1V5CA

The crystal structure of the inactive form chitosanase from bacillus sp. k17 at ph3.7
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
386
structure length
386
Chain Sequence
AKEMKPFPQQVNYAGVIKPNHVTQESLNASVRSYYDNWKKKYLKNDLSSLPGGYYVKGEITGDADGFKPLGTSEGQGYGMIITVLMAGYDSNAQKIYDGLFKTARTFKSSQNPNLMGWVVADSKKAQGHFDSATDGDLDIAYSLLLAHKQWGSNGTVNYLKEAQDMITKGIKASNVTNNNQLNLGDWDSKSSLDTRPSDWMMSHLRAFYEFTGDKTWLTVINNLYDVYTQFSNKYSPNTGLISDFVVKNPPQPAPKDFLDESEYTNAYYYNASRVPLRIVMDYAMYGEKRSKVISDKVSSWIQNKTNGNPSKIVDGYQLNGSNIGSYPTAVFVSPFIAASITSSNNQKWVNSGWDWMKNKRERYFSDSYNLLTMLFITGNWWKPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitosanase
publication title Crystal structure of family GH-8 chitosanase with subclass II specificity from Bacillus sp. K17
pubmed doi rcsb
molecule tags Hydrolase
total genus 154
structure length 386
sequence length 386
ec nomenclature ec 3.2.1.132: Chitosanase.
pdb deposition date 2003-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1v5cA01
2VN7A 3WIWA 4CJ0A 5DGRA 3RX5A 3EQAA 2Z07A 4ZG8A 4KTPA 3WKFA 1V5DA 3TF4A 3QWTA 3A3VA 1V5CA 1FCEA 5KKBA 5MEHA 3WUXA 2EAEA 3P2CA 4JJJA 3QSPA 1KREA 2AHFA 3QT9A 3WC3A 3D3IA 5M7IA 3ANKA 1GLMA 1IA7A 2WYNA 1XW2A 3QXQA 5E2JA 3W5MA 2DRRA 1RQ5A 2XFGA 3W7WA 3S4AA 3ANIA 3RENA 2D5JA 3WKHA 1HCUA 3W7UA 2QNOA 3ANJA 4ZH5A 2GZ6A 1LF6A 3QFZA 2CQSA 3GZKA 5DGQA 3W7SA 1NC5A 1G87A 5GW7A 3GLYA 1FMIA 5M7YA 1H12A 1DL2A 1L1YA 2DRSA 2A8ZA 3X17A 3AFJA 1UG9A 2GH4A 3H7LA 4CE7A 3PMMA 2JG0A 3QFYA 1XWTA 1F9OA 1V7XA 4EL8A 1FBWA 1KKTA 4L0GA 3K11A 1KFGA 4FUSA 4Z4LA 1F9DA 1ULVA 3QRYA 1IA6A 1G9JA 2EACA 2JJBA 3QXFA 1L2AA 3T33A 1KWFA 3S4DA 3S4BA 2AHGA 2EABA 3H2WA 3CIHA 4KTRA 3EZ8A 1X9DA 1KRFA 1WU6A 1XWQA 1FBOA 4Q2BA 3W7TA 4WVBA 3RX7A 1G9GA 1FO3A 2ZBLA 1JS4A 3RX8A 1KSDA 4CJ1A 4TF4A 4XUVA 3WIQA 4AYRA 4Q88A 1CEMA 4WVCA 3VW5A 1TF4A 4L6XA 2OKXA 1GAIA 2RGKA 5CZLA 4TXTA 1IS9A 2FV1A 3ON6A 3RSYA 4DODA 3S4CA 4Z4JA 1GA2A 3VXDA 2DROA 1K72A 2FBAA 4DOEA 3WKGA 5CA3A 3QG0A 1NXCA 2NVPA 1LF9A 1H54A 1AGMA 1V7VA 1H14A 2RI9A 4J5TA 4AYPA 2F6DA 2JF4A 2VN4A 4AYQA 2CQTA 2RI8A 1DOGA 3QPFA 5CD2A 5GY3A 3ACTA 2D8LA 2DRQA 3WIRA 4AYOA 3QDEA 3GT5A 3RRSA 1G6IA 2ZZRA 1GAHA 3ACSA 2FUZA 1VD5A 3E6UA 3H3KA 1WZZA 3E73A 1V7WA 1AYXA 1FAEA 2YIKA 1CLCA 3W5NA 1H13A 1KSCA 1KS8A 4WU0A 4WVAA 1FP3A 2EADA 1FO2A 1UT9A 3W7XA 2B4FA 2FV0A 3QT3A 3WKIA 1WU5A 2P0VA 2AFAA 1WU4A
chains in the Genus database with same CATH superfamily
2VN7A 3WIWA 3LZ9A 3EQAA 2V8KA 1TN8B 1HMWA 3A3VA 1FCEA 5MEHA 1N9AB 1N4RB 1W6JA 1QBQB 2ZIRB 3DSVB 5GZKA 3PYAA 3ANKA 1GLMA 4YDEB 2H6IB 3S4AA 3ANIA 4NEIA 3RENA 1C3DA 3WKHA 1HCUA 3W7UA 3SDTA 4ZH5A 5EAUA 1J0NA 4GAXA 2CQSA 2I07B 2H6HB 5M7YA 2R2LB 1L1YA 1H3CA 2A8ZA 3M7BA 3X17A 2GH4A 5ILYA 4CE7A 3QFYA 4MU9A 5JPMB 4D4AA 2PN5A 1TN7B 3CU7A 1O1RB 4Z4LA 1IA6A 2JJBA 2WDAA 5FO7B 1UMPA 2WIIB 2EABA 3CIHA 3Q79B 1X9DA 3KSLB 4Q2BA 4WVBA 3SDUA 3RX7A 1FO3A 1X1HA 3E30B 4XUVA 1NL4B 2H6GB 4RNQA 1N21A 1CEMA 1H37A 1GXNA 4GTSB 1RW9A 3M01A 1TF4A 3VW5A 4FXGB 2RGKA 1RWFA 5AGDA 4Z4JA 1O6QA 1HXAA 5FO9B 2FBAA 1HM2A 3WKGA 1HM3A 1LF9A 1H54A 2RI9A 2B39A 4E1YA 2JF4A 4LNVA 4YDOB 1X1IA 1GXMA 1H35A 5FO8B 1J0MA 1H3BA 3WIRA 4AYOA 3QDEA 3GT5A 3RRSA 2ZZRA 2V3PA 1O5MB 2FUZA 3DSTB 5IK9A 1TNBB 1S63B 1WZZA 1HZFA 1V7WA 2YIKA 3M72A 4DI5A 1KS8A 3HXEB 4WVAA 4ZRPA 1N1ZA 2G0DA 1RWHA 1GXOA 1O6HA 1OJOA 3WKIA 1N23A 1FT1B 4CJ0A 2A73B 3RX5A 4D4CA 5ILHA 3WKFA 3VSNA 1V5DA 5JMDA 1LD7B 4LNGB 4C1SA 3HXBB 2E22A 4D4DA 3SFYB 1H36A 3N0GA 1X81B 1IA7A 2WYNA 1XW2A 3Q75B 2WY8A 1O79A 1TNUB 3DSXB 4QT9A 3W7WA 5ILZA 1RWGA 3DSSB 1H3AA 3ANJA 1LF6A 1N1BA 3GZKA 5DGQA 3Q78B 5EATA 3M7CA 1NC5A 5GW7A 3DPYB 2BBCA 3HXFB 2DRSA 4GTMB 1JCRB 4GTOB 3H7LA 3PZ3B 1F9OA 1V7XA 4ZRQA 4GTPB 4EL8A 1KKTA 3M75A 4GTQB 3K11A 1KFGA 3E34B 1I8QA 4FUSA 4LNBB 2Q1FA 1G9JA 3QXFA 1KWFA 1GHQA 3S4DA 1OJMA 3S4BA 2E24A 3EZ8A 1XWQA 4BOJA 1G9GA 1TNOB 5ILDA 4TF4A 1NI1B 4Q88A 2ZISB 5JMFA 1N20A 1QSJA 3P5PA 5CZLA 1W3YA 1OJPA 2FV1A 3PZ1B 4DODA 2ONGA 4FXKB 1LXKA 2V8IA 1K72A 5IK6A 1N7OA 3M02A 1NXCA 3AFLA 4GTRB 1QQFA 2F6DA 5IKHA 4AYQA 3D5SA 2RI8A 1DOGA 2V3NA 3Q7AB 1QAZA 3HXDB 2XWBB 1HV6A 4FNVA 3E73A 1CLCA 3P5RA 4KKJA 2EADA 5JPNB 1FO2A 3W7XA 2FV0A 4MMHA 2P0VA 3QT3A 2AFAA 1N7PA 3DSWB 2Z07A 4KTPA 3QWTA 5KKBA 4KKIA 4OJZA 3M73A 3P2CA 2V8JA 1N4PB 1FPPB 2WINB 3WC3A 3M7LA 5E2JA 3W5MA 3SAEA 1RQ5A 2D5JA 2QNOA 1LTXB 2FUQA 3SDQA 1DCEB 3M7EA 3W7SA 1G87A 3GLYA 4GTVB 1GSZA 1H12A 1S64B 3M76A 3G4FA 3AFJA 3PMMA 4GL3A 1N7QA 1FBWA 1N4QB 1F9DA 3QRYA 1L2AA 3T33A 1F9GA 1HXGA 3H2WA 4F13A 4KTRA 4MMIA 4D94A 1WU6A 5DHKA 1FBOA 4L9PB 2BB5A 1TN6B 3W7TA 4V1RA 3SDVA 4MBGB 1RWAA 5ILKA 3G6JB 1TNZB 3RX8A 1KSDA 3M77A 3Q7FB 3PZ4B 4FJQA 4CJ1A 4AYRA 1RWCA 1OJNA 1O1SB 3EU8A 4WVCA 3M71A 1HN0A 4L6XA 2FUTA 1D8EB 4TXTA 1X1JA 1IS9A 3NFVA 5IKAA 3ON6A 3OXUA 3N0FA 3E33B 3VXDA 1HXCA 1O1TB 5DHIA 3QG0A 3G4DA 1AGMA 4J5TA 5FOBB 2VN4A 2CQTA 1HMUA 3QPFA 5CD2A 3SFXB 5GY3A 1N22A 5ILJA 2DRQA 2GOXA 2NOJA 2BRWA 3DSUB 1GAHA 3E32B 4OK4A 3KQ4A 1MZCB 1AYXA 4OK2A 1FAEA 1H39A 3W5NA 5IL8A 4ZH1A 3PZ2B 1UT9A 1LD8B 4OZVA 5IK0A 2B4FA 3RJ3A 4M76A 3EUVB 5DGRA 4ZG8A 2G02A 3TF4A 1V5CA 2ONHA 4GTTB 3WUXA 3VSMA 2EAEA 3KLSA 1CB8A 4JJJA 3QSPA 1KREA 2AHFA 3QT9A 2SQCA 3D3IA 5M7IA 3QXQA 4D4BA 2DRRA 1D8DB 2XFGA 1HX9A 1JCSB 4BOKA 3D5RA 2GZ6A 1KZPB 2BRVX 3QFZA 2BB6A 5IM1A 1FMIA 1DL2A 2XWJB 1R76A 1N95B 1UG9A 2XQWA 3K7XA 3NNBA 2JG0A 1XWTA 1TNYB 2BRPA 3E80A 5ILIA 4L0GA 1FT2B 3EU5B 3PYBA 2IEJB 3E37B 1ULVA 2EACA 3A0OA 2AHGA 2F0YB 1JCQB 1KRFA 1W6KA 2BEDB 2ZBLA 3HXCB 4F10A 1F1SA 1JS4A 1N4SB 1N7RA 3M00A 3WIQA 1SQCA 1SA4B 2OKXA 1GAIA 2J5CA 3M74A 3C72B 4LIXA 3RSYA 3S4CA 1GA2A 2DROA 2X03A 1SA5B 4DOEA 5EASA 5C05A 5CA3A 3DRAB 3SDRA 2NVPA 5IL3A 2H6FB 1V7VA 1H14A 4AYPA 1N94B 4OZWA 1N7NA 2WCOA 2D8LA 3ACTA 4YCRA 1G6IA 4EHMB 3E7JA 1N24A 3S9VA 1KZOB 3ACSA 1VD5A 3E6UA 1LOHA 3H3KA 1H13A 1KSCA 1C82A 1LXMA 3Q73B 4WU0A 4ONTA 1FP3A 2WY7A 1EGUA 2PMVA 4V1SA 3KSQB 1O6RA 1WU5A 3OEDA 1WU4A 3SQCA 3M78A
chains in the Genus database with same CATH topology
2VN7A 3WIWA 3EQAA 2V8KA 1TN8B 3A3VA 1FCEA 5MEHA 1N9AB 1N4RB 1W6JA 1QBQB 2ZIRB 3DSVB 5GZKA 3PYAA 3ANKA 1GLMA 4YDEB 2H6IB 3S4AA 3ANIA 3RENA 3WKHA 1C3DA 1HCUA 3W7UA 3SDTA 4ZH5A 2CQSA 2I07B 2H6HB 5M7YA 2R2LB 1L1YA 1H3CA 2A8ZA 3M7BA 3X17A 2GH4A 4CE7A 3QFYA 4MU9A 5JPMB 4D4AA 2PN5A 1TN7B 3CU7A 1O1RB 4Z4LA 1IA6A 2JJBA 5FO7B 1UMPA 2WIIB 2EABA 3CIHA 3Q79B 1X9DA 3KSLB 4Q2BA 4WVBA 3SDUA 3RX7A 1FO3A 3E30B 4XUVA 1NL4B 2H6GB 1CEMA 1H37A 1GXNA 4GTSB 3VW5A 1TF4A 4FXGB 2RGKA 5AGDA 4Z4JA 1O6QA 5FO9B 2FBAA 3WKGA 1LF9A 1H54A 2RI9A 2B39A 2JF4A 4LNVA 4YDOB 1GXMA 1H35A 5FO8B 1H3BA 3WIRA 4AYOA 3QDEA 3GT5A 3RRSA 2ZZRA 2V3PA 1O5MB 2FUZA 3DSTB 1TNBB 1S63B 1WZZA 1HZFA 1V7WA 2YIKA 3M72A 1KS8A 3HXEB 4WVAA 4ZRPA 2G0DA 1GXOA 1O6HA 3WKIA 1FT1B 4CJ0A 2A73B 3RX5A 4D4CA 3WKFA 1V5DA 1LD7B 4LNGB 4C1SA 3HXBB 4D4DA 3SFYB 1H36A 1X81B 1IA7A 2WYNA 1XW2A 3Q75B 2WY8A 1O79A 1TNUB 3DSXB 4QT9A 3W7WA 3DSSB 1H3AA 3ANJA 1LF6A 3GZKA 5DGQA 3Q78B 3M7CA 1NC5A 5GW7A 3DPYB 2BBCA 3HXFB 2DRSA 4GTMB 1JCRB 4GTOB 3H7LA 3PZ3B 1F9OA 1V7XA 4ZRQA 4GTPB 4EL8A 1KKTA 3M75A 4GTQB 3K11A 1KFGA 4FUSA 3E34B 4LNBB 1G9JA 3QXFA 1KWFA 1GHQA 3S4DA 3S4BA 3EZ8A 1XWQA 4BOJA 1G9GA 1TNOB 4TF4A 1NI1B 4Q88A 2ZISB 1QSJA 3P5PA 5CZLA 3PZ1B 2FV1A 4DODA 4FXKB 2V8IA 1K72A 1NXCA 4GTRB 1QQFA 2F6DA 4AYQA 3D5SA 2RI8A 1DOGA 2V3NA 3Q7AB 3HXDB 2XWBB 3E73A 1CLCA 3P5RA 4KKJA 2EADA 5JPNB 1FO2A 3W7XA 2FV0A 2P0VA 3QT3A 2AFAA 3DSWB 2Z07A 4KTPA 3QWTA 5KKBA 4KKIA 3M73A 3P2CA 2V8JA 1N4PB 1FPPB 2WINB 3WC3A 3M7LA 5E2JA 3W5MA 3SAEA 1RQ5A 2D5JA 2QNOA 1LTXB 3SDQA 1DCEB 3M7EA 3W7SA 1G87A 3GLYA 4GTVB 1GSZA 3M76A 1H12A 1S64B 3AFJA 3PMMA 4GL3A 1FBWA 1N4QB 1F9DA 3QRYA 1L2AA 3T33A 3H2WA 4KTRA 4D94A 1WU6A 1FBOA 4L9PB 2BB5A 1TN6B 3W7TA 4V1RA 3SDVA 4MBGB 3G6JB 1TNZB 3RX8A 1KSDA 3M77A 3Q7FB 3PZ4B 4CJ1A 4AYRA 1O1SB 3EU8A 4WVCA 3M71A 4L6XA 1D8EB 4TXTA 1IS9A 3ON6A 3OXUA 3E33B 3VXDA 1O1TB 3QG0A 1AGMA 4J5TA 5FOBB 2VN4A 2CQTA 3QPFA 5CD2A 3SFXB 5GY3A 2DRQA 2GOXA 2NOJA 3DSUB 1GAHA 3E32B 3KQ4A 1MZCB 1AYXA 1FAEA 1H39A 3W5NA 4ZH1A 3PZ2B 1UT9A 1LD8B 2B4FA 3RJ3A 4M76A 3EUVB 5DGRA 4ZG8A 2G02A 3TF4A 1V5CA 4GTTB 3WUXA 2EAEA 3KLSA 4JJJA 3QSPA 1KREA 2AHFA 3QT9A 2SQCA 3D3IA 5M7IA 3QXQA 4D4BA 2DRRA 1D8DB 2XFGA 1JCSB 4BOKA 3D5RA 2GZ6A 1KZPB 3QFZA 2BB6A 1FMIA 1DL2A 2XWJB 1R76A 1N95B 1UG9A 2XQWA 3K7XA 2JG0A 1XWTA 1TNYB 4L0GA 1FT2B 3EU5B 3PYBA 2IEJB 3E37B 1ULVA 2EACA 2AHGA 2F0YB 1KRFA 1JCQB 1W6KA 2BEDB 2ZBLA 3HXCB 1JS4A 1N4SB 3WIQA 1SQCA 1SA4B 2OKXA 1GAIA 3M74A 3C72B 4LIXA 3RSYA 3S4CA 1GA2A 2DROA 1SA5B 4DOEA 5CA3A 3DRAB 3SDRA 2NVPA 2H6FB 1V7VA 1H14A 4AYPA 1N94B 3ACTA 2D8LA 4YCRA 1G6IA 4EHMB 3S9VA 1KZOB 3ACSA 1VD5A 3E6UA 3H3KA 1H13A 1KSCA 4WU0A 3Q73B 4ONTA 1FP3A 2WY7A 2PMVA 4V1SA 3KSQB 1O6RA 1WU5A 3OEDA 1WU4A 3SQCA 3M78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN7 A;  3WIW A;  4CJ0 A;  5DGR A;  3RX5 A;  3EQA A;  2Z07 A;  4ZG8 A;  4KTP A;  3WKF A;  1V5D A;  3TF4 A;  3QWT A;  3A3V A;  1V5C A;  1FCE A;  5KKB A;  5MEH A;  3WUX A;  2EAE A;  3P2C A;  4JJJ A;  3QSP A;  1KRE A;  2AHF A;  3QT9 A;  3WC3 A;  3D3I A;  5M7I A;  3ANK A;  1GLM A;  1IA7 A;  2WYN A;  1XW2 A;  3QXQ A;  5E2J A;  3W5M A;  2DRR A;  1RQ5 A;  2XFG A;  3W7W A;  3S4A A;  3ANI A;  3REN A;  2D5J A;  3WKH A;  1HCU A;  3W7U A;  2QNO A;  3ANJ A;  4ZH5 A;  2GZ6 A;  1LF6 A;  3QFZ A;  2CQS A;  3GZK A;  5DGQ A;  3W7S A;  1NC5 A;  1G87 A;  5GW7 A;  3GLY A;  1FMI A;  5M7Y A;  1H12 A;  1DL2 A;  1L1Y A;  2DRS A;  2A8Z A;  3X17 A;  3AFJ A;  1UG9 A;  2GH4 A;  3H7L A;  4CE7 A;  3PMM A;  2JG0 A;  3QFY A;  1XWT A;  1F9O A;  1V7X A;  4EL8 A;  1FBW A;  1KKT A;  4L0G A;  3K11 A;  1KFG A;  4FUS A;  4Z4L A;  1F9D A;  1ULV A;  3QRY A;  1IA6 A;  1G9J A;  2EAC A;  2JJB A;  3QXF A;  1L2A A;  3T33 A;  1KWF A;  3S4D A;  3S4B A;  2AHG A;  2EAB A;  3H2W A;  3CIH A;  4KTR A;  3EZ8 A;  1X9D A;  1KRF A;  1WU6 A;  1XWQ A;  1FBO A;  4Q2B A;  3W7T A;  4WVB A;  3RX7 A;  1G9G A;  1FO3 A;  2ZBL A;  1JS4 A;  3RX8 A;  1KSD A;  4CJ1 A;  4TF4 A;  4XUV A;  3WIQ A;  4AYR A;  4Q88 A;  1CEM A;  4WVC A;  3VW5 A;  1TF4 A;  4L6X A;  2OKX A;  1GAI A;  2RGK A;  5CZL A;  4TXT A;  1IS9 A;  2FV1 A;  3ON6 A;  3RSY A;  4DOD A;  3S4C A;  4Z4J A;  1GA2 A;  3VXD A;  2DRO A;  1K72 A;  2FBA A;  4DOE A;  3WKG A;  5CA3 A;  3QG0 A;  1NXC A;  2NVP A;  1LF9 A;  1H54 A;  1AGM A;  1V7V A;  1H14 A;  2RI9 A;  4J5T A;  4AYP A;  2F6D A;  2JF4 A;  2VN4 A;  4AYQ A;  2CQT A;  2RI8 A;  1DOG A;  3QPF A;  5CD2 A;  5GY3 A;  3ACT A;  2D8L A;  2DRQ A;  3WIR A;  4AYO A;  3QDE A;  3GT5 A;  3RRS A;  1G6I A;  2ZZR A;  1GAH A;  3ACS A;  2FUZ A;  1VD5 A;  3E6U A;  3H3K A;  1WZZ A;  3E73 A;  1V7W A;  1AYX A;  1FAE A;  2YIK A;  1CLC A;  3W5N A;  1H13 A;  1KSC A;  1KS8 A;  4WU0 A;  4WVA A;  1FP3 A;  2EAD A;  1FO2 A;  1UT9 A;  3W7X A;  2B4F A;  2FV0 A;  3QT3 A;  3WKI A;  1WU5 A;  2P0V A;  2AFA A;  1WU4 A; 
#chains in the Genus database with same CATH topology
 2VN7 A;  3WIW A;  3LZ9 A;  3EQA A;  2V8K A;  1TN8 B;  1HMW A;  3A3V A;  1FCE A;  5MEH A;  1N9A B;  1N4R B;  1W6J A;  1QBQ B;  2ZIR B;  3DSV B;  5GZK A;  3PYA A;  3ANK A;  1GLM A;  4YDE B;  2H6I B;  3S4A A;  3ANI A;  4NEI A;  3REN A;  1C3D A;  3WKH A;  1HCU A;  3W7U A;  3SDT A;  4ZH5 A;  5EAU A;  1J0N A;  4GAX A;  2CQS A;  2I07 B;  2H6H B;  5M7Y A;  2R2L B;  1L1Y A;  1H3C A;  2A8Z A;  3M7B A;  3X17 A;  2GH4 A;  5ILY A;  4CE7 A;  3QFY A;  4MU9 A;  5JPM B;  4D4A A;  2PN5 A;  1TN7 B;  3CU7 A;  1O1R B;  4Z4L A;  1IA6 A;  2JJB A;  2WDA A;  5FO7 B;  1UMP A;  2WII B;  2EAB A;  3CIH A;  3Q79 B;  1X9D A;  3KSL B;  4Q2B A;  4WVB A;  3SDU A;  3RX7 A;  1FO3 A;  1X1H A;  3E30 B;  4XUV A;  1NL4 B;  2H6G B;  4RNQ A;  1N21 A;  1CEM A;  1H37 A;  1GXN A;  4GTS B;  1RW9 A;  3M01 A;  1TF4 A;  3VW5 A;  4FXG B;  2RGK A;  1RWF A;  5AGD A;  4Z4J A;  1O6Q A;  1HXA A;  5FO9 B;  2FBA A;  1HM2 A;  3WKG A;  1HM3 A;  1LF9 A;  1H54 A;  2RI9 A;  2B39 A;  4E1Y A;  2JF4 A;  4LNV A;  4YDO B;  1X1I A;  1GXM A;  1H35 A;  5FO8 B;  1J0M A;  1H3B A;  3WIR A;  4AYO A;  3QDE A;  3GT5 A;  3RRS A;  2ZZR A;  2V3P A;  1O5M B;  2FUZ A;  3DST B;  5IK9 A;  1TNB B;  1S63 B;  1WZZ A;  1HZF A;  1V7W A;  2YIK A;  3M72 A;  4DI5 A;  1KS8 A;  3HXE B;  4WVA A;  4ZRP A;  1N1Z A;  2G0D A;  1RWH A;  1GXO A;  1O6H A;  1OJO A;  3WKI A;  1N23 A;  1FT1 B;  4CJ0 A;  2A73 B;  3RX5 A;  4D4C A;  5ILH A;  3WKF A;  3VSN A;  1V5D A;  5JMD A;  1LD7 B;  4LNG B;  4C1S A;  3HXB B;  2E22 A;  4D4D A;  3SFY B;  1H36 A;  3N0G A;  1X81 B;  1IA7 A;  2WYN A;  1XW2 A;  3Q75 B;  2WY8 A;  1O79 A;  1TNU B;  3DSX B;  4QT9 A;  3W7W A;  5ILZ A;  1RWG A;  3DSS B;  1H3A A;  3ANJ A;  1LF6 A;  1N1B A;  3GZK A;  5DGQ A;  3Q78 B;  5EAT A;  3M7C A;  1NC5 A;  5GW7 A;  3DPY B;  2BBC A;  3HXF B;  2DRS A;  4GTM B;  1JCR B;  4GTO B;  3H7L A;  3PZ3 B;  1F9O A;  1V7X A;  4ZRQ A;  4GTP B;  4EL8 A;  1KKT A;  3M75 A;  4GTQ B;  3K11 A;  1KFG A;  3E34 B;  1I8Q A;  4FUS A;  4LNB B;  2Q1F A;  1G9J A;  3QXF A;  1KWF A;  1GHQ A;  3S4D A;  1OJM A;  3S4B A;  2E24 A;  3EZ8 A;  1XWQ A;  4BOJ A;  1G9G A;  1TNO B;  5ILD A;  4TF4 A;  1NI1 B;  4Q88 A;  2ZIS B;  5JMF A;  1N20 A;  1QSJ A;  3P5P A;  5CZL A;  1W3Y A;  1OJP A;  2FV1 A;  3PZ1 B;  4DOD A;  2ONG A;  4FXK B;  1LXK A;  2V8I A;  1K72 A;  5IK6 A;  1N7O A;  3M02 A;  1NXC A;  3AFL A;  4GTR B;  1QQF A;  2F6D A;  5IKH A;  4AYQ A;  3D5S A;  2RI8 A;  1DOG A;  2V3N A;  3Q7A B;  1QAZ A;  3HXD B;  2XWB B;  1HV6 A;  4FNV A;  3E73 A;  1CLC A;  3P5R A;  4KKJ A;  2EAD A;  5JPN B;  1FO2 A;  3W7X A;  2FV0 A;  4MMH A;  2P0V A;  3QT3 A;  2AFA A;  1N7P A;  3DSW B;  2Z07 A;  4KTP A;  3QWT A;  5KKB A;  4KKI A;  4OJZ A;  3M73 A;  3P2C A;  2V8J A;  1N4P B;  1FPP B;  2WIN B;  3WC3 A;  3M7L A;  5E2J A;  3W5M A;  3SAE A;  1RQ5 A;  2D5J A;  2QNO A;  1LTX B;  2FUQ A;  3SDQ A;  1DCE B;  3M7E A;  3W7S A;  1G87 A;  3GLY A;  4GTV B;  1GSZ A;  1H12 A;  1S64 B;  3M76 A;  3G4F A;  3AFJ A;  3PMM A;  4GL3 A;  1N7Q A;  1FBW A;  1N4Q B;  1F9D A;  3QRY A;  1L2A A;  3T33 A;  1F9G A;  1HXG A;  3H2W A;  4F13 A;  4KTR A;  4MMI A;  4D94 A;  1WU6 A;  5DHK A;  1FBO A;  4L9P B;  2BB5 A;  1TN6 B;  3W7T A;  4V1R A;  3SDV A;  4MBG B;  1RWA A;  5ILK A;  3G6J B;  1TNZ B;  3RX8 A;  1KSD A;  3M77 A;  3Q7F B;  3PZ4 B;  4FJQ A;  4CJ1 A;  4AYR A;  1RWC A;  1OJN A;  1O1S B;  3EU8 A;  4WVC A;  3M71 A;  1HN0 A;  4L6X A;  2FUT A;  1D8E B;  4TXT A;  1X1J A;  1IS9 A;  3NFV A;  5IKA A;  3ON6 A;  3OXU A;  3N0F A;  3E33 B;  3VXD A;  1HXC A;  1O1T B;  5DHI A;  3QG0 A;  3G4D A;  1AGM A;  4J5T A;  5FOB B;  2VN4 A;  2CQT A;  1HMU A;  3QPF A;  5CD2 A;  3SFX B;  5GY3 A;  1N22 A;  5ILJ A;  2DRQ A;  2GOX A;  2NOJ A;  2BRW A;  3DSU B;  1GAH A;  3E32 B;  4OK4 A;  3KQ4 A;  1MZC B;  1AYX A;  4OK2 A;  1FAE A;  1H39 A;  3W5N A;  5IL8 A;  4ZH1 A;  3PZ2 B;  1UT9 A;  1LD8 B;  4OZV A;  5IK0 A;  2B4F A;  3RJ3 A;  4M76 A;  3EUV B;  5DGR A;  4ZG8 A;  2G02 A;  3TF4 A;  1V5C A;  2ONH A;  4GTT B;  3WUX A;  3VSM A;  2EAE A;  3KLS A;  1CB8 A;  4JJJ A;  3QSP A;  1KRE A;  2AHF A;  3QT9 A;  2SQC A;  3D3I A;  5M7I A;  3QXQ A;  4D4B A;  2DRR A;  1D8D B;  2XFG A;  1HX9 A;  1JCS B;  4BOK A;  3D5R A;  2GZ6 A;  1KZP B;  2BRV X;  3QFZ A;  2BB6 A;  5IM1 A;  1FMI A;  1DL2 A;  2XWJ B;  1R76 A;  1N95 B;  1UG9 A;  2XQW A;  3K7X A;  3NNB A;  2JG0 A;  1XWT A;  1TNY B;  2BRP A;  3E80 A;  5ILI A;  4L0G A;  1FT2 B;  3EU5 B;  3PYB A;  2IEJ B;  3E37 B;  1ULV A;  2EAC A;  3A0O A;  2AHG A;  2F0Y B;  1JCQ B;  1KRF A;  1W6K A;  2BED B;  2ZBL A;  3HXC B;  4F10 A;  1F1S A;  1JS4 A;  1N4S B;  1N7R A;  3M00 A;  3WIQ A;  1SQC A;  1SA4 B;  2OKX A;  1GAI A;  2J5C A;  3M74 A;  3C72 B;  4LIX A;  3RSY A;  3S4C A;  1GA2 A;  2DRO A;  2X03 A;  1SA5 B;  4DOE A;  5EAS A;  5C05 A;  5CA3 A;  3DRA B;  3SDR A;  2NVP A;  5IL3 A;  2H6F B;  1V7V A;  1H14 A;  4AYP A;  1N94 B;  4OZW A;  1N7N A;  2WCO A;  2D8L A;  3ACT A;  4YCR A;  1G6I A;  4EHM B;  3E7J A;  1N24 A;  3S9V A;  1KZO B;  3ACS A;  1VD5 A;  3E6U A;  1LOH A;  3H3K A;  1H13 A;  1KSC A;  1C82 A;  1LXM A;  3Q73 B;  4WU0 A;  4ONT A;  1FP3 A;  2WY7 A;  1EGU A;  2PMV A;  4V1S A;  3KSQ B;  1O6R A;  1WU5 A;  3OED A;  1WU4 A;  3SQC A;  3M78 A; 
#chains in the Genus database with same CATH homology
 2VN7 A;  3WIW A;  3EQA A;  2V8K A;  1TN8 B;  3A3V A;  1FCE A;  5MEH A;  1N9A B;  1N4R B;  1W6J A;  1QBQ B;  2ZIR B;  3DSV B;  5GZK A;  3PYA A;  3ANK A;  1GLM A;  4YDE B;  2H6I B;  3S4A A;  3ANI A;  3REN A;  3WKH A;  1C3D A;  1HCU A;  3W7U A;  3SDT A;  4ZH5 A;  2CQS A;  2I07 B;  2H6H B;  5M7Y A;  2R2L B;  1L1Y A;  1H3C A;  2A8Z A;  3M7B A;  3X17 A;  2GH4 A;  4CE7 A;  3QFY A;  4MU9 A;  5JPM B;  4D4A A;  2PN5 A;  1TN7 B;  3CU7 A;  1O1R B;  4Z4L A;  1IA6 A;  2JJB A;  5FO7 B;  1UMP A;  2WII B;  2EAB A;  3CIH A;  3Q79 B;  1X9D A;  3KSL B;  4Q2B A;  4WVB A;  3SDU A;  3RX7 A;  1FO3 A;  3E30 B;  4XUV A;  1NL4 B;  2H6G B;  1CEM A;  1H37 A;  1GXN A;  4GTS B;  3VW5 A;  1TF4 A;  4FXG B;  2RGK A;  5AGD A;  4Z4J A;  1O6Q A;  5FO9 B;  2FBA A;  3WKG A;  1LF9 A;  1H54 A;  2RI9 A;  2B39 A;  2JF4 A;  4LNV A;  4YDO B;  1GXM A;  1H35 A;  5FO8 B;  1H3B A;  3WIR A;  4AYO A;  3QDE A;  3GT5 A;  3RRS A;  2ZZR A;  2V3P A;  1O5M B;  2FUZ A;  3DST B;  1TNB B;  1S63 B;  1WZZ A;  1HZF A;  1V7W A;  2YIK A;  3M72 A;  1KS8 A;  3HXE B;  4WVA A;  4ZRP A;  2G0D A;  1GXO A;  1O6H A;  3WKI A;  1FT1 B;  4CJ0 A;  2A73 B;  3RX5 A;  4D4C A;  3WKF A;  1V5D A;  1LD7 B;  4LNG B;  4C1S A;  3HXB B;  4D4D A;  3SFY B;  1H36 A;  1X81 B;  1IA7 A;  2WYN A;  1XW2 A;  3Q75 B;  2WY8 A;  1O79 A;  1TNU B;  3DSX B;  4QT9 A;  3W7W A;  3DSS B;  1H3A A;  3ANJ A;  1LF6 A;  3GZK A;  5DGQ A;  3Q78 B;  3M7C A;  1NC5 A;  5GW7 A;  3DPY B;  2BBC A;  3HXF B;  2DRS A;  4GTM B;  1JCR B;  4GTO B;  3H7L A;  3PZ3 B;  1F9O A;  1V7X A;  4ZRQ A;  4GTP B;  4EL8 A;  1KKT A;  3M75 A;  4GTQ B;  3K11 A;  1KFG A;  4FUS A;  3E34 B;  4LNB B;  1G9J A;  3QXF A;  1KWF A;  1GHQ A;  3S4D A;  3S4B A;  3EZ8 A;  1XWQ A;  4BOJ A;  1G9G A;  1TNO B;  4TF4 A;  1NI1 B;  4Q88 A;  2ZIS B;  1QSJ A;  3P5P A;  5CZL A;  3PZ1 B;  2FV1 A;  4DOD A;  4FXK B;  2V8I A;  1K72 A;  1NXC A;  4GTR B;  1QQF A;  2F6D A;  4AYQ A;  3D5S A;  2RI8 A;  1DOG A;  2V3N A;  3Q7A B;  3HXD B;  2XWB B;  3E73 A;  1CLC A;  3P5R A;  4KKJ A;  2EAD A;  5JPN B;  1FO2 A;  3W7X A;  2FV0 A;  2P0V A;  3QT3 A;  2AFA A;  3DSW B;  2Z07 A;  4KTP A;  3QWT A;  5KKB A;  4KKI A;  3M73 A;  3P2C A;  2V8J A;  1N4P B;  1FPP B;  2WIN B;  3WC3 A;  3M7L A;  5E2J A;  3W5M A;  3SAE A;  1RQ5 A;  2D5J A;  2QNO A;  1LTX B;  3SDQ A;  1DCE B;  3M7E A;  3W7S A;  1G87 A;  3GLY A;  4GTV B;  1GSZ A;  3M76 A;  1H12 A;  1S64 B;  3AFJ A;  3PMM A;  4GL3 A;  1FBW A;  1N4Q B;  1F9D A;  3QRY A;  1L2A A;  3T33 A;  3H2W A;  4KTR A;  4D94 A;  1WU6 A;  1FBO A;  4L9P B;  2BB5 A;  1TN6 B;  3W7T A;  4V1R A;  3SDV A;  4MBG B;  3G6J B;  1TNZ B;  3RX8 A;  1KSD A;  3M77 A;  3Q7F B;  3PZ4 B;  4CJ1 A;  4AYR A;  1O1S B;  3EU8 A;  4WVC A;  3M71 A;  4L6X A;  1D8E B;  4TXT A;  1IS9 A;  3ON6 A;  3OXU A;  3E33 B;  3VXD A;  1O1T B;  3QG0 A;  1AGM A;  4J5T A;  5FOB B;  2VN4 A;  2CQT A;  3QPF A;  5CD2 A;  3SFX B;  5GY3 A;  2DRQ A;  2GOX A;  2NOJ A;  3DSU B;  1GAH A;  3E32 B;  3KQ4 A;  1MZC B;  1AYX A;  1FAE A;  1H39 A;  3W5N A;  4ZH1 A;  3PZ2 B;  1UT9 A;  1LD8 B;  2B4F A;  3RJ3 A;  4M76 A;  3EUV B;  5DGR A;  4ZG8 A;  2G02 A;  3TF4 A;  1V5C A;  4GTT B;  3WUX A;  2EAE A;  3KLS A;  4JJJ A;  3QSP A;  1KRE A;  2AHF A;  3QT9 A;  2SQC A;  3D3I A;  5M7I A;  3QXQ A;  4D4B A;  2DRR A;  1D8D B;  2XFG A;  1JCS B;  4BOK A;  3D5R A;  2GZ6 A;  1KZP B;  3QFZ A;  2BB6 A;  1FMI A;  1DL2 A;  2XWJ B;  1R76 A;  1N95 B;  1UG9 A;  2XQW A;  3K7X A;  2JG0 A;  1XWT A;  1TNY B;  4L0G A;  1FT2 B;  3EU5 B;  3PYB A;  2IEJ B;  3E37 B;  1ULV A;  2EAC A;  2AHG A;  2F0Y B;  1KRF A;  1JCQ B;  1W6K A;  2BED B;  2ZBL A;  3HXC B;  1JS4 A;  1N4S B;  3WIQ A;  1SQC A;  1SA4 B;  2OKX A;  1GAI A;  3M74 A;  3C72 B;  4LIX A;  3RSY A;  3S4C A;  1GA2 A;  2DRO A;  1SA5 B;  4DOE A;  5CA3 A;  3DRA B;  3SDR A;  2NVP A;  2H6F B;  1V7V A;  1H14 A;  4AYP A;  1N94 B;  3ACT A;  2D8L A;  4YCR A;  1G6I A;  4EHM B;  3S9V A;  1KZO B;  3ACS A;  1VD5 A;  3E6U A;  3H3K A;  1H13 A;  1KSC A;  4WU0 A;  3Q73 B;  4ONT A;  1FP3 A;  2WY7 A;  2PMV A;  4V1S A;  3KSQ B;  1O6R A;  1WU5 A;  3OED A;  1WU4 A;  3SQC A;  3M78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...