1V5MA

Solution structure of the pleckstrin homology domain of mouse aps
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
136
structure length
136
Chain Sequence
GSSGSSGNLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH2 and PH domain-containing adapter protein APS
publication title Solution Structure of the Pleckstrin Homology Domain of Mouse APS
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 16
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1v5mA00
4A5KA 3AU4A 3MPXA 4A6HA 3TVVA 2X18A 4KHOA 2UZRA 3PP2A 4HAVB 2L2IA 1XD4A 3TCAA 1RRPB 1EF1A 2H7DA 2CAYA 4PQ0A 5C79A 4F7UP 5KQ4A 2RUKB 5D3VA 2EJ8A 2VSZA 1AQCA 1X1GA 4WJ7A 1Q67A 1SGHA 4DXAB 1WI1A 2N0YA 1UPQA 1OQNA 4P7IA 3QBVB 3IVFA 2GCJA 2ROVA 2YRYA 1M7RA 1FOEA 2QKMA 3FEHA 1UEFA 4IFSA 1P3RA 3PVUA 4EJNA 1MK7B 4XWXA 5GOWB 2Z0OA 4HB2B 3SO6A 2ADZA 3KRWA 4MK0A 1V5PA 4IOYX 5DHAB 2DLWA 5KCVA 2DYQA 2XQNM 4CYEA 1I7AA 4F7GA 3ODXA 3SUZA 2ELBA 1ZSQA 3PZDA 4NY0A 1EAZA 5HE1A 3TFMA 2DHJA 2COFA 3P6AA 4HHVA 4YONA 5HE3A 2E2XA 3KZ1A 3QIJA 3ZDTA 2I1JA 1FB8A 3VIAA 1V88A 3SYXA 1IRSA 5FI0A 1M7EA 1EVHA 3UZTA 1U2BA 3RCPA 1ZC3B 2I5CA 2YT0A 1UNRA 2Y8GA 2DA0A 4HB0B 1UPRA 2P8VA 4CHJA 2K00A 2D2QA 1KZ7A 4GPTB 2DFKA 3CXBB 4HAXB 1P6SA 1W1DA 2YVCA 4YL8A 2LOXA 3MDBC 5DHFB 2LULA 5DH9B 1WJMA 2ELAA 1W1HA 1DROA 2COCA 5D3WA 1V89A 2FJLA 2DHKA 2P0HA 3A8PA 4GXBA 3CIKA 4GMXB 3HK0A 1H4RA 4GMVA 2W2XC 2D9ZA 1N3HA 3TO1A 1BAKA 2DTCA 2RGNB 4K81A 2J0MA 5D3YA 1WVHA 4HAYB 4A6FB 5C5BB 4A6FA 1TJ6A 1OMWA 3G9WA 2HTHB 1Y19B 4HAWB 3M1IB 2CY5A 4GN1A 1AWEA 1FAOA 2P0FA 4HB3B 1XX0A 1DDWA 5KQ1A 2P0DA 2YS3A 4Z2NA 1TXDA 2R0DA 4EKUA 2D9XA 1H10A 1NI2A 4HDQA 1E5WA 2KGXB 3NSUA 2I1KA 2DKQA 1V5UA 1XODA 3T06A 3DXDA 1W1GA 2D9WA 2YT1A 3WA0A 2GS0A 1XR0B 5L81A 2ZPYA 2YS5A 1EGXA 2J0JA 2EMTA 2VKIA 3D8EA 2L1CA 1DYNA 2I5FA 2AL6A 1XKEA 1U5EA 1B55A 1TQZA 3AU5A 2UZSA 4Z2MB 2MFQA 1KZGA 2CY4A 1RJ2A 2VRWB 3PVLA 2RVBB 2OTXA 5J3YA 5DI9B 2K2JA 3P7ZA 4ZRJA 2Q13A 3HW2B 4H8SA 1ZC4B 5JLJB 5DIFB 2BCJA 3D8DA 4ZRIA 1MPHA 2DX5A 2D9YA 1V61A 1FGYA 2K2UA 3KSYA 2W2XD 5J3TA 1OY2A 4K17A 2DN6A 4GZUA 4D0NB 4C0AA 2DHIA 1Z87A 2HE7A 1MAIA 3KRXA 4ZRKA 2GJYA 2COAA 2DX1A 2ROZB 2MKRA 4WVFB 1XCGA 4A6KA 1U5DA 4MT7A 1WJ1A 2AEHA 1GC7A 2MWNB 1FHOA 4HAUB 2LG1A 1U29A 1I2HA 2LYDA 2RLOA 3PEGA 2NZ8B 3F0WA 2G35A 3QWMA 3ODOA 4HAZB 2Z0PA 4TKNA 3PSCA 5CLQB 3LJUX 5C5BA 1MKEA 3SV1A 3TW1A 1Y5OA 1BWNA 4L6EA 2PZ1A 2V76A 5CLLB 1K5GB 1MIXA 4HB4B 1U5FA 1LW3A 5C6RA 4K2PA 4BBKA 1WG7A 3V5WA 3BJIA 2YSZA 3FSSA 1SHCA 2GCLA 2RNRB 2LKOA 1DBHA 1GG3A 1FGZA 3PVWA 5LONB 2DKPA 1BTKA 4CHMA 2M14A 3D8FA 1BTNA 1PLSA 5C16A 3GYPA 2D10A 3U7DA 1KI1B 2NMBA 5D27A 1X1FA 3KY9A 4KHAA 3F5RA 1ZVRA 4KVGB 1X11A 1X05A 2D4QA 3HQCA 1FHWA 4KAXB 5FI1A 4DBBA 4WSFA 2QKLA 1MIZB 1LB1A 3ML4A 1P5TA 3VOQA 4DX8A 1UNPA 1DDMA 3BINA 5LOPB 2EC1A 2H7EA 4HDOA 1PMSA 2IYBA 2KCJA 5HE0A 3ULCA 1X86A 4DX90 3SNHA 1QC6A 3PG7A 4TYZA 3GYOA 2JP2A 2W2WA 5JHGA 5HE2A 1QQGA 2Y8FA 1UNQA 3N7CA 2CRFA 5J3QA 4K2OA 4KHBB 3ODWA 2YS1A 2KUPA 3X23A 2EMSA 1J0WA 2YF0A 2Z0QA 3O96A 1J19A 5EFXA 2UVMA 1GC6A 2J59M 3U8ZA 4NSWA 2D9VA 3AJ4A 3ULBA 4B6HA 5JHHA 1U27A 1WGUA 2CODA 1DDVA 4HATB 1MK9B 1U5GA 2OQBA 1NTVA 1WGQA 1NU2A 3DXEA 4PNKA 2J0KA 1FHXA 2N23A 3OANA 4MY6A 1NTYA 1V5MA 1ISNA 3ZVRA 1ZM0A 2RSGA 2Y7BA 3DXCA 2M38A 4EMOA 2LOZA 2D11A 3A8QA 4Y94A 2MDXA 4F7HA 5JP4A 3A98B 2R09A 4IAPA 3FM8C 1K5DB 2DYNA 3WYFB 2IFSA 5D3XA 1PFJA
chains in the Genus database with same CATH superfamily
4A5KA 3AU4A 3HSAA 3MPXA 4A6HA 3TVVA 2X18A 2KIGA 4KHOA 2K49A 2UZRA 3PP2A 4HAVB 2L2IA 1XD4A 3TCAA 1RRPB 1EF1A 2H7DA 2CAYA 4PQ0A 5C79A 4F7UP 5KQ4A 2RUKB 5D3VA 2EJ8A 2VSZA 1AQCA 1X1GA 4WJ7A 1Q67A 1SGHA 4DXAB 1WI1A 2N0YA 1UPQA 3A58A 1OQNA 4P7IA 3QBVB 3IVFA 2GCJA 2ROVA 2YRYA 1M7RA 4HSIA 1FOEA 2QKMA 3FEHA 1UEFA 4IFSA 1P3RA 3PVUA 4EJNA 1MK7B 4XWXA 5GOWB 2Z0OA 4HB2B 5M4YB 3SO6A 2ADZA 3KRWA 4MK0A 1V5PA 4IOYX 5DHAB 2DLWA 5KCVA 2DYQA 2XQNM 4CYEA 1I7AA 4F7GA 3ODXA 3SUZA 2ELBA 1ZSQA 3PZDA 4NY0A 1EAZA 5HE1A 3TFMA 2DHJA 2COFA 3P6AA 4HHVA 4YONA 5HE3A 4KHBA 2E2XA 3KZ1A 3QIJA 3ZDTA 2I1JA 1FB8A 3VIAA 1V88A 3SYXA 1IRSA 5FI0A 1M7EA 1EVHA 3UZTA 1U2BA 3RCPA 1ZC3B 2I5CA 2YT0A 1UNRA 2Y8GA 2DA0A 4HB0B 1UPRA 2P8VA 4CHJA 2K00A 2D2QA 5IRSA 1KZ7A 2KIEA 4GPTB 2DFKA 3CXBB 4QJ5B 4HAXB 1P6SA 1W1DA 2YVCA 4YL8A 5LG4B 2LOXA 3MDBC 5DHFB 2LULA 5DH9B 1WJMA 2ELAA 1W1HA 1DROA 2COCA 5D3WA 1V89A 2FJLA 2DHKA 2P0HA 3A8PA 3NWFA 4GXBA 3CIKA 4GMXB 3HK0A 1H4RA 4GMVA 2W2XC 2D9ZA 1N3HA 3TO1A 5I2SA 1BAKA 2DTCA 2RGNB 4K81A 2J0MA 5D3YA 1WVHA 4HAYB 4A6FB 5C5BB 4A6FA 1TJ6A 1OMWA 3G9WA 2HTHB 4DIXA 3NWAA 1Y19B 4HAWB 3M1IB 2CY5A 4GN1A 1AWEA 1FAOA 2P0FA 4HB3B 1XX0A 1DDWA 5KQ1A 2P0DA 2YS3A 4L1RA 4Z2NA 1TXDA 2R0DA 4EKUA 2D9XA 1H10A 1NI2A 4HDQA 1E5WA 2KGXB 3NSUA 2I1KA 2DKQA 1V5UA 1XODA 3T06A 3DXDA 1W1GA 2D9WA 2YT1A 3WA0A 2GS0A 1XR0B 5L81A 2ZPYA 2YS5A 1EGXA 2J0JA 1ZYIA 2EMTA 2VKIA 3D8EA 5I2MA 2L1CA 1DYNA 2I5FA 2AL6A 1XKEA 1U5EA 1B55A 1TQZA 3AU5A 2UZSA 4Z2MB 2MFQA 1KZGA 2CY4A 1RJ2A 1MI1A 2VRWB 3PVLA 2RVBB 2OTXA 5J3YA 5DI9B 2K2JA 3P7ZA 4ZRJA 2Q13A 3HW2B 4H8SA 1ZC4B 5JLJB 5DIFB 2BCJA 3D8DA 4ZRIA 1MPHA 2DX5A 2D9YA 3DCXA 1V61A 1FGYA 2K2UA 3KSYA 2W2XD 5J3TA 1OY2A 4K17A 2DN6A 4GZUA 4D0NB 4C0AA 2DHIA 1Z87A 2HE7A 4GOUA 1MAIA 2RRFA 3KRXA 4ZRKA 2GJYA 2COAA 2DX1A 2ROZB 2MKRA 4WVFB 1XCGA 4A6KA 1U5DA 4MT7A 1WJ1A 2AEHA 2GUMA 1GC7A 2MWNB 4CSQA 1FHOA 4HAUB 2LG1A 1U29A 3NW8A 3OHMB 1I2HA 2LYDA 2RLOA 3PEGA 2NZ8B 2YT2A 3F0WA 2G35A 3QWMA 3ODOA 4HAZB 2Z0PA 4TKNA 3PSCA 5CLQB 4OSNA 3LJUX 5C5BA 1MKEA 3SV1A 3FVCA 3TW1A 1Y5OA 3HIEA 1BWNA 2ZKMX 4L6EA 2PZ1A 2V76A 5CLLB 1K5GB 1MIXA 4HB4B 1U5FA 1LW3A 5C6RA 4K2PA 4BBKA 3NWDA 1WG7A 3V5WA 3BJIA 2YSZA 3FSSA 4D6WA 1SHCA 2GCLA 2RNRB 2LKOA 2KR0A 4QJ3B 1DBHA 1GG3A 1FGZA 3PVWA 5LONB 2DKPA 1BTKA 4CHMA 2M14A 3D8FA 1BTNA 1PLSA 4QXAB 5C16A 3GYPA 2D10A 2FJUB 3U7DA 1KI1B 2NMBA 5D27A 2NBVA 1X1FA 1T77A 3KY9A 4KHAA 3F5RA 1ZVRA 4KVGB 1X11A 1X05A 2D4QA 3HQCA 1FHWA 4KAXB 5FI1A 4DBBA 4WSFA 2QKLA 1MIZB 1LB1A 3ML4A 1P5TA 3VOQA 4DX8A 1UNPA 2R2YA 1DDMA 3BINA 5LOPB 2EC1A 2H7EA 4HDOA 1PMSA 2IYBA 2KCJA 5HE0A 2K8EA 3ULCA 1X86A 4DX90 3SNHA 1QC6A 3PG7A 4TYZA 3GYOA 2JP2A 2W2WA 4OT1A 5HE2A 5JHGA 1QQGA 2Y8FA 1UNQA 3N7CA 2CRFA 5J3QA 4K2OA 4KHBB 3ODWA 2YS1A 3B77A 2KUPA 2Z14A 3X23A 2EMSA 2Z4DA 1J0WA 2YF0A 2Z0QA 3U12A 4QJ4B 3O96A 1J19A 5EFXA 2Z13A 2UVMA 1GC6A 2J59M 2KUQA 2Z59A 3U8ZA 4NSWA 2D9VA 3AJ4A 3ULBA 4B6HA 5JHHA 1U27A 1WGUA 2CODA 1DDVA 4HATB 1MK9B 1U5GA 2OQBA 1NTVA 1WGQA 1NU2A 3DXEA 4PNKA 2J0KA 1FHXA 2N23A 3OANA 4MY6A 1NTYA 1V5MA 1ISNA 3ZVRA 1ZM0A 2RSGA 2Y7BA 4GNKB 3DXCA 2M38A 4EMOA 2LOZA 2D11A 3A8QA 4Y94A 2MDXA 4F7HA 5JP4A 3A98B 2R09A 4IAPA 3FM8C 1K5DB 2DYNA 3WYFB 2IFSA 5D3XA 1PFJA
chains in the Genus database with same CATH topology
4A5KA 3AU4A 3MPXA 4A6HA 3TVVA 2X18A 4KHOA 2UZRA 3PP2A 4HAVB 2L2IA 1XD4A 3TCAA 1RRPB 1EF1A 2H7DA 2CAYA 4PQ0A 5C79A 4F7UP 5KQ4A 2RUKB 5D3VA 2EJ8A 2VSZA 1AQCA 1X1GA 4WJ7A 1Q67A 1SGHA 4DXAB 1WI1A 2N0YA 1UPQA 1OQNA 4P7IA 3QBVB 3IVFA 2GCJA 2ROVA 2YRYA 1M7RA 1FOEA 2QKMA 3FEHA 1UEFA 4IFSA 1P3RA 3PVUA 4EJNA 1MK7B 4XWXA 5GOWB 2Z0OA 4HB2B 3SO6A 2ADZA 3KRWA 4MK0A 1V5PA 4IOYX 5DHAB 2DLWA 5KCVA 2DYQA 2XQNM 4CYEA 1I7AA 4F7GA 3ODXA 3SUZA 2ELBA 1ZSQA 3PZDA 4NY0A 1EAZA 5HE1A 3TFMA 2DHJA 2COFA 3P6AA 4HHVA 4YONA 5HE3A 2E2XA 3KZ1A 3QIJA 3ZDTA 2I1JA 1FB8A 3VIAA 1V88A 3SYXA 1IRSA 5FI0A 1M7EA 1EVHA 3UZTA 1U2BA 3RCPA 1ZC3B 2I5CA 2YT0A 1UNRA 2Y8GA 2DA0A 4HB0B 1UPRA 2P8VA 4CHJA 2K00A 2D2QA 1KZ7A 4GPTB 2DFKA 3CXBB 4HAXB 1P6SA 1W1DA 2YVCA 4YL8A 2LOXA 3MDBC 5DHFB 2LULA 5DH9B 1WJMA 2ELAA 1W1HA 1DROA 2COCA 5D3WA 1V89A 2FJLA 2DHKA 2P0HA 3A8PA 4GXBA 3CIKA 4GMXB 3HK0A 1H4RA 4GMVA 2W2XC 2D9ZA 1N3HA 3TO1A 1BAKA 2DTCA 2RGNB 4K81A 2J0MA 5D3YA 1WVHA 4HAYB 4A6FB 5C5BB 4A6FA 1TJ6A 1OMWA 3G9WA 2HTHB 1Y19B 4HAWB 3M1IB 2CY5A 4GN1A 1AWEA 1FAOA 2P0FA 4HB3B 1XX0A 1DDWA 5KQ1A 2P0DA 2YS3A 4Z2NA 1TXDA 2R0DA 4EKUA 2D9XA 1H10A 1NI2A 4HDQA 1E5WA 2KGXB 3NSUA 2I1KA 2DKQA 1V5UA 1XODA 3T06A 3DXDA 1W1GA 2D9WA 2YT1A 3WA0A 2GS0A 1XR0B 5L81A 2ZPYA 2YS5A 1EGXA 2J0JA 2EMTA 2VKIA 3D8EA 2L1CA 1DYNA 2I5FA 2AL6A 1XKEA 1U5EA 1B55A 1TQZA 3AU5A 2UZSA 4Z2MB 2MFQA 1KZGA 2CY4A 1RJ2A 2VRWB 3PVLA 2RVBB 2OTXA 5J3YA 5DI9B 2K2JA 3P7ZA 4ZRJA 2Q13A 3HW2B 4H8SA 1ZC4B 5JLJB 5DIFB 2BCJA 3D8DA 4ZRIA 1MPHA 2DX5A 2D9YA 1V61A 1FGYA 2K2UA 3KSYA 2W2XD 5J3TA 1OY2A 4K17A 2DN6A 4GZUA 4D0NB 4C0AA 2DHIA 1Z87A 2HE7A 1MAIA 3KRXA 4ZRKA 2GJYA 2COAA 2DX1A 2ROZB 2MKRA 4WVFB 1XCGA 4A6KA 1U5DA 4MT7A 1WJ1A 2AEHA 1GC7A 2MWNB 1FHOA 4HAUB 2LG1A 1U29A 1I2HA 2LYDA 2RLOA 3PEGA 2NZ8B 3F0WA 2G35A 3QWMA 3ODOA 4HAZB 2Z0PA 4TKNA 3PSCA 5CLQB 3LJUX 5C5BA 1MKEA 3SV1A 3TW1A 1Y5OA 1BWNA 4L6EA 2PZ1A 2V76A 5CLLB 1K5GB 1MIXA 4HB4B 1U5FA 1LW3A 5C6RA 4K2PA 4BBKA 1WG7A 3V5WA 3BJIA 2YSZA 3FSSA 1SHCA 2GCLA 2RNRB 2LKOA 1DBHA 1GG3A 1FGZA 3PVWA 5LONB 2DKPA 1BTKA 4CHMA 2M14A 3D8FA 1BTNA 1PLSA 5C16A 3GYPA 2D10A 3U7DA 1KI1B 2NMBA 5D27A 1X1FA 3KY9A 4KHAA 3F5RA 1ZVRA 4KVGB 1X11A 1X05A 2D4QA 3HQCA 1FHWA 4KAXB 5FI1A 4DBBA 4WSFA 2QKLA 1MIZB 1LB1A 3ML4A 1P5TA 3VOQA 4DX8A 1UNPA 1DDMA 3BINA 5LOPB 2EC1A 2H7EA 4HDOA 1PMSA 2IYBA 2KCJA 5HE0A 3ULCA 1X86A 4DX90 3SNHA 1QC6A 3PG7A 4TYZA 3GYOA 2JP2A 2W2WA 5JHGA 5HE2A 1QQGA 2Y8FA 1UNQA 3N7CA 2CRFA 5J3QA 4K2OA 4KHBB 3ODWA 2YS1A 2KUPA 3X23A 2EMSA 1J0WA 2YF0A 2Z0QA 3O96A 1J19A 5EFXA 2UVMA 1GC6A 2J59M 3U8ZA 4NSWA 2D9VA 3AJ4A 3ULBA 4B6HA 5JHHA 1U27A 1WGUA 2CODA 1DDVA 4HATB 1MK9B 1U5GA 2OQBA 1NTVA 1WGQA 1NU2A 3DXEA 4PNKA 2J0KA 1FHXA 2N23A 3OANA 4MY6A 1NTYA 1V5MA 1ISNA 3ZVRA 1ZM0A 2RSGA 2Y7BA 3DXCA 2M38A 4EMOA 2LOZA 2D11A 3A8QA 4Y94A 2MDXA 4F7HA 5JP4A 3A98B 2R09A 4IAPA 3FM8C 1K5DB 2DYNA 3WYFB 2IFSA 5D3XA 1PFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5K A;  3AU4 A;  3MPX A;  4A6H A;  3TVV A;  2X18 A;  4KHO A;  2UZR A;  3PP2 A;  4HAV B;  2L2I A;  1XD4 A;  3TCA A;  1RRP B;  1EF1 A;  2H7D A;  2CAY A;  4PQ0 A;  5C79 A;  4F7U P;  5KQ4 A;  2RUK B;  5D3V A;  2EJ8 A;  2VSZ A;  1AQC A;  1X1G A;  4WJ7 A;  1Q67 A;  1SGH A;  4DXA B;  1WI1 A;  2N0Y A;  1UPQ A;  1OQN A;  4P7I A;  3QBV B;  3IVF A;  2GCJ A;  2ROV A;  2YRY A;  1M7R A;  1FOE A;  2QKM A;  3FEH A;  1UEF A;  4IFS A;  1P3R A;  3PVU A;  4EJN A;  1MK7 B;  4XWX A;  5GOW B;  2Z0O A;  4HB2 B;  3SO6 A;  2ADZ A;  3KRW A;  4MK0 A;  1V5P A;  4IOY X;  5DHA B;  2DLW A;  5KCV A;  2DYQ A;  2XQN M;  4CYE A;  1I7A A;  4F7G A;  3ODX A;  3SUZ A;  2ELB A;  1ZSQ A;  3PZD A;  4NY0 A;  1EAZ A;  5HE1 A;  3TFM A;  2DHJ A;  2COF A;  3P6A A;  4HHV A;  4YON A;  5HE3 A;  2E2X A;  3KZ1 A;  3QIJ A;  3ZDT A;  2I1J A;  1FB8 A;  3VIA A;  1V88 A;  3SYX A;  1IRS A;  5FI0 A;  1M7E A;  1EVH A;  3UZT A;  1U2B A;  3RCP A;  1ZC3 B;  2I5C A;  2YT0 A;  1UNR A;  2Y8G A;  2DA0 A;  4HB0 B;  1UPR A;  2P8V A;  4CHJ A;  2K00 A;  2D2Q A;  1KZ7 A;  4GPT B;  2DFK A;  3CXB B;  4HAX B;  1P6S A;  1W1D A;  2YVC A;  4YL8 A;  2LOX A;  3MDB C;  5DHF B;  2LUL A;  5DH9 B;  1WJM A;  2ELA A;  1W1H A;  1DRO A;  2COC A;  5D3W A;  1V89 A;  2FJL A;  2DHK A;  2P0H A;  3A8P A;  4GXB A;  3CIK A;  4GMX B;  3HK0 A;  1H4R A;  4GMV A;  2W2X C;  2D9Z A;  1N3H A;  3TO1 A;  1BAK A;  2DTC A;  2RGN B;  4K81 A;  2J0M A;  5D3Y A;  1WVH A;  4HAY B;  4A6F B;  5C5B B;  4A6F A;  1TJ6 A;  1OMW A;  3G9W A;  2HTH B;  1Y19 B;  4HAW B;  3M1I B;  2CY5 A;  4GN1 A;  1AWE A;  1FAO A;  2P0F A;  4HB3 B;  1XX0 A;  1DDW A;  5KQ1 A;  2P0D A;  2YS3 A;  4Z2N A;  1TXD A;  2R0D A;  4EKU A;  2D9X A;  1H10 A;  1NI2 A;  4HDQ A;  1E5W A;  2KGX B;  3NSU A;  2I1K A;  2DKQ A;  1V5U A;  1XOD A;  3T06 A;  3DXD A;  1W1G A;  2D9W A;  2YT1 A;  3WA0 A;  2GS0 A;  1XR0 B;  5L81 A;  2ZPY A;  2YS5 A;  1EGX A;  2J0J A;  2EMT A;  2VKI A;  3D8E A;  2L1C A;  1DYN A;  2I5F A;  2AL6 A;  1XKE A;  1U5E A;  1B55 A;  1TQZ A;  3AU5 A;  2UZS A;  4Z2M B;  2MFQ A;  1KZG A;  2CY4 A;  1RJ2 A;  2VRW B;  3PVL A;  2RVB B;  2OTX A;  5J3Y A;  5DI9 B;  2K2J A;  3P7Z A;  4ZRJ A;  2Q13 A;  3HW2 B;  4H8S A;  1ZC4 B;  5JLJ B;  5DIF B;  2BCJ A;  3D8D A;  4ZRI A;  1MPH A;  2DX5 A;  2D9Y A;  1V61 A;  1FGY A;  2K2U A;  3KSY A;  2W2X D;  5J3T A;  1OY2 A;  4K17 A;  2DN6 A;  4GZU A;  4D0N B;  4C0A A;  2DHI A;  1Z87 A;  2HE7 A;  1MAI A;  3KRX A;  4ZRK A;  2GJY A;  2COA A;  2DX1 A;  2ROZ B;  2MKR A;  4WVF B;  1XCG A;  4A6K A;  1U5D A;  4MT7 A;  1WJ1 A;  2AEH A;  1GC7 A;  2MWN B;  1FHO A;  4HAU B;  2LG1 A;  1U29 A;  1I2H A;  2LYD A;  2RLO A;  3PEG A;  2NZ8 B;  3F0W A;  2G35 A;  3QWM A;  3ODO A;  4HAZ B;  2Z0P A;  4TKN A;  3PSC A;  5CLQ B;  3LJU X;  5C5B A;  1MKE A;  3SV1 A;  3TW1 A;  1Y5O A;  1BWN A;  4L6E A;  2PZ1 A;  2V76 A;  5CLL B;  1K5G B;  1MIX A;  4HB4 B;  1U5F A;  1LW3 A;  5C6R A;  4K2P A;  4BBK A;  1WG7 A;  3V5W A;  3BJI A;  2YSZ A;  3FSS A;  1SHC A;  2GCL A;  2RNR B;  2LKO A;  1DBH A;  1GG3 A;  1FGZ A;  3PVW A;  5LON B;  2DKP A;  1BTK A;  4CHM A;  2M14 A;  3D8F A;  1BTN A;  1PLS A;  5C16 A;  3GYP A;  2D10 A;  3U7D A;  1KI1 B;  2NMB A;  5D27 A;  1X1F A;  3KY9 A;  4KHA A;  3F5R A;  1ZVR A;  4KVG B;  1X11 A;  1X05 A;  2D4Q A;  3HQC A;  1FHW A;  4KAX B;  5FI1 A;  4DBB A;  4WSF A;  2QKL A;  1MIZ B;  1LB1 A;  3ML4 A;  1P5T A;  3VOQ A;  4DX8 A;  1UNP A;  1DDM A;  3BIN A;  5LOP B;  2EC1 A;  2H7E A;  4HDO A;  1PMS A;  2IYB A;  2KCJ A;  5HE0 A;  3ULC A;  1X86 A;  4DX9 0;  3SNH A;  1QC6 A;  3PG7 A;  4TYZ A;  3GYO A;  2JP2 A;  2W2W A;  5JHG A;  5HE2 A;  1QQG A;  2Y8F A;  1UNQ A;  3N7C A;  2CRF A;  5J3Q A;  4K2O A;  4KHB B;  3ODW A;  2YS1 A;  2KUP A;  3X23 A;  2EMS A;  1J0W A;  2YF0 A;  2Z0Q A;  3O96 A;  1J19 A;  5EFX A;  2UVM A;  1GC6 A;  2J59 M;  3U8Z A;  4NSW A;  2D9V A;  3AJ4 A;  3ULB A;  4B6H A;  5JHH A;  1U27 A;  1WGU A;  2COD A;  1DDV A;  4HAT B;  1MK9 B;  1U5G A;  2OQB A;  1NTV A;  1WGQ A;  1NU2 A;  3DXE A;  4PNK A;  2J0K A;  1FHX A;  2N23 A;  3OAN A;  4MY6 A;  1NTY A;  1V5M A;  1ISN A;  3ZVR A;  1ZM0 A;  2RSG A;  2Y7B A;  3DXC A;  2M38 A;  4EMO A;  2LOZ A;  2D11 A;  3A8Q A;  4Y94 A;  2MDX A;  4F7H A;  5JP4 A;  3A98 B;  2R09 A;  4IAP A;  3FM8 C;  1K5D B;  2DYN A;  3WYF B;  2IFS A;  5D3X A;  1PFJ A; 
#chains in the Genus database with same CATH topology
 4A5K A;  3AU4 A;  3HSA A;  3MPX A;  4A6H A;  3TVV A;  2X18 A;  2KIG A;  4KHO A;  2K49 A;  2UZR A;  3PP2 A;  4HAV B;  2L2I A;  1XD4 A;  3TCA A;  1RRP B;  1EF1 A;  2H7D A;  2CAY A;  4PQ0 A;  5C79 A;  4F7U P;  5KQ4 A;  2RUK B;  5D3V A;  2EJ8 A;  2VSZ A;  1AQC A;  1X1G A;  4WJ7 A;  1Q67 A;  1SGH A;  4DXA B;  1WI1 A;  2N0Y A;  1UPQ A;  3A58 A;  1OQN A;  4P7I A;  3QBV B;  3IVF A;  2GCJ A;  2ROV A;  2YRY A;  1M7R A;  4HSI A;  1FOE A;  2QKM A;  3FEH A;  1UEF A;  4IFS A;  1P3R A;  3PVU A;  4EJN A;  1MK7 B;  4XWX A;  5GOW B;  2Z0O A;  4HB2 B;  5M4Y B;  3SO6 A;  2ADZ A;  3KRW A;  4MK0 A;  1V5P A;  4IOY X;  5DHA B;  2DLW A;  5KCV A;  2DYQ A;  2XQN M;  4CYE A;  1I7A A;  4F7G A;  3ODX A;  3SUZ A;  2ELB A;  1ZSQ A;  3PZD A;  4NY0 A;  1EAZ A;  5HE1 A;  3TFM A;  2DHJ A;  2COF A;  3P6A A;  4HHV A;  4YON A;  5HE3 A;  4KHB A;  2E2X A;  3KZ1 A;  3QIJ A;  3ZDT A;  2I1J A;  1FB8 A;  3VIA A;  1V88 A;  3SYX A;  1IRS A;  5FI0 A;  1M7E A;  1EVH A;  3UZT A;  1U2B A;  3RCP A;  1ZC3 B;  2I5C A;  2YT0 A;  1UNR A;  2Y8G A;  2DA0 A;  4HB0 B;  1UPR A;  2P8V A;  4CHJ A;  2K00 A;  2D2Q A;  5IRS A;  1KZ7 A;  2KIE A;  4GPT B;  2DFK A;  3CXB B;  4QJ5 B;  4HAX B;  1P6S A;  1W1D A;  2YVC A;  4YL8 A;  5LG4 B;  2LOX A;  3MDB C;  5DHF B;  2LUL A;  5DH9 B;  1WJM A;  2ELA A;  1W1H A;  1DRO A;  2COC A;  5D3W A;  1V89 A;  2FJL A;  2DHK A;  2P0H A;  3A8P A;  3NWF A;  4GXB A;  3CIK A;  4GMX B;  3HK0 A;  1H4R A;  4GMV A;  2W2X C;  2D9Z A;  1N3H A;  3TO1 A;  5I2S A;  1BAK A;  2DTC A;  2RGN B;  4K81 A;  2J0M A;  5D3Y A;  1WVH A;  4HAY B;  4A6F B;  5C5B B;  4A6F A;  1TJ6 A;  1OMW A;  3G9W A;  2HTH B;  4DIX A;  3NWA A;  1Y19 B;  4HAW B;  3M1I B;  2CY5 A;  4GN1 A;  1AWE A;  1FAO A;  2P0F A;  4HB3 B;  1XX0 A;  1DDW A;  5KQ1 A;  2P0D A;  2YS3 A;  4L1R A;  4Z2N A;  1TXD A;  2R0D A;  4EKU A;  2D9X A;  1H10 A;  1NI2 A;  4HDQ A;  1E5W A;  2KGX B;  3NSU A;  2I1K A;  2DKQ A;  1V5U A;  1XOD A;  3T06 A;  3DXD A;  1W1G A;  2D9W A;  2YT1 A;  3WA0 A;  2GS0 A;  1XR0 B;  5L81 A;  2ZPY A;  2YS5 A;  1EGX A;  2J0J A;  1ZYI A;  2EMT A;  2VKI A;  3D8E A;  5I2M A;  2L1C A;  1DYN A;  2I5F A;  2AL6 A;  1XKE A;  1U5E A;  1B55 A;  1TQZ A;  3AU5 A;  2UZS A;  4Z2M B;  2MFQ A;  1KZG A;  2CY4 A;  1RJ2 A;  1MI1 A;  2VRW B;  3PVL A;  2RVB B;  2OTX A;  5J3Y A;  5DI9 B;  2K2J A;  3P7Z A;  4ZRJ A;  2Q13 A;  3HW2 B;  4H8S A;  1ZC4 B;  5JLJ B;  5DIF B;  2BCJ A;  3D8D A;  4ZRI A;  1MPH A;  2DX5 A;  2D9Y A;  3DCX A;  1V61 A;  1FGY A;  2K2U A;  3KSY A;  2W2X D;  5J3T A;  1OY2 A;  4K17 A;  2DN6 A;  4GZU A;  4D0N B;  4C0A A;  2DHI A;  1Z87 A;  2HE7 A;  4GOU A;  1MAI A;  2RRF A;  3KRX A;  4ZRK A;  2GJY A;  2COA A;  2DX1 A;  2ROZ B;  2MKR A;  4WVF B;  1XCG A;  4A6K A;  1U5D A;  4MT7 A;  1WJ1 A;  2AEH A;  2GUM A;  1GC7 A;  2MWN B;  4CSQ A;  1FHO A;  4HAU B;  2LG1 A;  1U29 A;  3NW8 A;  3OHM B;  1I2H A;  2LYD A;  2RLO A;  3PEG A;  2NZ8 B;  2YT2 A;  3F0W A;  2G35 A;  3QWM A;  3ODO A;  4HAZ B;  2Z0P A;  4TKN A;  3PSC A;  5CLQ B;  4OSN A;  3LJU X;  5C5B A;  1MKE A;  3SV1 A;  3FVC A;  3TW1 A;  1Y5O A;  3HIE A;  1BWN A;  2ZKM X;  4L6E A;  2PZ1 A;  2V76 A;  5CLL B;  1K5G B;  1MIX A;  4HB4 B;  1U5F A;  1LW3 A;  5C6R A;  4K2P A;  4BBK A;  3NWD A;  1WG7 A;  3V5W A;  3BJI A;  2YSZ A;  3FSS A;  4D6W A;  1SHC A;  2GCL A;  2RNR B;  2LKO A;  2KR0 A;  4QJ3 B;  1DBH A;  1GG3 A;  1FGZ A;  3PVW A;  5LON B;  2DKP A;  1BTK A;  4CHM A;  2M14 A;  3D8F A;  1BTN A;  1PLS A;  4QXA B;  5C16 A;  3GYP A;  2D10 A;  2FJU B;  3U7D A;  1KI1 B;  2NMB A;  5D27 A;  2NBV A;  1X1F A;  1T77 A;  3KY9 A;  4KHA A;  3F5R A;  1ZVR A;  4KVG B;  1X11 A;  1X05 A;  2D4Q A;  3HQC A;  1FHW A;  4KAX B;  5FI1 A;  4DBB A;  4WSF A;  2QKL A;  1MIZ B;  1LB1 A;  3ML4 A;  1P5T A;  3VOQ A;  4DX8 A;  1UNP A;  2R2Y A;  1DDM A;  3BIN A;  5LOP B;  2EC1 A;  2H7E A;  4HDO A;  1PMS A;  2IYB A;  2KCJ A;  5HE0 A;  2K8E A;  3ULC A;  1X86 A;  4DX9 0;  3SNH A;  1QC6 A;  3PG7 A;  4TYZ A;  3GYO A;  2JP2 A;  2W2W A;  4OT1 A;  5HE2 A;  5JHG A;  1QQG A;  2Y8F A;  1UNQ A;  3N7C A;  2CRF A;  5J3Q A;  4K2O A;  4KHB B;  3ODW A;  2YS1 A;  3B77 A;  2KUP A;  2Z14 A;  3X23 A;  2EMS A;  2Z4D A;  1J0W A;  2YF0 A;  2Z0Q A;  3U12 A;  4QJ4 B;  3O96 A;  1J19 A;  5EFX A;  2Z13 A;  2UVM A;  1GC6 A;  2J59 M;  2KUQ A;  2Z59 A;  3U8Z A;  4NSW A;  2D9V A;  3AJ4 A;  3ULB A;  4B6H A;  5JHH A;  1U27 A;  1WGU A;  2COD A;  1DDV A;  4HAT B;  1MK9 B;  1U5G A;  2OQB A;  1NTV A;  1WGQ A;  1NU2 A;  3DXE A;  4PNK A;  2J0K A;  1FHX A;  2N23 A;  3OAN A;  4MY6 A;  1NTY A;  1V5M A;  1ISN A;  3ZVR A;  1ZM0 A;  2RSG A;  2Y7B A;  4GNK B;  3DXC A;  2M38 A;  4EMO A;  2LOZ A;  2D11 A;  3A8Q A;  4Y94 A;  2MDX A;  4F7H A;  5JP4 A;  3A98 B;  2R09 A;  4IAP A;  3FM8 C;  1K5D B;  2DYN A;  3WYF B;  2IFS A;  5D3X A;  1PFJ A; 
#chains in the Genus database with same CATH homology
 4A5K A;  3AU4 A;  3MPX A;  4A6H A;  3TVV A;  2X18 A;  4KHO A;  2UZR A;  3PP2 A;  4HAV B;  2L2I A;  1XD4 A;  3TCA A;  1RRP B;  1EF1 A;  2H7D A;  2CAY A;  4PQ0 A;  5C79 A;  4F7U P;  5KQ4 A;  2RUK B;  5D3V A;  2EJ8 A;  2VSZ A;  1AQC A;  1X1G A;  4WJ7 A;  1Q67 A;  1SGH A;  4DXA B;  1WI1 A;  2N0Y A;  1UPQ A;  1OQN A;  4P7I A;  3QBV B;  3IVF A;  2GCJ A;  2ROV A;  2YRY A;  1M7R A;  1FOE A;  2QKM A;  3FEH A;  1UEF A;  4IFS A;  1P3R A;  3PVU A;  4EJN A;  1MK7 B;  4XWX A;  5GOW B;  2Z0O A;  4HB2 B;  3SO6 A;  2ADZ A;  3KRW A;  4MK0 A;  1V5P A;  4IOY X;  5DHA B;  2DLW A;  5KCV A;  2DYQ A;  2XQN M;  4CYE A;  1I7A A;  4F7G A;  3ODX A;  3SUZ A;  2ELB A;  1ZSQ A;  3PZD A;  4NY0 A;  1EAZ A;  5HE1 A;  3TFM A;  2DHJ A;  2COF A;  3P6A A;  4HHV A;  4YON A;  5HE3 A;  2E2X A;  3KZ1 A;  3QIJ A;  3ZDT A;  2I1J A;  1FB8 A;  3VIA A;  1V88 A;  3SYX A;  1IRS A;  5FI0 A;  1M7E A;  1EVH A;  3UZT A;  1U2B A;  3RCP A;  1ZC3 B;  2I5C A;  2YT0 A;  1UNR A;  2Y8G A;  2DA0 A;  4HB0 B;  1UPR A;  2P8V A;  4CHJ A;  2K00 A;  2D2Q A;  1KZ7 A;  4GPT B;  2DFK A;  3CXB B;  4HAX B;  1P6S A;  1W1D A;  2YVC A;  4YL8 A;  2LOX A;  3MDB C;  5DHF B;  2LUL A;  5DH9 B;  1WJM A;  2ELA A;  1W1H A;  1DRO A;  2COC A;  5D3W A;  1V89 A;  2FJL A;  2DHK A;  2P0H A;  3A8P A;  4GXB A;  3CIK A;  4GMX B;  3HK0 A;  1H4R A;  4GMV A;  2W2X C;  2D9Z A;  1N3H A;  3TO1 A;  1BAK A;  2DTC A;  2RGN B;  4K81 A;  2J0M A;  5D3Y A;  1WVH A;  4HAY B;  4A6F B;  5C5B B;  4A6F A;  1TJ6 A;  1OMW A;  3G9W A;  2HTH B;  1Y19 B;  4HAW B;  3M1I B;  2CY5 A;  4GN1 A;  1AWE A;  1FAO A;  2P0F A;  4HB3 B;  1XX0 A;  1DDW A;  5KQ1 A;  2P0D A;  2YS3 A;  4Z2N A;  1TXD A;  2R0D A;  4EKU A;  2D9X A;  1H10 A;  1NI2 A;  4HDQ A;  1E5W A;  2KGX B;  3NSU A;  2I1K A;  2DKQ A;  1V5U A;  1XOD A;  3T06 A;  3DXD A;  1W1G A;  2D9W A;  2YT1 A;  3WA0 A;  2GS0 A;  1XR0 B;  5L81 A;  2ZPY A;  2YS5 A;  1EGX A;  2J0J A;  2EMT A;  2VKI A;  3D8E A;  2L1C A;  1DYN A;  2I5F A;  2AL6 A;  1XKE A;  1U5E A;  1B55 A;  1TQZ A;  3AU5 A;  2UZS A;  4Z2M B;  2MFQ A;  1KZG A;  2CY4 A;  1RJ2 A;  2VRW B;  3PVL A;  2RVB B;  2OTX A;  5J3Y A;  5DI9 B;  2K2J A;  3P7Z A;  4ZRJ A;  2Q13 A;  3HW2 B;  4H8S A;  1ZC4 B;  5JLJ B;  5DIF B;  2BCJ A;  3D8D A;  4ZRI A;  1MPH A;  2DX5 A;  2D9Y A;  1V61 A;  1FGY A;  2K2U A;  3KSY A;  2W2X D;  5J3T A;  1OY2 A;  4K17 A;  2DN6 A;  4GZU A;  4D0N B;  4C0A A;  2DHI A;  1Z87 A;  2HE7 A;  1MAI A;  3KRX A;  4ZRK A;  2GJY A;  2COA A;  2DX1 A;  2ROZ B;  2MKR A;  4WVF B;  1XCG A;  4A6K A;  1U5D A;  4MT7 A;  1WJ1 A;  2AEH A;  1GC7 A;  2MWN B;  1FHO A;  4HAU B;  2LG1 A;  1U29 A;  1I2H A;  2LYD A;  2RLO A;  3PEG A;  2NZ8 B;  3F0W A;  2G35 A;  3QWM A;  3ODO A;  4HAZ B;  2Z0P A;  4TKN A;  3PSC A;  5CLQ B;  3LJU X;  5C5B A;  1MKE A;  3SV1 A;  3TW1 A;  1Y5O A;  1BWN A;  4L6E A;  2PZ1 A;  2V76 A;  5CLL B;  1K5G B;  1MIX A;  4HB4 B;  1U5F A;  1LW3 A;  5C6R A;  4K2P A;  4BBK A;  1WG7 A;  3V5W A;  3BJI A;  2YSZ A;  3FSS A;  1SHC A;  2GCL A;  2RNR B;  2LKO A;  1DBH A;  1GG3 A;  1FGZ A;  3PVW A;  5LON B;  2DKP A;  1BTK A;  4CHM A;  2M14 A;  3D8F A;  1BTN A;  1PLS A;  5C16 A;  3GYP A;  2D10 A;  3U7D A;  1KI1 B;  2NMB A;  5D27 A;  1X1F A;  3KY9 A;  4KHA A;  3F5R A;  1ZVR A;  4KVG B;  1X11 A;  1X05 A;  2D4Q A;  3HQC A;  1FHW A;  4KAX B;  5FI1 A;  4DBB A;  4WSF A;  2QKL A;  1MIZ B;  1LB1 A;  3ML4 A;  1P5T A;  3VOQ A;  4DX8 A;  1UNP A;  1DDM A;  3BIN A;  5LOP B;  2EC1 A;  2H7E A;  4HDO A;  1PMS A;  2IYB A;  2KCJ A;  5HE0 A;  3ULC A;  1X86 A;  4DX9 0;  3SNH A;  1QC6 A;  3PG7 A;  4TYZ A;  3GYO A;  2JP2 A;  2W2W A;  5JHG A;  5HE2 A;  1QQG A;  2Y8F A;  1UNQ A;  3N7C A;  2CRF A;  5J3Q A;  4K2O A;  4KHB B;  3ODW A;  2YS1 A;  2KUP A;  3X23 A;  2EMS A;  1J0W A;  2YF0 A;  2Z0Q A;  3O96 A;  1J19 A;  5EFX A;  2UVM A;  1GC6 A;  2J59 M;  3U8Z A;  4NSW A;  2D9V A;  3AJ4 A;  3ULB A;  4B6H A;  5JHH A;  1U27 A;  1WGU A;  2COD A;  1DDV A;  4HAT B;  1MK9 B;  1U5G A;  2OQB A;  1NTV A;  1WGQ A;  1NU2 A;  3DXE A;  4PNK A;  2J0K A;  1FHX A;  2N23 A;  3OAN A;  4MY6 A;  1NTY A;  1V5M A;  1ISN A;  3ZVR A;  1ZM0 A;  2RSG A;  2Y7B A;  3DXC A;  2M38 A;  4EMO A;  2LOZ A;  2D11 A;  3A8Q A;  4Y94 A;  2MDX A;  4F7H A;  5JP4 A;  3A98 B;  2R09 A;  4IAP A;  3FM8 C;  1K5D B;  2DYN A;  3WYF B;  2IFS A;  5D3X A;  1PFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...