV0 A;  1LD7 B;  3SFX B;  3RRS A;  4ZH1 A;  3ON6 A;  1G9G A;  4V1S A;  2V3P A;  3RSY A;  4AYR A;  1H12 A;  2DRS A;  2BB6 A;  3QDE A;  3QWT A;  5E2J A;  2H6F B;  4FXK B;  1S63 B;  1O1S B;  3AFJ A;  1S64 B;  2JG0 A;  1O6H A;  2AFA A;  1W6K A;  4KTR A;  3Q73 B;  1WU6 A;  4MU9 A;  1ULV A;  2ZIS B;  1V5C A;  3DST B;  2F0Y B;  3Q78 B;  3TF4 A;  3WIR A;  4L6X A;  4LNV A;  3PYA A;  2H6G B;  2SQC A;  4ZRP A;  1XWQ A;  3HXE B;  3W7T A;  3E30 B;  2EAD A;  4D4A A;  2WYN A;  1FO2 A;  4JJJ A;  1L2A A;  3DSS B;  5FO9 B;  3D5S A;  3KQ4 A;  2H6H B;  3PZ3 B;  4GL3 A;  2XQW A;  2DRR A;  3SFY B;  1G9J A;  2OKX A;  2I07 B;  1H36 A;  1O5M B;  2D5J A;  3S4C A;  1GLM A;  4FUS A;  2H6I B;  3RJ3 A;  1GXM A;  4CE7 A;  1K72 A;  1TNU B;  4Z4L A;  4ONT A;  3E34 B;  1N4R B;  1KRF A;  1TF4 A;  4AYQ A;  1W6J A;  1D8D B;  3P5R A;  4L9P B;  1FCE A;  1FPP B;  1C3D A;  1O79 A;  5MEH A;  1FO3 A;  1FT1 B;  1AYX A;  1FBO A;  3OED A;  3SDU A;  3M73 A;  4D4C A;  4GTO B;  3T33 A;  2FV1 A;  3C72 B;  2IEJ B;  4WVA A;  3G6J B;  3KSL B;  3SDT A;  5FOB B;  1DOG A;  1H3A A;  4C1S A;  1H14 A;  3W5N A;  3WUX A;  2WII B;  3W5M A;  4GTM B;  4TXT A;  1GAH A;  1KS8 A;  1H13 A;  4BOK A;  4LNB B;  2DRO A;  2BB5 A;  3P2C A;  5DGQ A;  3SAE A;  1L1Y A;  1JCQ B;  3PZ2 B;  1TN8 B;  1KZO B;  3M75 A;  1H3B A;  1KSC A;  3KSQ B;  3ACS A;  2G02 A;  2GOX A;  4KKJ A;  1X81 B;  5GY3 A;  4EL8 A;  4Q88 A;  1O6Q A;  3HXB B;  1H39 A;  3WKF A;  3QXF A;  4ZH5 A;  2BED B;  2PN5 A;  3K11 A;  3WC3 A;  1V5D A;  1N9A B;  2PMV A;  3QT3 A;  4LNG B;  1QBQ B;  2V8K A;  2XWB B;  3PZ1 B;  3QT9 A;  4GTQ B;  2WY7 A;  1CEM A;  4WU0 A;  3SDR A;  3SDQ A;  5FO8 B;  4V1R A;  1KKT A;  2CQT A;  1N4S B;  2A73 B;  2B4F A;  5AGD A;  1SA4 B;  1O1T B;  1N4Q B;  3GZK A;  3QPF A;  4GTV B;  3S4A A;  4M76 A;  1D8E B;  2WIN B;  4Z4J A;  4KTP A;  3GLY A;  1JCS B;  3X17 A;  2YIK A;  2WY8 A;  4KKI A;  1GXN A;  3M77 A;  1V7W A;  1KFG A;  1R76 A;  2JF4 A;  4GTT B;  3WIW A;  2EAC A;  1QSJ A;  1H35 A;  4WVB A;  1LTX B;  3S4D A;  4GTS B;  5GW7 A;  2RI8 A;  2Z07 A;  3K7X A;  2RGK A;  3VW5 A;  1KWF A;  3H7L A;  3Q7A B;  3Q79 B;  3QXQ A;  4YCR A;  1RQ5 A;  2ZZR A;  1IS9 A;  1TNY B;  2FUZ A;  4FXG B;  1O1R B;  3DSW B;  1GSZ A;  3QFY A;  2G0D A;  1H54 A;  1F9O A;  1N95 B;  3E37 B;  3QRY A;  3M72 A;  3ANJ A;  5CD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...