1V5OA

Solution structure of the ubiquitin-like domain from mouse hypothetical 1700011n24rik protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
b'GSSGSSGMLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDNVGLRTPGRTPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1700011N24Rik protein
publication title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 1700011N24Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v5oA00
2IO2B 3R3MA 1QZEA 1UZXB 1M94A 4XC2A 3V6EB 5TR5A 1Z2MA 2MLBA 3DBLI 3NS8A 5DPTA 2L05A 2XBBC 4IWPA 4BFRA 2ZVNA 4ICVA 2N4FA 2KVRA 4IWQA 4JLCA 2C7NB 1P1AA 2R2QA 4PYZA 2BYEA 2LUEA 2GMIC 4TUUA 3VH3B 2KX0A 2LXCA 4GDLB 3VFKA 2IO1B 2RPQA 1KM7A 2NVUI 3U30A 4WJOA 1S3SG 5IA7A 2RR9A 1GC6A 4B95A 4DDID 2KO3A 2HJ8A 3VXWA 1TBEA 3MHSD 4K1RB 4FADA 2ZNVC 4W9KA 4DXAB 3CMMB 3IVFA 4G0NB 4ASWC 4WJQA 5KHOA 1Y8RC 2J0KA 4BBNF 5DPSA 4HCPB 1ZGUB 2KQSA 2L8JA 4EUTA 1ZKHA 4HCNB 2EMSA 2N9PC 2G4DB 1V80A 3N32A 1SIFA 5DPRA 2K25A 3KUCB 2LRUA 4GDKA 3CF6E 3QAQA 1X1MA 2KJ6A 3VHTC 4GIVA 4BOZB 2MP2A 3R7QA 4NQKE 4GN1A 4XZ4A 4AUQC 3APFA 2EKEC 1U4AA 3EECA 4B6WA 2GOWA 4AOFA 2V1YA 5DPWA 2LGYA 3PZDA 2KWUB 4KZ0A 4MGZE 4FBJB 3NZUA 2UYZB 2I1JA 2K8CA 2NBVB 3VTUA 3ZTDA 4W9EA 4BKGA 2VRRB 3VH4B 3H7SA 2L00B 2DHZA 2CHWA 1NDDA 3VAWA 4IG7B 1RRBA 4KVGB 4WJNA 2B3AA 3KW5B 2WX0A 5LXHA 1UELA 4NJ7A 2DYMA 4BVUC 2CU1A 3CSTA 1ZW7A 2KNBA 4E71A 1ISNA 1NBFC 3EFUA 2Z0EB 5JHBA 3OAWA 4LJPB 4HVBA 1V81A 3KYDD 4EZKA 1L2NA 4W9DA 2DYOA 3V61A 1IP9A 4AJWA 4DWFA 5L95C 1UBIA 1WY8A 4OVVA 4HPMB 2KOXA 4NAWA 1TTNA 3VTVA 4DHJD 2JZ3B 2LJ5A 4I6NB 3VDZA 4HDQA 2MBBB 2C7HA 4TV3A 4IM0A 4RM9A 3WAPA 2C7MB 3HM3A 4HK2A 2BPSA 3DBSA 4HJKA 1V9JA 2ZNVB 3AULA 4W9CA 3APCA 3DVNV 4URKA 1GJZA 1YX6B 3U7DA 3D32A 4EZLA 3ZUNA 3VVWB 2LWPA 2M4NA 1I35A 3AI5A 2BKRB 1LM8B 2NR2A 4TKNA 5D94A 3NHEB 2KX3A 2JRHA 3KVFB 2C5LC 1WIAA 4HLEA 1WRDB 3LDZE 3OLMD 3CSFA 4LDTD 3ZW3A 2IO3B 2N1VA 3TMPB 2J0JA 3PPAA 2LGXA 2WDTB 4II3B 4II2B 1Q0WB 2KXJA 3B08A 4ZDVA 3X23A 4MDKE 4ZRJA 2JUOA 4FJYA 4GB9A 3ZTCA 3APDA 4GXBA 4W9IA 3A9KA 1EO6A 4G50A 4CYEA 1WI0A 1EUVB 2PE6B 4PS7A 2I1KA 3RT3B 2N1WA 3TJPA 2IYDB 4A3OA 5CX3A 3PGEA 1V5TA 2RD0A 3ECIA 1WZ0A 1E8XA 2ZZPB 1D3ZA 2AL6A 3L17A 4IWOA 1E7UA 2NBUA 2IZVB 1AARA 4KV2A 3ZLZA 4LJOB 3TBLD 3W1YA 1WR6E 4IM3A 2JVCA 5C1ZA 1PQSA 2LI5A 2J7QB 5CHFA 4G3XB 2ZJDA 1Z5SB 1WYWB 2BKFA 2IO0B 2JRIB 2KFKB 2REXA 3PRPB 4FHKA 4X57B 3UF8A 3T8MA 2R2OA 2JT4B 3ML9A 3KH0A 3NY5A 1K8RB 3QCAA 5J17A 4J6IA 1RLFA 2ZPYA 3PS6A 5E6NA 1XT9B 1Q1OA 1I42A 1C3TA 2XK5B 2GBNA 4W9FA 2L0TA 2FIDA 1VD2A 2RGFA 4EOYA 2KANA 4BKSD 4IM2A 2JF5A 3WIMA 4W9GA 3M62B 3ZNGC 1WX9A 3M63B 2BYVE 2NPTB 2KMAA 2KJHB 3RUIB 3VUYA 2M8SA 2MBHA 3PLUA 4E74A 2MA9B 2KJRA 3AXCA 3B1LX 3PHXB 3PLVA 4BKTA 3JSVA 5G2NA 5E6OA 1TZ1A 2PPHA 3RCZA 3RZFA 2O2VA 3JW0X 2GBJA 4GDKB 2N9EB 1F9JA 3H7PA 2MSED 3ZKJC 2KC2A 3PSEB 3QIJA 2CR5A 2KN5A 2RSUA 1WM3A 4BKSA 2MP2B 2KK8A 4DDGD 2GBRA 1WMHA 3VUWA 4ANVA 1LFDA 1NI2A 1H4RA 3RYTA 5AZFA 4ICUA 2NCNA 2HE7A 2A4ZA 2KC1A 1XD3B 5G55A 3DQVA 5BO4B 1TGZB 3B0AA 2KD0A 1E8YA 2MWSB 2MRPA 4PS3A 4JQWC 2M17A 2KWCA 3L08A 5LXIB 1WZ3A 2PEAA 3ONSA 1YQBA 2KWVB 2M0XA 3DDCB 2N7EA 3C0RB 2J0MA 1WE7A 3PHWB 4PYUA 2D11A 2O6VD 2KMCA 3K9PB 3DBRI 1SE9A 1WGRA 3IHPC 2IY0B 2MBOA 3DBHI 2ZCCA 4K81A 1P98A 4P7IA 2KTRA 1GC7A 1WXMA 4K7WA 1WXAA 3ML8A 3L16A 4NPNA 1RAXA 3QJZA 2BWFA 1KOTA 4MGYE 3PRMB 1A5RA 4ANXA 4NAWB 2KTFA 5J2RA 1GNUA 1WGHA 1WXVA 2AEHA 5AEKB 3H6NA 1J19A 4DHZB 2YLMA 3NOBA 4F1SA 1Q5WB 3A9JB 1E8ZA 4KSLC 3DVGY 3UIPB 4EEWA 2L3ZA 2O6VA 3ZRCA 2BF8B 1JRUA 3QARA 4M8NA 2JWZA 4N9F4 1FXTB 3PVLA 2UWQA 2KDFB 5CHWA 3VQIA 3JYUA 2CS4A 3AU5A 3DVGX 2FIFA 3IG3A 2ASQA 2HTHA 2YVCA 4F7ZA 1V6EA 4AWJA 1YD8U 1WR1A 4DHJB 1WJNA 2DAFA 1UGMA 2K39A 1WJUA 2MW5A 3TCAA 3ZNHB 2BWES 3NZSA 2K8BA 1VCBA 2IBIB 4MELA 1WGYA 4MM3A 4M8MA 4W9LA 3ZNID 1UBQA 3ZVVA 5HKHA 2V4LA 5DCNA 2LGDA 2D3GA 2JY6A 3PRZA 4GU2A 2M1MA 5J18A 3A9KB 3X0WA 5KHQA 4AJYB 1V86A 3WAMA 4W9HA 1IYFA 5AZHA 2AYOB 2C9WB 2LASA 3Q3FA 4CHKA 2KLCA 4WWOA 4KIKA 3R7RA 1LQBA 2XEWA 1WH3A 4KDLB 2BYFA 2EMTA 3IBEA 3PREA 4LDTB 2KDBA 4KDIC 2KFJA 4M0WB 1E7VA 2G4SA 3A1QA 4FN2A 3EC8A 3N30A 1P3QU 2DYBA 3SU8X 4TQ0A 4WQOB 3V60A 2G3QB 4NNJB 4MJSA 3AU4A 3A33B 4HXDA 1P9DU 4NJ6A 2NS5A 3ZO5B 1YX5B 2DZIA 1CMXB 1V49A 4GOCA 2JXXA 1P0RA 2KLGA 1WFYA 2DZMA 1WF9A 3RULA 3H9DA 4I6LB 1WGDA 5CTRC 2DAJA 2OJRA 3N3KB 4HWIB 4PS8A 4MEMA 4NQLB 3M95A 4B9KA 1OQYA 3SD5A 1H8CA 1SGHA 2OOBB 1YIWA 1V5OA 2PJHA 4GDLA 3WANA 3WALA 2XK5A 3WAOA 3UQBA 4ZRKA 3QWZB 2C60A 2Y5BB 4MGIE 5IAAC 2FUHB 2Z0DB 3UINB 4BBNC 4ANUA 2LVQA 5EDSA 1BT0A 2CHXA 2LRWA 4NY0A 3JSVB 5GMVA 3ZIMA 2K6QA 1OTRB 4A3PA 2NPTA 4IUMB 2O2VB 3V6CB 5AZGA 4K7SA 4CO7A 1T0YA 2ZCBA 3H7PB 4KSKC 2KZRA 2HD5B 3H1UA 4FHJA 3Q3JA 4HDOA 2DZKA 4W9JA 1GUAB 1WMHB 2AWTA 1S1QB 3DPDA 3ZDTA 3L13A 3U8ZA 1MG8A 2GBKA 4WWNA 4MSMB 3PTFC 3L54A 3UQAA 5LLIA 4FLHA 1E5WA 4XX5A 4ZYNA 4WAAA 2QHOA 4KZCA 4WWPA 5CHVC 4EZJA 2MBQA 3VTWA 1WX8A 1GG3A 2AL3A 2D2QA 4F8CB 3DCGA 2D10A 4DHZE 5JH5C 4WJPA 3SHQA 2LVPA 3A4RA 3KUDB 1L7YA 3QHTA 1EF1A 3QK0A 4GMVA 3TL5A 3ALBA 2MBEA 3V62A 2A5UA 4HPLB 4YL8A 3W1SA 3OJ3A 5L83A 4JGHB 2N7DA 2KDEB 2KDIA 3P2BA 2L76A 4OVUA 2KTRB 2FCQA 1OEYA 1IPGA 1EF5A 3HHMA 4EFOA 2Z59B 1HE8A 3S2AA 3RZWC 3HIZA 4AP4C 2DZJA 1RFAA 3OJ4B 2FAZA 3O65B 5D7GA 3SDLC 3K9OB 3BY4B 3GZNI 1E8WA 1YJ1A 2KQ7A 1E90A 3HK0A 3TIXA 2WWZA 2CHZA 1KLVA 3GOEA 2FCNA 2LD9A 4BOSC 1V2YA 1C1YB 1J0GA 2K1FA 4E3CA 1XQQA 1WJ6A 3ZDMC 2FNJB 3KYCD 3ZRFA 1WXSA 2MX2A 2MQJA 2O6VB 3QA8A 3MTNB 4A20A 2JZZA 4MGKE 1WE6A 1OEYJ 4JL9A 4MH0E 3A9JA 3R66C 4DK5A 1WX7A 2WYQA 2N9XA 3A4SC 3RD2A 4ANWA 2K6DB 4FJVB 5JHAA 3EHVA 2W9NA 4MSQB 1WJ4A 3WA0A 1UD7A 2FCSA 2FCMA 1J8CA 1LXDA 5C23A 2KHWB 5D2MB 5D6JB 1KJTA 2DX5B 1G6JA 3L10B 4ZRIA 2G45B 2L7RA 3QX1A 2CKHB 5E6PA 2PE9A 4GSWA 4IW0A 4GGQA 2D07B 3LJ3A 4K7UA 4RMAA 2ZVOA 4TQ1A 4DBGA 1WGGA 2KKCA 3QC8B 2L0FA 2ZEQA 2LVOA 1OGWA 2DENB 3L0WB 3VUXA 5FR6A 4I6PA 4KIKB 2MCNB 3KUZA 3M3JA 2WX1A 3QQ8B 1R4MI 3ZNZB 4FA6A 4EKUA 3BINA 4RM8A 2LXAA 4G11A 4JIOU 4FULA 3IFWB 2ZPNA 3I3TB 3A1QB 3HM6X 3JVZX 4IC7B 2GBMA 4LCDE 3PV1A 2K8HA 2V3SA 1UH6A 3T9LA 3MJWA 2JPHA 4MJSB 2BGFA 2LZ6A 3DOWA 3UGBB 5JZEB 3UIOB 3DVNU 3PT2B 4FJZA 3W1SC 1WM2A 2KFKA 2NBWB 2IY1B 3ENEA 1R4NI
chains in the Genus database with same CATH superfamily
3V6EB 2L32A 1Z2MA 2W82A 3NS8A 4BFRA 2NTSA 2N4FA 2KVRA 4PYZA 3VH3B 4ANWA 2LUEA 1KM7A 2LJIA 1MPEA 2RR9A 2KO3A 2WXLA 3MHSD 4S0RA 4W9KA 1PYWD 2MH7A 3IVFA 4WJQA 5KHOA 1Y8RC 2J0KA 2KQSA 2L8JA 4EUTA 1ZKHA 3IXSA 4JX1C 4HCNB 1C9FA 2N9PC 2G4DB 1V80A 3N32A 3TSSA 2K25A 3KUCB 4GDKA 2D3BA 1X1MA 3VHTC 2FUG1 4NQKE 4XZ4A 2VH1A 3EECA 2GOWA 2BB5A 2KWUB 4OW0A 1KRHA 1IUEA 3MC0B 1UWMA 3VH4B 1NDDA 1IBXA 4KVGB 5G5GA 3KW5B 4REZA 2WX0A 1TY0A 2HDEA 2CU1A 1ZW7A 2KNBA 3AB5A 1EWCA 4LNIA 5HG2A 1R4NB 1V81A 1WGKA 4HVBA 1L2NA 1IP9A 1UBIA 4OVVA 2WDQB 1L0VB 1I7HA 2JZ3B 4I6NB 1CK1A 2WXHA 4IM0A 4RM9A 1V8CA 4HJKA 2ZNVB 1IGCA 4DXGA 3SR6A 4HROA 3TEWA 2LWPA 2M4NA 1LM8B 2I2YA 1TJEA 3NHEB 5IN7A 2C5LC 1V1PB 3DHGC 3LDZE 3OLMD 3TMPB 2J0JA 4II2B 1SE2A 3X23A 3ZTCA 1ACCA 1QT9A 3APDA 4W9IA 1EO6A 3J9CA 4FXCA 1EUVB 2PE6B 4PS7A 2N1WA 2IYDB 5CX3A 2BB6A 2ZZPB 4PK1A 1EU4A 4KV2A 3TBLD 2QDFA 2QCZA 4MT5A 2JVCA 5AUKA 4RGMA 4G3XB 1Z5SB 1WYWB 4X57B 2KFKB 4OZBA 2M56B 3T8MA 1ET6A 3KH0A 3NY5A 3QCAA 2ZW0A 1FNUA 4BZAA 4LNKA 1C3TA 2N7JA 2XK5B 3R8BA 4KKJA 2L0TA 2FIDA 1VD2A 1T5XD 1T6BX 3ZNGC 2BYVE 3PZ8A 2MA9B 3B1LX 1SIJA 3PZ7A 3FAHA 3Q8CA 2INNE 3I5JC 4BKTA 1XCQL 2PPHA 2O2VA 2K5PA 2GBJA 2KACA 3H7PA 4WIPA 3ZKJC 3PSEB 1TY2A 3ZXVA 1WM3A 2MP2B 3NZ3A 1WMHA 3KWVA 3VUWA 1T0QC 1FNWA 3CIRB 2RPVA 5AZFA 2NCNA 2HE7A 1EU3A 1ENFA 3DQVA 3B0AA 3IAM1 4NJCA 2WS3B 5LXIB 2PEAA 1L4DB 2GLSA 2KWVB 3P42A 2N7EA 3C0RB 3PHWB 1ZP0B 4PYUA 3K9PB 3Q3NC 1SE9A 1WGRA 2IY0B 3DBHI 1GC7A 3MP9A 4RCOA 1WXAA 4JWUC 3L16A 1RAXA 2BWFA 1GOZA 1FCCC 3ZJVA 2QEJC 5J2RA 1PUTA 1BXTA 1WGHA 2WDRB 5AEKB 2KN4A 3WCQA 2YEPB 2YLMA 3DVGY 4YTNB 5I4DA 4KGSA 1FXTB 3PVLA 2UWQA 1YJIA 2VZKB 3GE3C 3P63A 1DOIA 2FIFA 1YJJA 2ASQA 2HTHA 1YD8U 1UGMA 2K3UA 1WJUA 1D6EC 1XF5L 4MM3A 4M8MA 3ZVVA 1DGJA 2JY6A 3PRZA 1RM6C 4LK0M 1IYFA 5AZHA 4WWOA 1LQBA 1WH3A 1F1HA 2D3CA 4RGNA 2BYFA 4KDIC 4JE3B 1HTOA 2WXQA 1BUIC 3EC8A 1P3QU 3V60A 3DBHB 3KLSX 1MJDA 2QC8A 4NJ6A 1P9DU 3EUB2 1CMXB 3IT4B 3NVVA 2KLGA 1WFYA 5CTRC 4LTUA 5EE3A 4NQLB 3M95A 3WAOA 3UQBA 4D2KA 3QWZB 2C60A 3UINB 2Z0DB 2LVQA 1BT0A 2K6QA 3U2SC 3AV8A 4P6VF 2Y3AA 2ZCBA 5MPOA 1QOBA 3EA6A 4HDOA 1SJHD 1S1QB 3ZDTA 1R7SA 4WWNA 2AQ2B 3L54A 1E5WA 1C76A 3BIID 2QHOA 5CHVC 1JWSD 2MBQA 2V4IB 1WX8A 3L4PA 2KWDA 3DCGA 4DHZE 1HZ6A 4DXFA 4YL8A 3P2BA 2L76A 4YSZB 2FCQA 3SEBA 4AQ7A 3HHMA 2FBWB 1JCKB 1XLOA 3RZWC 1RFAA 3GZNI 3AE4B 1JROA 3PO0A 1J7AA 1B9RA 3GOEA 4GLSC 1J0GA 1C1YB 4YSYB 1XQQA 2N9KA 1WXSA 1MFWA 2JZZA 1WE6A 2JU6X 3R66C 4DK5A 1UF0A 3RD2A 1Y56A 2W9NA 4MSQB 2BVCA 3WA0A 1UD7A 2KHWB 5D6JB 2DX5B 4ZRIA 1J7CA 3AEAB 4MACA 2D5GA 1FO4A 2CKHB 5E6PA 2PE9A 1P7EA 2SAKA 1F2RC 3B2FA 4RMAA 2ZVOA 4TQ1A 4DBGA 1WGGA 2M19A 2ZEQA 2LFIA 2LVOA 1K51A 1NI3A 4RGTA 4FA6A 4R3DA 1MHXA 3BINA 4RM8A 2LXAA 4JIOU 1ESFA 2UU7A 3I3TB 3A1QB 3JVZX 2BW2A 1DOYA 1TYGB 2V3PA 4KGTA 3R2IA 4WURA 3V05A 5JZEB 3UGBB 3UIOB 3DVNU 3PT2B 2KFKA 2BS2B 3GZNB 2IO2B 3R3MA 1QZEA 4XC2A 5TR5A 2MLBA 2WQYB 3AEDB 2ZVNA 4ICVA 4JLCA 2KX0A 4GDLB 3UI3A 1ZDVA 1S3SG 5IA7A 4XE0A 4B95A 1L5PA 5D3IB 4FADA 2ZNVC 3CMMB 4HCPB 1ZGUB 2WU2B 2KMMA 4JPSA 2CJOA 2GI9A 3N1YC 4GIVA 4XDCA 1XEEA 2MP2A 1NVID 2GB1A 1JWUD 1FM0D 3APFA 3MHZA 4AUQC 1U4AA 4B6WA 3AE1B 2LGYA 4MGZE 4FBJB 2NBVB 3ZTDA 4W9EA 2VRRB 3H7SA 2L00B 2LHEA 2AQ3B 1HQRD 2XN9C 1UELA 4NJ7A 1NBFC 3EFUA 2Z0EB 2Q5WD 3OAWA 4LJPB 2VZKD 4K3CA 3GE8C 3KYDD 4YSXB 4W9DA 4AJWA 4DWFA 2PLPA 3VTVA 1JWBD 1KF6B 4TV3A 3WAPA 3HM3A 4HK2A 3DBSA 1V9JA 3RN9C 1FXAA 1L0YB 2K9XA 3U7DA 3AI5A 2NR2A 4L1BA 2KX3A 1KTKA 1WIAA 1TZOA 3CSFA 2KT7A 2IO3B 4ZDVA 4ZRJA 1N61A 2JZPA 3AE5B 3RNAC 4G50A 2IPKD 4CYEA 3Q69A 3U4EG 3ECIA 2RD0A 1WZ0A 1E8XA 1E7UA 2NBUA 1AARA 1SXTA 3W1YA 1WR6E 1FRRA 2LI5A 5CHFA 2ZJDA 3PRPB 2JRIB 1KH0A 2R2OA 1TIFA 2LUMA 5E6NA 3TEZA 3VR8B 1WWTA 2GBNA 2BBCA 2BS3B 2QILA 1BMLC 2RGFA 3AECB 2KANA 1K53A 4PT5A 2JF5A 3WIMA 1AWDA 3M63B 2KMAA 1J7BA 3RMKC 3AXCA 3AEBB 1YN3A 3FC4A 4WQMA 3PLVA 1TZ1A 3BVZA 4N58A 2KC2A 1I4HA 3I57A 2RSUA 4DDGD 4KX6B 2QMTA 2GBRA 4NZLB 3HUIA 4ANVA 4KGRA 1LFDA 1NI2A 2PVOD 4XYCA 4YTPB 1HTQA 2KC1A 1XD3B 1VZ8A 5BO4B 2KD0A 1E8YA 3TUOA 2MWSB 2MRPA 2JYTA 4JQWC 4RGOS 3L08A 3DDCB 2J0MA 1WE7A 1OQRA 2KMCA 5IOIA 1JWMD 3IHPC 1D5ZC 4K7WA 4MGYE 3N1XC 3NJTA 4NAWB 1I4XA 1QILA 1WXVA 2AEHA 4ZYSA 3H6NA 2BTEA 3RI7C 1JQ4A 1HXYD 1YQ3B 3LB8C 1Q5WB 4KSLC 1ZXHA 2L3ZA 2BF8B 1VZ6A 3BYYB 2KDFB 2TSSA 2DLBA 3JYUA 2CS4A 2K0PA 3DVGX 3Q14C 1N5WA 4DHJB 2DAFA 2K39A 2MW5A 4HPPA 2BWES 3NZSA 3TEYA 4MELA 4W9LA 1UBQA 2D3GA 4GU2A 4H2AA 5J18A 3A9KB 1SBBB 4AJYB 2CJNA 2AYOB 2C9WB 4CHKA 2LHDA 2BQQA 1FFVA 4N6EB 2XEWA 2ACZB 4M01A 2EMTA 3IBEA 4LDTB 4WH4A 1E7VA 3A1QA 2GRIA 4FN2A 3SU8X 4TQ0A 1M4VA 4WQOB 5BYQA 4RH6A 2G3QB 3AU4A 1FD6A 4ZRQA 4HXDA 2NS5A 2AX5A 1P0RA 1WF9A 1TS5A 2INDC 2OJRA 4DQOC 1ZXIA 3DWMA 4MEMA 3VRAB 1OQYA 1SGHA 1YIWA 2V0GA 1V5OA 4GDLA 3P4PB 1N62A 2WXKA 4RNAA 4MGIE 4BBNC 3AE3B 5GMVA 3P4RB 4K3BA 3V6CB 2KAJA 4L23A 3GP7A 2KZRA 4KSKC 2PKOA 2DZKA 1HZ5A 2AQ1B 4C00A 1GUAB 2X8XX 3C19A 3U8ZA 4MSMB 3PTFC 5LLIA 4FLHA 4F8CB 5JH5C 3GB1A 2QSDA 1KLGD 1L7YA 2PTLA 3TL5A 2MBEA 2MJ3A 3V62A 2A5UA 1AN8A 4QAYA 4ZHPA 4OVUA 5BYSA 1EF5A 3HIZA 2DZJA 2FAZA 3HVDA 4OZAA 3W2DA 3AE7B 1E90A 1D5MC 3HK0A 1B1ZA 2NMQA 2LD9A 3V3XA 4E3CA 3AE6B 2WXIA 1OFFA 3KYCD 1JMLA 2O6VB 3QA8A 1IGDA 2HTME 3SFDB 4FJVB 3EHVA 2MJEA 2FCMA 1LXDA 4NAMA 5C23A 4WAFA 3L10B 5IO9A 2WP9B 2L7RA 4GGQA 5IKCM 3AM9A 3Q6BA 2L1AA 3QC8B 1V1OA 2L0FA 1C4CA 3VUXA 3N1ZC 4KIKB 4TMAB 4HKZE 3KUZA 3QQ8B 3IT6B 2ZPNA 1NEKB 2JWUA 2K8HA 5FKAC 1I4PA 1UH6A 3T9LA 3T3NA 2JPHA 1N5XA 3HRDD 4MJSB 1TT5B 3AEEB 1NENB 4FJZA 2W3SA 3ENEA 3P4QB 1E9MA 1PGXA 3AEGB 3AE2B 2L05A 2I38A 2XBBC 4IWPA 3ZQ4A 1C79A 4IWQA 2C7NB 1P1AA 4F7ZA 1H8CA 2BYEA 4TUUA 2GMIC 4WJOA 4O1NA 3AE9B 2CU3A 4DDID 2HJ8A 3VXWA 1TBEA 1UNSA 4K1RB 2RDGA 4G0NB 2ONQA 4ASWC 1KFYB 2SEBD 1SSNA 1JALA 1RWSA 3TEXA 1SIFA 1UGJA 4OZCA 3CF6E 1SE3A 4ZHOA 3ZGZA 2KJ6A 2WXOA 3R7QA 4GN1A 3EFCA 2V1YA 5DPWA 3NZUA 1WRIA 2I1JA 1EM7A 4B0MA 4BKGA 4AS1A 5T8IA 1FIQA 4IG7B 4ACFA 2XNAC 2WXRA 4WJNA 1L6VA 4US9A 3CSTA 3SFEB 4E71A 5JHBA 2V3NA 4EZKA 1CQVA 2DYOA 3NUHB 3V61A 1WY8A 2WDVB 4HPMB 4NAWA 1TTNA 4DHJD 2LJ5A 3Q2AC 4S17A 2FE8A 4HDQA 3VDZA 2C7HA 2C7MB 1SE4A 2OEDA 3E9SA 3C8YA 3APCA 3DVNV 4URKA 5BMGA 3MC8A 2JSVX 1STEA 2R61A 3U52E 1I35A 2ZW1A 3AH7A 2MEKA 2G9HD 4IDIA 5TSSA 1T0SC 3RNBC 3BVMA 4XWTA 4LDTD 1Q10A 2N1VA 3PPAA 2WDTB 2KXJA 1NYQA 2PIAA 3B08A 2JUOA 4GB9A 4GXBA 1F52A 3A9KA 1JWAD 2WNMA 3P4SB 4A3OA 3PGEA 1V5TA 1ZPSA 2OJWA 1TS4A 4N59A 3Q3OC 3O13A 4C7ZA 5D3DA 1E6EB 2IJ0A 1CZPA 4P1CC 4LJOB 4IM3A 4TSSA 1PQSA 1QOGA 2REXA 1GJZA 4FHKA 2JT4B 1XXGA 2WGSA 1K8RB 1LGRA 1RLFA 2ZPYA 2IGGA 4XGAB 1C77A 4EOYA 4BKSD 4IM2A 2PVGC 4W9GA 1QOAA 2H89B 3RUIB 3VUYA 2KJHB 1FMAD 2MBHA 3PLUA 2DBYA 5G2NA 5E6OA 5C3JB 3OWEB 5G5HA 1F9JA 2MSED 3QIJA 2WXGA 2KN5A 4BKSA 2KK8A 1EWYC 2M0AA 1MG4A 5GXGB 4A55A 2KVZA 2M17A 2KWCA 3ONSA 1YQBA 5EE9A 2M0XA 4KKIA 3BK2A 3DHIC 1OQQA 2O6VD 3Q8AA 4P7IA 2ZCCA 3GS2A 1P98A 4C56C 1WXMA 3MFGA 2V9HA 3ML8A 4NPNA 3QJZA 1KOTA 4JWSC 1I4GA 2NTTA 5FR3A 1TKYA 3ZXRA 4DHZB 1SJED 4F1SA 1E8ZA 2IGHA 3Q3MC 2O6VA 2ON8A 3QARA 4M8NA 2JWZA 4ITKA 2WXPA 3VQIA 3AU5A 3IG3A 1XO3A 1V6EA 4AWJA 5HFYA 4EZJA 1SEBD 3ZNHB 1VCBA 4J3OD 3VRBB 3ZNID 4RFBA 2V4LA 5DCNA 2LGDA 1C4AA 1D5XC 3X0WA 2EELA 5KHQA 3WAMA 4W9HA 3Q3FA 4M02A 2KLCA 4KIKA 3ABVB 3I9V1 1GPXA 3MJ5A 3PREA 2KDBA 4M0WB 2G4SA 2H88B 1DYQA 1QF6A 1WSPA 3N30A 2DYBA 1L4ZB 4MJSA 3A33B 4HJGE 2DZIA 1GB4A 2E3TA 4GOCA 1V49A 2JXXA 1TS2A 1XLQA 2DAJA 3N3KB 1N6ZA 4HWIB 2JQRB 4B9KA 3NVYA 3SD5A 1PGAA 2PJHA 2WHIA 3WALA 1KLUD 1I4RA 1VJKA 2YEPF 2Y5BB 1E7PB 3I63C 4ANUA 3JSVB 4OVZA 2NPTA 1L6UA 5AZGA 4K7SA 4HEA1 3Q3JA 4W9JA 3N9YC 3DPDA 5BYRA 3L13A 1WXQA 3AMZA 1MG8A 1XLPA 2GBKA 4C4VB 3UQAA 4CQNA 4ZYNA 3MC9A 4WWPA 2D3AA 3VTWA 1GG3A 1K50A 2AL3A 2D2QA 3BVGA 4WJPA 2LVPA 3A4RA 3KUDB 2WLBA 3QK0A 4GMVA 5EE1A 2MJDA 2WXNA 3Q8BA 3W1SA 5L83A 3OJ3A 1PFDA 1VLBA 1QKZA 5JXVA 2KDIA 2KTRB 2Z59B 1HEZE 3S2AA 1D4BA 4AP4C 2RDBC 3OJ4B 5D7GA 3K9OB 3BY4B 1NYRA 2KQ7A 3AEFB 2K22A 3DWGC 3TIXA 1KLVA 2BS4B 1N60A 4BOSC 4XWWA 1V2YA 2K1FA 3ZDMC 4LLGM 3ZRFA 2MX2A 2J4XA 1ET9A 4MGKE 1OEYJ 4YT0B 3A9JA 4XDDA 1WX7A 2WYQA 3A4SC 2KDMA 5JHAA 1ROEA 1YMHE 2PW9A 1G6JA 1FRDA 2G45B 4ARIA 1A70A 4GSWA 4IW0A 3ETRA 4K7UA 1RYJA 3URYA 1OGWA 2DENB 3L0WB 5FR6A 4I6PA 2MCNB 3M3JA 3NS1A 1R4MI 4EKUA 4YWGG 3IFWB 3HM6X 4IC7B 1QLBB 4LCDE 2BYTA 1YN5A 4IKGA 3MJWA 4RF0A 2BGFA 2LZ6A 1DOXA 3W1SC 1YX6B 1UZXB 1M94A 3KWLA 5DPTA 2RDHA 3DBLI 4A8XC 1C4PA 2R2QA 5EDSA 2LXCA 3VFKA 2IO1B 2RPQA 2NVUI 3U30A 2WU5B 1GC6A 4WWMA 2DWQA 4ZOHC 4DXAB 2IGDA 3RFZB 4BBNF 5DPSA 2EMSA 1F77A 2DNFA 4A9AA 5DPRA 2LRUA 3QAQA 4BOZB 5AUIA 4EE2A 2EKEC 2Z8LA 4AOFA 3RNFC 3PZDA 3NG0A 5E6JA 4KZ0A 1R4MB 2UYZB 2K8CA 3VTUA 2J42A 1GAQB 2DHZA 2CHWA 3VAWA 2X38A 1RRBA 2B3AA 5LXHA 2DYMA 4BVUC 1ISNA 5BMIA 3BYTB 3IAS1 5L95C 2ICIA 2J52A 4RF1A 2KOXA 5HHDG 2QIEB 3DBLB 1F0ZA 5HI1A 1AW7A 2MBBB 2EKIA 3FILB 2BPSA 2IDYA 3NRZA 4LNFA 4C7YA 3AULA 4W9CA 5H92C 3D32A 4EZLA 3ZUNA 3VVWB 2BKRB 4TKNA 5D94A 1I4QA 2JRHA 3KVFB 4A6QA 4HLEA 1WRDB 3BZDB 3ZW3A 2LGXA 4II3B 1Q0WB 1FFUA 4MDKE 3RPFC 1FPYA 2Y5PA 2JYEA 4FJYA 2B76B 2WXJA 2N0SB 2LGSA 3KQ4A 3RNGC 1WI0A 1C78A 2I1KA 3RT3B 3TJPA 2N9LA 2INCC 1D3ZA 2AL6A 3L17A 3AN1A 4IWOA 2IZVB 4BAXA 4M0WA 1JRPA 5IP4D 3ZLZA 1TS3A 2L52A 5C1ZA 2J7QB 2BKFA 2HJ1A 2IO0B 4UDUC 3UF8A 3ML9A 5J17A 4J6IA 3PS6A 2LEKA 1XT9B 1Q1OA 1TKEA 1I42A 3BWUD 1AYFA 4W9FA 2KQ4X 3M62B 1MVKA 1WX9A 2NPTB 1UUPA 2M8SA 4E74A 2KJRA 3PHXB 4YTMB 3HVZA 3NVWA 2E6XA 5FK9C 3JSVA 3T3OA 3RCZA 3RZFA 4P1BC 3JW0X 1CJEA 4GDKB 2N9EB 1MHHE 4Q2JA 3Q8EA 2CR5A 5EE0A 4P16A 2KYWA 1N63A 4LNOA 1H4RA 3RYTA 1GB1A 4C4VA 4ICUA 2A4ZA 5G55A 1TGZB 4ARCA 4PS3A 1ZOYB 1WZ3A 2J53A 1IBXB 2D11A 3DBRI 5C2TB 4K81A 2MBOA 2KTRA 3Q8FA 3W5VB 4YXDB 2JXTA 2LMCA 3PRMB 1A5RA 4ANXA 1XLNA 2KTFA 1MI0A 2VH2A 1GNUA 1WYGA 2Y5CA 5BMHA 1J19A 4ZRPA 3NOBA 3A9JB 3UIPB 1K52A 1PDXA 4US8A 4EEWA 3ZRCA 1V97A 2QJLA 1JRUA 3ZYYX 3LXFA 4N9F4 5CHWA 3CWIA 2OHFA 2YVCA 1WR1A 1WJNA 2PMVA 3TCAA 2K8BA 2IBIB 1WGYA 1V1PA 5HKHA 2M1MA 4IOIE 1TKGA 1V86A 2LASA 4HRSA 4HKQA 1YQ4B 3R7RA 4KDLB 2KFJA 1FXIA 1L0XB 3DBRB 4NNJB 1QOFA 3ZO5B 1ZDXA 1YX5B 2L83A 1ZUD2 2WXMA 2DZMA 1VDVA 3RULA 3H9DA 4I6LB 1WGDA 4PS8A 4OHJA 1E0ZA 1YNTE 2OOBB 2W54A 3W9CB 1VRAB 2LGIA 1ZE3D 3WANA 2INPE 1VR9A 3ZJTA 2RMMA 2XK5A 4ZRKA 1XCTL 5IAAC 2FUHB 3N20C 1FEHA 1JW9D 2CHXA 2LRWA 1FNVA 4NY0A 3ZIMA 4B0EA 1YN4A 1OTRB 4A3PA 4IUMB 2O2VB 2W55A 3B2GA 4CO7A 1T0YA 1SB3C 2WXFA 3R2TA 3H7PB 2HD5B 2MHJA 3H1UA 4FHJA 4C80A 3AE8B 1E10A 1WMHB 2AWTA 5LNK1 1QQRA 4XX5A 4WAAA 4KZCA 1RFKA 3U7ZA 3P1MA 3DHHC 2D10A 1P7FA 3SHQA 3VR9B 1YOVB 4USAA 3NVZA 4MH8A 3QHTA 1EF1A 3W5UB 3EGRA 3ALBA 4HPLB 4JGHB 2N7DA 2KDEB 1OEYA 1IPGA 1UWXA 2JX5A 4EFOA 1HE8A 4LNNA 1T3QA 3SDLC 3O65B 3FKYA 1E8WA 1YJ1A 2WWZA 2CHZA 3FILA 2FCNA 2BT6A 1SF0A 3BK1A 1WJ6A 2FNJB 2MQJA 3MTNB 4A20A 1T0RC 3ZJUA 4JL9A 3B9JA 4MH0E 2N9XA 2K6DB 1WJ4A 2FCSA 1J8CA 5D2MB 1KJTA 3RNEC 3QX1A 4L2YA 4A90A 4MM3B 1FCLA 1F2RI 1PGBA 2W3RA 2D07B 3LJ3A 2KKCA 3OG5A 1LO5D 3H8HA 2WX1A 3ZNZB 1HA5A 3E56A 4G11A 2G1EA 4FULA 5H8YE 1VZ7A 2GBMA 3PV1A 2V3SA 3LYYA 3DOWA 1WM2A 2NBWB 4M00A 3RNCC 2IY1B 1R4NI
chains in the Genus database with same CATH topology
2IO2B 3R3MA 1QZEA 1UZXB 1M94A 4XC2A 3V6EB 5TR5A 1Z2MA 2MLBA 3DBLI 3NS8A 5DPTA 2L05A 2XBBC 4IWPA 4BFRA 2ZVNA 4ICVA 2N4FA 2KVRA 4IWQA 4JLCA 2C7NB 1P1AA 2R2QA 4PYZA 2BYEA 2LUEA 2GMIC 4TUUA 3VH3B 2KX0A 2LXCA 4GDLB 3VFKA 2IO1B 2RPQA 1KM7A 2NVUI 3U30A 4WJOA 1S3SG 5IA7A 2RR9A 1GC6A 4B95A 4DDID 2KO3A 2HJ8A 3VXWA 1TBEA 3MHSD 4K1RB 4FADA 2ZNVC 4W9KA 4DXAB 3CMMB 3IVFA 4G0NB 4ASWC 4WJQA 5KHOA 1Y8RC 2J0KA 4BBNF 5DPSA 4HCPB 1ZGUB 2KQSA 2L8JA 4EUTA 1ZKHA 4HCNB 2EMSA 2N9PC 2G4DB 1V80A 3N32A 1SIFA 5DPRA 2K25A 3KUCB 2LRUA 4GDKA 3CF6E 3QAQA 1X1MA 2KJ6A 3VHTC 4GIVA 4BOZB 2MP2A 3R7QA 4NQKE 4GN1A 4XZ4A 4AUQC 3APFA 2EKEC 1U4AA 3EECA 4B6WA 2GOWA 4AOFA 2V1YA 5DPWA 2LGYA 3PZDA 2KWUB 4KZ0A 4MGZE 4FBJB 3NZUA 2UYZB 2I1JA 2K8CA 2NBVB 3VTUA 3ZTDA 4W9EA 4BKGA 2VRRB 3VH4B 3H7SA 2L00B 2DHZA 2CHWA 1NDDA 3VAWA 4IG7B 1RRBA 4KVGB 4WJNA 2B3AA 3KW5B 2WX0A 5LXHA 1UELA 4NJ7A 2DYMA 4BVUC 2CU1A 3CSTA 1ZW7A 2KNBA 4E71A 1ISNA 1NBFC 3EFUA 2Z0EB 5JHBA 3OAWA 4LJPB 4HVBA 1V81A 3KYDD 4EZKA 1L2NA 4W9DA 2DYOA 3V61A 1IP9A 4AJWA 4DWFA 5L95C 1UBIA 1WY8A 4OVVA 4HPMB 2KOXA 4NAWA 1TTNA 3VTVA 4DHJD 2JZ3B 2LJ5A 4I6NB 3VDZA 4HDQA 2MBBB 2C7HA 4TV3A 4IM0A 4RM9A 3WAPA 2C7MB 3HM3A 4HK2A 2BPSA 3DBSA 4HJKA 1V9JA 2ZNVB 3AULA 4W9CA 3APCA 3DVNV 4URKA 1GJZA 1YX6B 3U7DA 3D32A 4EZLA 3ZUNA 3VVWB 2LWPA 2M4NA 1I35A 3AI5A 2BKRB 1LM8B 2NR2A 4TKNA 5D94A 3NHEB 2KX3A 2JRHA 3KVFB 2C5LC 1WIAA 4HLEA 1WRDB 3LDZE 3OLMD 3CSFA 4LDTD 3ZW3A 2IO3B 2N1VA 3TMPB 2J0JA 3PPAA 2LGXA 2WDTB 4II3B 4II2B 1Q0WB 2KXJA 3B08A 4ZDVA 3X23A 4MDKE 4ZRJA 2JUOA 4FJYA 4GB9A 3ZTCA 3APDA 4GXBA 4W9IA 3A9KA 1EO6A 4G50A 4CYEA 1WI0A 1EUVB 2PE6B 4PS7A 2I1KA 3RT3B 2N1WA 3TJPA 2IYDB 4A3OA 5CX3A 3PGEA 1V5TA 2RD0A 3ECIA 1WZ0A 1E8XA 2ZZPB 1D3ZA 2AL6A 3L17A 4IWOA 1E7UA 2NBUA 2IZVB 1AARA 4KV2A 3ZLZA 4LJOB 3TBLD 3W1YA 1WR6E 4IM3A 2JVCA 5C1ZA 1PQSA 2LI5A 2J7QB 5CHFA 4G3XB 2ZJDA 1Z5SB 1WYWB 2BKFA 2IO0B 2JRIB 2KFKB 2REXA 3PRPB 4FHKA 4X57B 3UF8A 3T8MA 2R2OA 2JT4B 3ML9A 3KH0A 3NY5A 1K8RB 3QCAA 5J17A 4J6IA 1RLFA 2ZPYA 3PS6A 5E6NA 1XT9B 1Q1OA 1I42A 1C3TA 2XK5B 2GBNA 4W9FA 2L0TA 2FIDA 1VD2A 2RGFA 4EOYA 2KANA 4BKSD 4IM2A 2JF5A 3WIMA 4W9GA 3M62B 3ZNGC 1WX9A 3M63B 2BYVE 2NPTB 2KMAA 2KJHB 3RUIB 3VUYA 2M8SA 2MBHA 3PLUA 4E74A 2MA9B 2KJRA 3AXCA 3B1LX 3PHXB 3PLVA 4BKTA 3JSVA 5G2NA 5E6OA 1TZ1A 2PPHA 3RCZA 3RZFA 2O2VA 3JW0X 2GBJA 4GDKB 2N9EB 1F9JA 3H7PA 2MSED 3ZKJC 2KC2A 3PSEB 3QIJA 2CR5A 2KN5A 2RSUA 1WM3A 4BKSA 2MP2B 2KK8A 4DDGD 2GBRA 1WMHA 3VUWA 4ANVA 1LFDA 1NI2A 1H4RA 3RYTA 5AZFA 4ICUA 2NCNA 2HE7A 2A4ZA 2KC1A 1XD3B 5G55A 3DQVA 5BO4B 1TGZB 3B0AA 2KD0A 1E8YA 2MWSB 2MRPA 4PS3A 4JQWC 2M17A 2KWCA 3L08A 5LXIB 1WZ3A 2PEAA 3ONSA 1YQBA 2KWVB 2M0XA 3DDCB 2N7EA 3C0RB 2J0MA 1WE7A 3PHWB 4PYUA 2D11A 2O6VD 2KMCA 3K9PB 3DBRI 1SE9A 1WGRA 3IHPC 2IY0B 2MBOA 3DBHI 2ZCCA 4K81A 1P98A 4P7IA 2KTRA 1GC7A 1WXMA 4K7WA 1WXAA 3ML8A 3L16A 4NPNA 1RAXA 3QJZA 2BWFA 1KOTA 4MGYE 3PRMB 1A5RA 4ANXA 4NAWB 2KTFA 5J2RA 1GNUA 1WGHA 1WXVA 2AEHA 5AEKB 3H6NA 1J19A 4DHZB 2YLMA 3NOBA 4F1SA 1Q5WB 3A9JB 1E8ZA 4KSLC 3DVGY 3UIPB 4EEWA 2L3ZA 2O6VA 3ZRCA 2BF8B 1JRUA 3QARA 4M8NA 2JWZA 4N9F4 1FXTB 3PVLA 2UWQA 2KDFB 5CHWA 3VQIA 3JYUA 2CS4A 3AU5A 3DVGX 2FIFA 3IG3A 2ASQA 2HTHA 2YVCA 4F7ZA 1V6EA 4AWJA 1YD8U 1WR1A 4DHJB 1WJNA 2DAFA 1UGMA 2K39A 1WJUA 2MW5A 3TCAA 3ZNHB 2BWES 3NZSA 2K8BA 1VCBA 2IBIB 4MELA 1WGYA 4MM3A 4M8MA 4W9LA 3ZNID 1UBQA 3ZVVA 5HKHA 2V4LA 5DCNA 2LGDA 2D3GA 2JY6A 3PRZA 4GU2A 2M1MA 5J18A 3A9KB 3X0WA 5KHQA 4AJYB 1V86A 3WAMA 4W9HA 1IYFA 5AZHA 2AYOB 2C9WB 2LASA 3Q3FA 4CHKA 2KLCA 4WWOA 4KIKA 3R7RA 1LQBA 2XEWA 1WH3A 4KDLB 2BYFA 2EMTA 3IBEA 3PREA 4LDTB 2KDBA 4KDIC 2KFJA 4M0WB 1E7VA 2G4SA 3A1QA 4FN2A 3EC8A 3N30A 1P3QU 2DYBA 3SU8X 4TQ0A 4WQOB 3V60A 2G3QB 4NNJB 4MJSA 3AU4A 3A33B 4HXDA 1P9DU 4NJ6A 2NS5A 3ZO5B 1YX5B 2DZIA 1CMXB 1V49A 4GOCA 2JXXA 1P0RA 2KLGA 1WFYA 2DZMA 1WF9A 3RULA 3H9DA 4I6LB 1WGDA 5CTRC 2DAJA 2OJRA 3N3KB 4HWIB 4PS8A 4MEMA 4NQLB 3M95A 4B9KA 1OQYA 3SD5A 1H8CA 1SGHA 2OOBB 1YIWA 1V5OA 2PJHA 4GDLA 3WANA 3WALA 2XK5A 3WAOA 3UQBA 4ZRKA 3QWZB 2C60A 2Y5BB 4MGIE 5IAAC 2FUHB 2Z0DB 3UINB 4BBNC 4ANUA 2LVQA 5EDSA 1BT0A 2CHXA 2LRWA 4NY0A 3JSVB 5GMVA 3ZIMA 2K6QA 1OTRB 4A3PA 2NPTA 4IUMB 2O2VB 3V6CB 5AZGA 4K7SA 4CO7A 1T0YA 2ZCBA 3H7PB 4KSKC 2KZRA 2HD5B 3H1UA 4FHJA 3Q3JA 4HDOA 2DZKA 4W9JA 1GUAB 1WMHB 2AWTA 1S1QB 3DPDA 3ZDTA 3L13A 3U8ZA 1MG8A 2GBKA 4WWNA 4MSMB 3PTFC 3L54A 3UQAA 5LLIA 4FLHA 1E5WA 4XX5A 4ZYNA 4WAAA 2QHOA 4KZCA 4WWPA 5CHVC 4EZJA 2MBQA 3VTWA 1WX8A 1GG3A 2AL3A 2D2QA 4F8CB 3DCGA 2D10A 4DHZE 5JH5C 4WJPA 3SHQA 2LVPA 3A4RA 3KUDB 1L7YA 3QHTA 1EF1A 3QK0A 4GMVA 3TL5A 3ALBA 2MBEA 3V62A 2A5UA 4HPLB 4YL8A 3W1SA 3OJ3A 5L83A 4JGHB 2N7DA 2KDEB 2KDIA 3P2BA 2L76A 4OVUA 2KTRB 2FCQA 1OEYA 1IPGA 1EF5A 3HHMA 4EFOA 2Z59B 1HE8A 3S2AA 3RZWC 3HIZA 4AP4C 2DZJA 1RFAA 3OJ4B 2FAZA 3O65B 5D7GA 3SDLC 3K9OB 3BY4B 3GZNI 1E8WA 1YJ1A 2KQ7A 1E90A 3HK0A 3TIXA 2WWZA 2CHZA 1KLVA 3GOEA 2FCNA 2LD9A 4BOSC 1V2YA 1C1YB 1J0GA 2K1FA 4E3CA 1XQQA 1WJ6A 3ZDMC 2FNJB 3KYCD 3ZRFA 1WXSA 2MX2A 2MQJA 2O6VB 3QA8A 3MTNB 4A20A 2JZZA 4MGKE 1WE6A 1OEYJ 4JL9A 4MH0E 3A9JA 3R66C 4DK5A 1WX7A 2WYQA 2N9XA 3A4SC 3RD2A 4ANWA 2K6DB 4FJVB 5JHAA 3EHVA 2W9NA 4MSQB 1WJ4A 3WA0A 1UD7A 2FCSA 2FCMA 1J8CA 1LXDA 5C23A 2KHWB 5D2MB 5D6JB 1KJTA 2DX5B 1G6JA 3L10B 4ZRIA 2G45B 2L7RA 3QX1A 2CKHB 5E6PA 2PE9A 4GSWA 4IW0A 4GGQA 2D07B 3LJ3A 4K7UA 4RMAA 2ZVOA 4TQ1A 4DBGA 1WGGA 2KKCA 3QC8B 2L0FA 2ZEQA 2LVOA 1OGWA 2DENB 3L0WB 3VUXA 5FR6A 4I6PA 4KIKB 2MCNB 3KUZA 3M3JA 2WX1A 3QQ8B 1R4MI 3ZNZB 4FA6A 4EKUA 3BINA 4RM8A 2LXAA 4G11A 4JIOU 4FULA 3IFWB 2ZPNA 3I3TB 3A1QB 3HM6X 3JVZX 4IC7B 2GBMA 4LCDE 3PV1A 2K8HA 2V3SA 1UH6A 3T9LA 3MJWA 2JPHA 4MJSB 2BGFA 2LZ6A 3DOWA 3UGBB 5JZEB 3UIOB 3DVNU 3PT2B 4FJZA 3W1SC 1WM2A 2KFKA 2NBWB 2IY1B 3ENEA 1R4NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 B;  3R3M A;  1QZE A;  1UZX B;  1M94 A;  4XC2 A;  3V6E B;  5TR5 A;  1Z2M A;  2MLB A;  3DBL I;  3NS8 A;  5DPT A;  2L05 A;  2XBB C;  4IWP A;  4BFR A;  2ZVN A;  4ICV A;  2N4F A;  2KVR A;  4IWQ A;  4JLC A;  2C7N B;  1P1A A;  2R2Q A;  4PYZ A;  2BYE A;  2LUE A;  2GMI C;  4TUU A;  3VH3 B;  2KX0 A;  2LXC A;  4GDL B;  3VFK A;  2IO1 B;  2RPQ A;  1KM7 A;  2NVU I;  3U30 A;  4WJO A;  1S3S G;  5IA7 A;  2RR9 A;  1GC6 A;  4B95 A;  4DDI D;  2KO3 A;  2HJ8 A;  3VXW A;  1TBE A;  3MHS D;  4K1R B;  4FAD A;  2ZNV C;  4W9K A;  4DXA B;  3CMM B;  3IVF A;  4G0N B;  4ASW C;  4WJQ A;  5KHO A;  1Y8R C;  2J0K A;  4BBN F;  5DPS A;  4HCP B;  1ZGU B;  2KQS A;  2L8J A;  4EUT A;  1ZKH A;  4HCN B;  2EMS A;  2N9P C;  2G4D B;  1V80 A;  3N32 A;  1SIF A;  5DPR A;  2K25 A;  3KUC B;  2LRU A;  4GDK A;  3CF6 E;  3QAQ A;  1X1M A;  2KJ6 A;  3VHT C;  4GIV A;  4BOZ B;  2MP2 A;  3R7Q A;  4NQK E;  4GN1 A;  4XZ4 A;  4AUQ C;  3APF A;  2EKE C;  1U4A A;  3EEC A;  4B6W A;  2GOW A;  4AOF A;  2V1Y A;  5DPW A;  2LGY A;  3PZD A;  2KWU B;  4KZ0 A;  4MGZ E;  4FBJ B;  3NZU A;  2UYZ B;  2I1J A;  2K8C A;  2NBV B;  3VTU A;  3ZTD A;  4W9E A;  4BKG A;  2VRR B;  3VH4 B;  3H7S A;  2L00 B;  2DHZ A;  2CHW A;  1NDD A;  3VAW A;  4IG7 B;  1RRB A;  4KVG B;  4WJN A;  2B3A A;  3KW5 B;  2WX0 A;  5LXH A;  1UEL A;  4NJ7 A;  2DYM A;  4BVU C;  2CU1 A;  3CST A;  1ZW7 A;  2KNB A;  4E71 A;  1ISN A;  1NBF C;  3EFU A;  2Z0E B;  5JHB A;  3OAW A;  4LJP B;  4HVB A;  1V81 A;  3KYD D;  4EZK A;  1L2N A;  4W9D A;  2DYO A;  3V61 A;  1IP9 A;  4AJW A;  4DWF A;  5L95 C;  1UBI A;  1WY8 A;  4OVV A;  4HPM B;  2KOX A;  4NAW A;  1TTN A;  3VTV A;  4DHJ D;  2JZ3 B;  2LJ5 A;  4I6N B;  3VDZ A;  4HDQ A;  2MBB B;  2C7H A;  4TV3 A;  4IM0 A;  4RM9 A;  3WAP A;  2C7M B;  3HM3 A;  4HK2 A;  2BPS A;  3DBS A;  4HJK A;  1V9J A;  2ZNV B;  3AUL A;  4W9C A;  3APC A;  3DVN V;  4URK A;  1GJZ A;  1YX6 B;  3U7D A;  3D32 A;  4EZL A;  3ZUN A;  3VVW B;  2LWP A;  2M4N A;  1I35 A;  3AI5 A;  2BKR B;  1LM8 B;  2NR2 A;  4TKN A;  5D94 A;  3NHE B;  2KX3 A;  2JRH A;  3KVF B;  2C5L C;  1WIA A;  4HLE A;  1WRD B;  3LDZ E;  3OLM D;  3CSF A;  4LDT D;  3ZW3 A;  2IO3 B;  2N1V A;  3TMP B;  2J0J A;  3PPA A;  2LGX A;  2WDT B;  4II3 B;  4II2 B;  1Q0W B;  2KXJ A;  3B08 A;  4ZDV A;  3X23 A;  4MDK E;  4ZRJ A;  2JUO A;  4FJY A;  4GB9 A;  3ZTC A;  3APD A;  4GXB A;  4W9I A;  3A9K A;  1EO6 A;  4G50 A;  4CYE A;  1WI0 A;  1EUV B;  2PE6 B;  4PS7 A;  2I1K A;  3RT3 B;  2N1W A;  3TJP A;  2IYD B;  4A3O A;  5CX3 A;  3PGE A;  1V5T A;  2RD0 A;  3ECI A;  1WZ0 A;  1E8X A;  2ZZP B;  1D3Z A;  2AL6 A;  3L17 A;  4IWO A;  1E7U A;  2NBU A;  2IZV B;  1AAR A;  4KV2 A;  3ZLZ A;  4LJO B;  3TBL D;  3W1Y A;  1WR6 E;  4IM3 A;  2JVC A;  5C1Z A;  1PQS A;  2LI5 A;  2J7Q B;  5CHF A;  4G3X B;  2ZJD A;  1Z5S B;  1WYW B;  2BKF A;  2IO0 B;  2JRI B;  2KFK B;  2REX A;  3PRP B;  4FHK A;  4X57 B;  3UF8 A;  3T8M A;  2R2O A;  2JT4 B;  3ML9 A;  3KH0 A;  3NY5 A;  1K8R B;  3QCA A;  5J17 A;  4J6I A;  1RLF A;  2ZPY A;  3PS6 A;  5E6N A;  1XT9 B;  1Q1O A;  1I42 A;  1C3T A;  2XK5 B;  2GBN A;  4W9F A;  2L0T A;  2FID A;  1VD2 A;  2RGF A;  4EOY A;  2KAN A;  4BKS D;  4IM2 A;  2JF5 A;  3WIM A;  4W9G A;  3M62 B;  3ZNG C;  1WX9 A;  3M63 B;  2BYV E;  2NPT B;  2KMA A;  2KJH B;  3RUI B;  3VUY A;  2M8S A;  2MBH A;  3PLU A;  4E74 A;  2MA9 B;  2KJR A;  3AXC A;  3B1L X;  3PHX B;  3PLV A;  4BKT A;  3JSV A;  5G2N A;  5E6O A;  1TZ1 A;  2PPH A;  3RCZ A;  3RZF A;  2O2V A;  3JW0 X;  2GBJ A;  4GDK B;  2N9E B;  1F9J A;  3H7P A;  2MSE D;  3ZKJ C;  2KC2 A;  3PSE B;  3QIJ A;  2CR5 A;  2KN5 A;  2RSU A;  1WM3 A;  4BKS A;  2MP2 B;  2KK8 A;  4DDG D;  2GBR A;  1WMH A;  3VUW A;  4ANV A;  1LFD A;  1NI2 A;  1H4R A;  3RYT A;  5AZF A;  4ICU A;  2NCN A;  2HE7 A;  2A4Z A;  2KC1 A;  1XD3 B;  5G55 A;  3DQV A;  5BO4 B;  1TGZ B;  3B0A A;  2KD0 A;  1E8Y A;  2MWS B;  2MRP A;  4PS3 A;  4JQW C;  2M17 A;  2KWC A;  3L08 A;  5LXI B;  1WZ3 A;  2PEA A;  3ONS A;  1YQB A;  2KWV B;  2M0X A;  3DDC B;  2N7E A;  3C0R B;  2J0M A;  1WE7 A;  3PHW B;  4PYU A;  2D11 A;  2O6V D;  2KMC A;  3K9P B;  3DBR I;  1SE9 A;  1WGR A;  3IHP C;  2IY0 B;  2MBO A;  3DBH I;  2ZCC A;  4K81 A;  1P98 A;  4P7I A;  2KTR A;  1GC7 A;  1WXM A;  4K7W A;  1WXA A;  3ML8 A;  3L16 A;  4NPN A;  1RAX A;  3QJZ A;  2BWF A;  1KOT A;  4MGY E;  3PRM B;  1A5R A;  4ANX A;  4NAW B;  2KTF A;  5J2R A;  1GNU A;  1WGH A;  1WXV A;  2AEH A;  5AEK B;  3H6N A;  1J19 A;  4DHZ B;  2YLM A;  3NOB A;  4F1S A;  1Q5W B;  3A9J B;  1E8Z A;  4KSL C;  3DVG Y;  3UIP B;  4EEW A;  2L3Z A;  2O6V A;  3ZRC A;  2BF8 B;  1JRU A;  3QAR A;  4M8N A;  2JWZ A;  4N9F 4;  1FXT B;  3PVL A;  2UWQ A;  2KDF B;  5CHW A;  3VQI A;  3JYU A;  2CS4 A;  3AU5 A;  3DVG X;  2FIF A;  3IG3 A;  2ASQ A;  2HTH A;  2YVC A;  4F7Z A;  1V6E A;  4AWJ A;  1YD8 U;  1WR1 A;  4DHJ B;  1WJN A;  2DAF A;  1UGM A;  2K39 A;  1WJU A;  2MW5 A;  3TCA A;  3ZNH B;  2BWE S;  3NZS A;  2K8B A;  1VCB A;  2IBI B;  4MEL A;  1WGY A;  4MM3 A;  4M8M A;  4W9L A;  3ZNI D;  1UBQ A;  3ZVV A;  5HKH A;  2V4L A;  5DCN A;  2LGD A;  2D3G A;  2JY6 A;  3PRZ A;  4GU2 A;  2M1M A;  5J18 A;  3A9K B;  3X0W A;  5KHQ A;  4AJY B;  1V86 A;  3WAM A;  4W9H A;  1IYF A;  5AZH A;  2AYO B;  2C9W B;  2LAS A;  3Q3F A;  4CHK A;  2KLC A;  4WWO A;  4KIK A;  3R7R A;  1LQB A;  2XEW A;  1WH3 A;  4KDL B;  2BYF A;  2EMT A;  3IBE A;  3PRE A;  4LDT B;  2KDB A;  4KDI C;  2KFJ A;  4M0W B;  1E7V A;  2G4S A;  3A1Q A;  4FN2 A;  3EC8 A;  3N30 A;  1P3Q U;  2DYB A;  3SU8 X;  4TQ0 A;  4WQO B;  3V60 A;  2G3Q B;  4NNJ B;  4MJS A;  3AU4 A;  3A33 B;  4HXD A;  1P9D U;  4NJ6 A;  2NS5 A;  3ZO5 B;  1YX5 B;  2DZI A;  1CMX B;  1V49 A;  4GOC A;  2JXX A;  1P0R A;  2KLG A;  1WFY A;  2DZM A;  1WF9 A;  3RUL A;  3H9D A;  4I6L B;  1WGD A;  5CTR C;  2DAJ A;  2OJR A;  3N3K B;  4HWI B;  4PS8 A;  4MEM A;  4NQL B;  3M95 A;  4B9K A;  1OQY A;  3SD5 A;  1H8C A;  1SGH A;  2OOB B;  1YIW A;  1V5O A;  2PJH A;  4GDL A;  3WAN A;  3WAL A;  2XK5 A;  3WAO A;  3UQB A;  4ZRK A;  3QWZ B;  2C60 A;  2Y5B B;  4MGI E;  5IAA C;  2FUH B;  2Z0D B;  3UIN B;  4BBN C;  4ANU A;  2LVQ A;  5EDS A;  1BT0 A;  2CHX A;  2LRW A;  4NY0 A;  3JSV B;  5GMV A;  3ZIM A;  2K6Q A;  1OTR B;  4A3P A;  2NPT A;  4IUM B;  2O2V B;  3V6C B;  5AZG A;  4K7S A;  4CO7 A;  1T0Y A;  2ZCB A;  3H7P B;  4KSK C;  2KZR A;  2HD5 B;  3H1U A;  4FHJ A;  3Q3J A;  4HDO A;  2DZK A;  4W9J A;  1GUA B;  1WMH B;  2AWT A;  1S1Q B;  3DPD A;  3ZDT A;  3L13 A;  3U8Z A;  1MG8 A;  2GBK A;  4WWN A;  4MSM B;  3PTF C;  3L54 A;  3UQA A;  5LLI A;  4FLH A;  1E5W A;  4XX5 A;  4ZYN A;  4WAA A;  2QHO A;  4KZC A;  4WWP A;  5CHV C;  4EZJ A;  2MBQ A;  3VTW A;  1WX8 A;  1GG3 A;  2AL3 A;  2D2Q A;  4F8C B;  3DCG A;  2D10 A;  4DHZ E;  5JH5 C;  4WJP A;  3SHQ A;  2LVP A;  3A4R A;  3KUD B;  1L7Y A;  3QHT A;  1EF1 A;  3QK0 A;  4GMV A;  3TL5 A;  3ALB A;  2MBE A;  3V62 A;  2A5U A;  4HPL B;  4YL8 A;  3W1S A;  3OJ3 A;  5L83 A;  4JGH B;  2N7D A;  2KDE B;  2KDI A;  3P2B A;  2L76 A;  4OVU A;  2KTR B;  2FCQ A;  1OEY A;  1IPG A;  1EF5 A;  3HHM A;  4EFO A;  2Z59 B;  1HE8 A;  3S2A A;  3RZW C;  3HIZ A;  4AP4 C;  2DZJ A;  1RFA A;  3OJ4 B;  2FAZ A;  3O65 B;  5D7G A;  3SDL C;  3K9O B;  3BY4 B;  3GZN I;  1E8W A;  1YJ1 A;  2KQ7 A;  1E90 A;  3HK0 A;  3TIX A;  2WWZ A;  2CHZ A;  1KLV A;  3GOE A;  2FCN A;  2LD9 A;  4BOS C;  1V2Y A;  1C1Y B;  1J0G A;  2K1F A;  4E3C A;  1XQQ A;  1WJ6 A;  3ZDM C;  2FNJ B;  3KYC D;  3ZRF A;  1WXS A;  2MX2 A;  2MQJ A;  2O6V B;  3QA8 A;  3MTN B;  4A20 A;  2JZZ A;  4MGK E;  1WE6 A;  1OEY J;  4JL9 A;  4MH0 E;  3A9J A;  3R66 C;  4DK5 A;  1WX7 A;  2WYQ A;  2N9X A;  3A4S C;  3RD2 A;  4ANW A;  2K6D B;  4FJV B;  5JHA A;  3EHV A;  2W9N A;  4MSQ B;  1WJ4 A;  3WA0 A;  1UD7 A;  2FCS A;  2FCM A;  1J8C A;  1LXD A;  5C23 A;  2KHW B;  5D2M B;  5D6J B;  1KJT A;  2DX5 B;  1G6J A;  3L10 B;  4ZRI A;  2G45 B;  2L7R A;  3QX1 A;  2CKH B;  5E6P A;  2PE9 A;  4GSW A;  4IW0 A;  4GGQ A;  2D07 B;  3LJ3 A;  4K7U A;  4RMA A;  2ZVO A;  4TQ1 A;  4DBG A;  1WGG A;  2KKC A;  3QC8 B;  2L0F A;  2ZEQ A;  2LVO A;  1OGW A;  2DEN B;  3L0W B;  3VUX A;  5FR6 A;  4I6P A;  4KIK B;  2MCN B;  3KUZ A;  3M3J A;  2WX1 A;  3QQ8 B;  1R4M I;  3ZNZ B;  4FA6 A;  4EKU A;  3BIN A;  4RM8 A;  2LXA A;  4G11 A;  4JIO U;  4FUL A;  3IFW B;  2ZPN A;  3I3T B;  3A1Q B;  3HM6 X;  3JVZ X;  4IC7 B;  2GBM A;  4LCD E;  3PV1 A;  2K8H A;  2V3S A;  1UH6 A;  3T9L A;  3MJW A;  2JPH A;  4MJS B;  2BGF A;  2LZ6 A;  3DOW A;  3UGB B;  5JZE B;  3UIO B;  3DVN U;  3PT2 B;  4FJZ A;  3W1S C;  1WM2 A;  2KFK A;  2NBW B;  2IY1 B;  3ENE A;  1R4N I; 
#chains in the Genus database with same CATH topology
 3V6E B;  2L32 A;  1Z2M A;  2W82 A;  3NS8 A;  4BFR A;  2NTS A;  2N4F A;  2KVR A;  4PYZ A;  3VH3 B;  4ANW A;  2LUE A;  1KM7 A;  2LJI A;  1MPE A;  2RR9 A;  2KO3 A;  2WXL A;  3MHS D;  4S0R A;  4W9K A;  1PYW D;  2MH7 A;  3IVF A;  4WJQ A;  5KHO A;  1Y8R C;  2J0K A;  2KQS A;  2L8J A;  4EUT A;  1ZKH A;  3IXS A;  4JX1 C;  4HCN B;  1C9F A;  2N9P C;  2G4D B;  1V80 A;  3N32 A;  3TSS A;  2K25 A;  3KUC B;  4GDK A;  2D3B A;  1X1M A;  3VHT C;  2FUG 1;  4NQK E;  4XZ4 A;  2VH1 A;  3EEC A;  2GOW A;  2BB5 A;  2KWU B;  4OW0 A;  1KRH A;  1IUE A;  3MC0 B;  1UWM A;  3VH4 B;  1NDD A;  1IBX A;  4KVG B;  5G5G A;  3KW5 B;  4REZ A;  2WX0 A;  1TY0 A;  2HDE A;  2CU1 A;  1ZW7 A;  2KNB A;  3AB5 A;  1EWC A;  4LNI A;  5HG2 A;  1R4N B;  1V81 A;  1WGK A;  4HVB A;  1L2N A;  1IP9 A;  1UBI A;  4OVV A;  2WDQ B;  1L0V B;  1I7H A;  2JZ3 B;  4I6N B;  1CK1 A;  2WXH A;  4IM0 A;  4RM9 A;  1V8C A;  4HJK A;  2ZNV B;  1IGC A;  4DXG A;  3SR6 A;  4HRO A;  3TEW A;  2LWP A;  2M4N A;  1LM8 B;  2I2Y A;  1TJE A;  3NHE B;  5IN7 A;  2C5L C;  1V1P B;  3DHG C;  3LDZ E;  3OLM D;  3TMP B;  2J0J A;  4II2 B;  1SE2 A;  3X23 A;  3ZTC A;  1ACC A;  1QT9 A;  3APD A;  4W9I A;  1EO6 A;  3J9C A;  4FXC A;  1EUV B;  2PE6 B;  4PS7 A;  2N1W A;  2IYD B;  5CX3 A;  2BB6 A;  2ZZP B;  4PK1 A;  1EU4 A;  4KV2 A;  3TBL D;  2QDF A;  2QCZ A;  4MT5 A;  2JVC A;  5AUK A;  4RGM A;  4G3X B;  1Z5S B;  1WYW B;  4X57 B;  2KFK B;  4OZB A;  2M56 B;  3T8M A;  1ET6 A;  3KH0 A;  3NY5 A;  3QCA A;  2ZW0 A;  1FNU A;  4BZA A;  4LNK A;  1C3T A;  2N7J A;  2XK5 B;  3R8B A;  4KKJ A;  2L0T A;  2FID A;  1VD2 A;  1T5X D;  1T6B X;  3ZNG C;  2BYV E;  3PZ8 A;  2MA9 B;  3B1L X;  1SIJ A;  3PZ7 A;  3FAH A;  3Q8C A;  2INN E;  3I5J C;  4BKT A;  1XCQ L;  2PPH A;  2O2V A;  2K5P A;  2GBJ A;  2KAC A;  3H7P A;  4WIP A;  3ZKJ C;  3PSE B;  1TY2 A;  3ZXV A;  1WM3 A;  2MP2 B;  3NZ3 A;  1WMH A;  3KWV A;  3VUW A;  1T0Q C;  1FNW A;  3CIR B;  2RPV A;  5AZF A;  2NCN A;  2HE7 A;  1EU3 A;  1ENF A;  3DQV A;  3B0A A;  3IAM 1;  4NJC A;  2WS3 B;  5LXI B;  2PEA A;  1L4D B;  2GLS A;  2KWV B;  3P42 A;  2N7E A;  3C0R B;  3PHW B;  1ZP0 B;  4PYU A;  3K9P B;  3Q3N C;  1SE9 A;  1WGR A;  2IY0 B;  3DBH I;  1GC7 A;  3MP9 A;  4RCO A;  1WXA A;  4JWU C;  3L16 A;  1RAX A;  2BWF A;  1GOZ A;  1FCC C;  3ZJV A;  2QEJ C;  5J2R A;  1PUT A;  1BXT A;  1WGH A;  2WDR B;  5AEK B;  2KN4 A;  3WCQ A;  2YEP B;  2YLM A;  3DVG Y;  4YTN B;  5I4D A;  4KGS A;  1FXT B;  3PVL A;  2UWQ A;  1YJI A;  2VZK B;  3GE3 C;  3P63 A;  1DOI A;  2FIF A;  1YJJ A;  2ASQ A;  2HTH A;  1YD8 U;  1UGM A;  2K3U A;  1WJU A;  1D6E C;  1XF5 L;  4MM3 A;  4M8M A;  3ZVV A;  1DGJ A;  2JY6 A;  3PRZ A;  1RM6 C;  4LK0 M;  1IYF A;  5AZH A;  4WWO A;  1LQB A;  1WH3 A;  1F1H A;  2D3C A;  4RGN A;  2BYF A;  4KDI C;  4JE3 B;  1HTO A;  2WXQ A;  1BUI C;  3EC8 A;  1P3Q U;  3V60 A;  3DBH B;  3KLS X;  1MJD A;  2QC8 A;  4NJ6 A;  1P9D U;  3EUB 2;  1CMX B;  3IT4 B;  3NVV A;  2KLG A;  1WFY A;  5CTR C;  4LTU A;  5EE3 A;  4NQL B;  3M95 A;  3WAO A;  3UQB A;  4D2K A;  3QWZ B;  2C60 A;  3UIN B;  2Z0D B;  2LVQ A;  1BT0 A;  2K6Q A;  3U2S C;  3AV8 A;  4P6V F;  2Y3A A;  2ZCB A;  5MPO A;  1QOB A;  3EA6 A;  4HDO A;  1SJH D;  1S1Q B;  3ZDT A;  1R7S A;  4WWN A;  2AQ2 B;  3L54 A;  1E5W A;  1C76 A;  3BII D;  2QHO A;  5CHV C;  1JWS D;  2MBQ A;  2V4I B;  1WX8 A;  3L4P A;  2KWD A;  3DCG A;  4DHZ E;  1HZ6 A;  4DXF A;  4YL8 A;  3P2B A;  2L76 A;  4YSZ B;  2FCQ A;  3SEB A;  4AQ7 A;  3HHM A;  2FBW B;  1JCK B;  1XLO A;  3RZW C;  1RFA A;  3GZN I;  3AE4 B;  1JRO A;  3PO0 A;  1J7A A;  1B9R A;  3GOE A;  4GLS C;  1J0G A;  1C1Y B;  4YSY B;  1XQQ A;  2N9K A;  1WXS A;  1MFW A;  2JZZ A;  1WE6 A;  2JU6 X;  3R66 C;  4DK5 A;  1UF0 A;  3RD2 A;  1Y56 A;  2W9N A;  4MSQ B;  2BVC A;  3WA0 A;  1UD7 A;  2KHW B;  5D6J B;  2DX5 B;  4ZRI A;  1J7C A;  3AEA B;  4MAC A;  2D5G A;  1FO4 A;  2CKH B;  5E6P A;  2PE9 A;  1P7E A;  2SAK A;  1F2R C;  3B2F A;  4RMA A;  2ZVO A;  4TQ1 A;  4DBG A;  1WGG A;  2M19 A;  2ZEQ A;  2LFI A;  2LVO A;  1K51 A;  1NI3 A;  4RGT A;  4FA6 A;  4R3D A;  1MHX A;  3BIN A;  4RM8 A;  2LXA A;  4JIO U;  1ESF A;  2UU7 A;  3I3T B;  3A1Q B;  3JVZ X;  2BW2 A;  1DOY A;  1TYG B;  2V3P A;  4KGT A;  3R2I A;  4WUR A;  3V05 A;  5JZE B;  3UGB B;  3UIO B;  3DVN U;  3PT2 B;  2KFK A;  2BS2 B;  3GZN B;  2IO2 B;  3R3M A;  1QZE A;  4XC2 A;  5TR5 A;  2MLB A;  2WQY B;  3AED B;  2ZVN A;  4ICV A;  4JLC A;  2KX0 A;  4GDL B;  3UI3 A;  1ZDV A;  1S3S G;  5IA7 A;  4XE0 A;  4B95 A;  1L5P A;  5D3I B;  4FAD A;  2ZNV C;  3CMM B;  4HCP B;  1ZGU B;  2WU2 B;  2KMM A;  4JPS A;  2CJO A;  2GI9 A;  3N1Y C;  4GIV A;  4XDC A;  1XEE A;  2MP2 A;  1NVI D;  2GB1 A;  1JWU D;  1FM0 D;  3APF A;  3MHZ A;  4AUQ C;  1U4A A;  4B6W A;  3AE1 B;  2LGY A;  4MGZ E;  4FBJ B;  2NBV B;  3ZTD A;  4W9E A;  2VRR B;  3H7S A;  2L00 B;  2LHE A;  2AQ3 B;  1HQR D;  2XN9 C;  1UEL A;  4NJ7 A;  1NBF C;  3EFU A;  2Z0E B;  2Q5W D;  3OAW A;  4LJP B;  2VZK D;  4K3C A;  3GE8 C;  3KYD D;  4YSX B;  4W9D A;  4AJW A;  4DWF A;  2PLP A;  3VTV A;  1JWB D;  1KF6 B;  4TV3 A;  3WAP A;  3HM3 A;  4HK2 A;  3DBS A;  1V9J A;  3RN9 C;  1FXA A;  1L0Y B;  2K9X A;  3U7D A;  3AI5 A;  2NR2 A;  4L1B A;  2KX3 A;  1KTK A;  1WIA A;  1TZO A;  3CSF A;  2KT7 A;  2IO3 B;  4ZDV A;  4ZRJ A;  1N61 A;  2JZP A;  3AE5 B;  3RNA C;  4G50 A;  2IPK D;  4CYE A;  3Q69 A;  3U4E G;  3ECI A;  2RD0 A;  1WZ0 A;  1E8X A;  1E7U A;  2NBU A;  1AAR A;  1SXT A;  3W1Y A;  1WR6 E;  1FRR A;  2LI5 A;  5CHF A;  2ZJD A;  3PRP B;  2JRI B;  1KH0 A;  2R2O A;  1TIF A;  2LUM A;  5E6N A;  3TEZ A;  3VR8 B;  1WWT A;  2GBN A;  2BBC A;  2BS3 B;  2QIL A;  1BML C;  2RGF A;  3AEC B;  2KAN A;  1K53 A;  4PT5 A;  2JF5 A;  3WIM A;  1AWD A;  3M63 B;  2KMA A;  1J7B A;  3RMK C;  3AXC A;  3AEB B;  1YN3 A;  3FC4 A;  4WQM A;  3PLV A;  1TZ1 A;  3BVZ A;  4N58 A;  2KC2 A;  1I4H A;  3I57 A;  2RSU A;  4DDG D;  4KX6 B;  2QMT A;  2GBR A;  4NZL B;  3HUI A;  4ANV A;  4KGR A;  1LFD A;  1NI2 A;  2PVO D;  4XYC A;  4YTP B;  1HTQ A;  2KC1 A;  1XD3 B;  1VZ8 A;  5BO4 B;  2KD0 A;  1E8Y A;  3TUO A;  2MWS B;  2MRP A;  2JYT A;  4JQW C;  4RGO S;  3L08 A;  3DDC B;  2J0M A;  1WE7 A;  1OQR A;  2KMC A;  5IOI A;  1JWM D;  3IHP C;  1D5Z C;  4K7W A;  4MGY E;  3N1X C;  3NJT A;  4NAW B;  1I4X A;  1QIL A;  1WXV A;  2AEH A;  4ZYS A;  3H6N A;  2BTE A;  3RI7 C;  1JQ4 A;  1HXY D;  1YQ3 B;  3LB8 C;  1Q5W B;  4KSL C;  1ZXH A;  2L3Z A;  2BF8 B;  1VZ6 A;  3BYY B;  2KDF B;  2TSS A;  2DLB A;  3JYU A;  2CS4 A;  2K0P A;  3DVG X;  3Q14 C;  1N5W A;  4DHJ B;  2DAF A;  2K39 A;  2MW5 A;  4HPP A;  2BWE S;  3NZS A;  3TEY A;  4MEL A;  4W9L A;  1UBQ A;  2D3G A;  4GU2 A;  4H2A A;  5J18 A;  3A9K B;  1SBB B;  4AJY B;  2CJN A;  2AYO B;  2C9W B;  4CHK A;  2LHD A;  2BQQ A;  1FFV A;  4N6E B;  2XEW A;  2ACZ B;  4M01 A;  2EMT A;  3IBE A;  4LDT B;  4WH4 A;  1E7V A;  3A1Q A;  2GRI A;  4FN2 A;  3SU8 X;  4TQ0 A;  1M4V A;  4WQO B;  5BYQ A;  4RH6 A;  2G3Q B;  3AU4 A;  1FD6 A;  4ZRQ A;  4HXD A;  2NS5 A;  2AX5 A;  1P0R A;  1WF9 A;  1TS5 A;  2IND C;  2OJR A;  4DQO C;  1ZXI A;  3DWM A;  4MEM A;  3VRA B;  1OQY A;  1SGH A;  1YIW A;  2V0G A;  1V5O A;  4GDL A;  3P4P B;  1N62 A;  2WXK A;  4RNA A;  4MGI E;  4BBN C;  3AE3 B;  5GMV A;  3P4R B;  4K3B A;  3V6C B;  2KAJ A;  4L23 A;  3GP7 A;  2KZR A;  4KSK C;  2PKO A;  2DZK A;  1HZ5 A;  2AQ1 B;  4C00 A;  1GUA B;  2X8X X;  3C19 A;  3U8Z A;  4MSM B;  3PTF C;  5LLI A;  4FLH A;  4F8C B;  5JH5 C;  3GB1 A;  2QSD A;  1KLG D;  1L7Y A;  2PTL A;  3TL5 A;  2MBE A;  2MJ3 A;  3V62 A;  2A5U A;  1AN8 A;  4QAY A;  4ZHP A;  4OVU A;  5BYS A;  1EF5 A;  3HIZ A;  2DZJ A;  2FAZ A;  3HVD A;  4OZA A;  3W2D A;  3AE7 B;  1E90 A;  1D5M C;  3HK0 A;  1B1Z A;  2NMQ A;  2LD9 A;  3V3X A;  4E3C A;  3AE6 B;  2WXI A;  1OFF A;  3KYC D;  1JML A;  2O6V B;  3QA8 A;  1IGD A;  2HTM E;  3SFD B;  4FJV B;  3EHV A;  2MJE A;  2FCM A;  1LXD A;  4NAM A;  5C23 A;  4WAF A;  3L10 B;  5IO9 A;  2WP9 B;  2L7R A;  4GGQ A;  5IKC M;  3AM9 A;  3Q6B A;  2L1A A;  3QC8 B;  1V1O A;  2L0F A;  1C4C A;  3VUX A;  3N1Z C;  4KIK B;  4TMA B;  4HKZ E;  3KUZ A;  3QQ8 B;  3IT6 B;  2ZPN A;  1NEK B;  2JWU A;  2K8H A;  5FKA C;  1I4P A;  1UH6 A;  3T9L A;  3T3N A;  2JPH A;  1N5X A;  3HRD D;  4MJS B;  1TT5 B;  3AEE B;  1NEN B;  4FJZ A;  2W3S A;  3ENE A;  3P4Q B;  1E9M A;  1PGX A;  3AEG B;  3AE2 B;  2L05 A;  2I38 A;  2XBB C;  4IWP A;  3ZQ4 A;  1C79 A;  4IWQ A;  2C7N B;  1P1A A;  4F7Z A;  1H8C A;  2BYE A;  4TUU A;  2GMI C;  4WJO A;  4O1N A;  3AE9 B;  2CU3 A;  4DDI D;  2HJ8 A;  3VXW A;  1TBE A;  1UNS A;  4K1R B;  2RDG A;  4G0N B;  2ONQ A;  4ASW C;  1KFY B;  2SEB D;  1SSN A;  1JAL A;  1RWS A;  3TEX A;  1SIF A;  1UGJ A;  4OZC A;  3CF6 E;  1SE3 A;  4ZHO A;  3ZGZ A;  2KJ6 A;  2WXO A;  3R7Q A;  4GN1 A;  3EFC A;  2V1Y A;  5DPW A;  3NZU A;  1WRI A;  2I1J A;  1EM7 A;  4B0M A;  4BKG A;  4AS1 A;  5T8I A;  1FIQ A;  4IG7 B;  4ACF A;  2XNA C;  2WXR A;  4WJN A;  1L6V A;  4US9 A;  3CST A;  3SFE B;  4E71 A;  5JHB A;  2V3N A;  4EZK A;  1CQV A;  2DYO A;  3NUH B;  3V61 A;  1WY8 A;  2WDV B;  4HPM B;  4NAW A;  1TTN A;  4DHJ D;  2LJ5 A;  3Q2A C;  4S17 A;  2FE8 A;  4HDQ A;  3VDZ A;  2C7H A;  2C7M B;  1SE4 A;  2OED A;  3E9S A;  3C8Y A;  3APC A;  3DVN V;  4URK A;  5BMG A;  3MC8 A;  2JSV X;  1STE A;  2R61 A;  3U52 E;  1I35 A;  2ZW1 A;  3AH7 A;  2MEK A;  2G9H D;  4IDI A;  5TSS A;  1T0S C;  3RNB C;  3BVM A;  4XWT A;  4LDT D;  1Q10 A;  2N1V A;  3PPA A;  2WDT B;  2KXJ A;  1NYQ A;  2PIA A;  3B08 A;  2JUO A;  4GB9 A;  4GXB A;  1F52 A;  3A9K A;  1JWA D;  2WNM A;  3P4S B;  4A3O A;  3PGE A;  1V5T A;  1ZPS A;  2OJW A;  1TS4 A;  4N59 A;  3Q3O C;  3O13 A;  4C7Z A;  5D3D A;  1E6E B;  2IJ0 A;  1CZP A;  4P1C C;  4LJO B;  4IM3 A;  4TSS A;  1PQS A;  1QOG A;  2REX A;  1GJZ A;  4FHK A;  2JT4 B;  1XXG A;  2WGS A;  1K8R B;  1LGR A;  1RLF A;  2ZPY A;  2IGG A;  4XGA B;  1C77 A;  4EOY A;  4BKS D;  4IM2 A;  2PVG C;  4W9G A;  1QOA A;  2H89 B;  3RUI B;  3VUY A;  2KJH B;  1FMA D;  2MBH A;  3PLU A;  2DBY A;  5G2N A;  5E6O A;  5C3J B;  3OWE B;  5G5H A;  1F9J A;  2MSE D;  3QIJ A;  2WXG A;  2KN5 A;  4BKS A;  2KK8 A;  1EWY C;  2M0A A;  1MG4 A;  5GXG B;  4A55 A;  2KVZ A;  2M17 A;  2KWC A;  3ONS A;  1YQB A;  5EE9 A;  2M0X A;  4KKI A;  3BK2 A;  3DHI C;  1OQQ A;  2O6V D;  3Q8A A;  4P7I A;  2ZCC A;  3GS2 A;  1P98 A;  4C56 C;  1WXM A;  3MFG A;  2V9H A;  3ML8 A;  4NPN A;  3QJZ A;  1KOT A;  4JWS C;  1I4G A;  2NTT A;  5FR3 A;  1TKY A;  3ZXR A;  4DHZ B;  1SJE D;  4F1S A;  1E8Z A;  2IGH A;  3Q3M C;  2O6V A;  2ON8 A;  3QAR A;  4M8N A;  2JWZ A;  4ITK A;  2WXP A;  3VQI A;  3AU5 A;  3IG3 A;  1XO3 A;  1V6E A;  4AWJ A;  5HFY A;  4EZJ A;  1SEB D;  3ZNH B;  1VCB A;  4J3O D;  3VRB B;  3ZNI D;  4RFB A;  2V4L A;  5DCN A;  2LGD A;  1C4A A;  1D5X C;  3X0W A;  2EEL A;  5KHQ A;  3WAM A;  4W9H A;  3Q3F A;  4M02 A;  2KLC A;  4KIK A;  3ABV B;  3I9V 1;  1GPX A;  3MJ5 A;  3PRE A;  2KDB A;  4M0W B;  2G4S A;  2H88 B;  1DYQ A;  1QF6 A;  1WSP A;  3N30 A;  2DYB A;  1L4Z B;  4MJS A;  3A33 B;  4HJG E;  2DZI A;  1GB4 A;  2E3T A;  4GOC A;  1V49 A;  2JXX A;  1TS2 A;  1XLQ A;  2DAJ A;  3N3K B;  1N6Z A;  4HWI B;  2JQR B;  4B9K A;  3NVY A;  3SD5 A;  1PGA A;  2PJH A;  2WHI A;  3WAL A;  1KLU D;  1I4R A;  1VJK A;  2YEP F;  2Y5B B;  1E7P B;  3I63 C;  4ANU A;  3JSV B;  4OVZ A;  2NPT A;  1L6U A;  5AZG A;  4K7S A;  4HEA 1;  3Q3J A;  4W9J A;  3N9Y C;  3DPD A;  5BYR A;  3L13 A;  1WXQ A;  3AMZ A;  1MG8 A;  1XLP A;  2GBK A;  4C4V B;  3UQA A;  4CQN A;  4ZYN A;  3MC9 A;  4WWP A;  2D3A A;  3VTW A;  1GG3 A;  1K50 A;  2AL3 A;  2D2Q A;  3BVG A;  4WJP A;  2LVP A;  3A4R A;  3KUD B;  2WLB A;  3QK0 A;  4GMV A;  5EE1 A;  2MJD A;  2WXN A;  3Q8B A;  3W1S A;  5L83 A;  3OJ3 A;  1PFD A;  1VLB A;  1QKZ A;  5JXV A;  2KDI A;  2KTR B;  2Z59 B;  1HEZ E;  3S2A A;  1D4B A;  4AP4 C;  2RDB C;  3OJ4 B;  5D7G A;  3K9O B;  3BY4 B;  1NYR A;  2KQ7 A;  3AEF B;  2K22 A;  3DWG C;  3TIX A;  1KLV A;  2BS4 B;  1N60 A;  4BOS C;  4XWW A;  1V2Y A;  2K1F A;  3ZDM C;  4LLG M;  3ZRF A;  2MX2 A;  2J4X A;  1ET9 A;  4MGK E;  1OEY J;  4YT0 B;  3A9J A;  4XDD A;  1WX7 A;  2WYQ A;  3A4S C;  2KDM A;  5JHA A;  1ROE A;  1YMH E;  2PW9 A;  1G6J A;  1FRD A;  2G45 B;  4ARI A;  1A70 A;  4GSW A;  4IW0 A;  3ETR A;  4K7U A;  1RYJ A;  3URY A;  1OGW A;  2DEN B;  3L0W B;  5FR6 A;  4I6P A;  2MCN B;  3M3J A;  3NS1 A;  1R4M I;  4EKU A;  4YWG G;  3IFW B;  3HM6 X;  4IC7 B;  1QLB B;  4LCD E;  2BYT A;  1YN5 A;  4IKG A;  3MJW A;  4RF0 A;  2BGF A;  2LZ6 A;  1DOX A;  3W1S C;  1YX6 B;  1UZX B;  1M94 A;  3KWL A;  5DPT A;  2RDH A;  3DBL I;  4A8X C;  1C4P A;  2R2Q A;  5EDS A;  2LXC A;  3VFK A;  2IO1 B;  2RPQ A;  2NVU I;  3U30 A;  2WU5 B;  1GC6 A;  4WWM A;  2DWQ A;  4ZOH C;  4DXA B;  2IGD A;  3RFZ B;  4BBN F;  5DPS A;  2EMS A;  1F77 A;  2DNF A;  4A9A A;  5DPR A;  2LRU A;  3QAQ A;  4BOZ B;  5AUI A;  4EE2 A;  2EKE C;  2Z8L A;  4AOF A;  3RNF C;  3PZD A;  3NG0 A;  5E6J A;  4KZ0 A;  1R4M B;  2UYZ B;  2K8C A;  3VTU A;  2J42 A;  1GAQ B;  2DHZ A;  2CHW A;  3VAW A;  2X38 A;  1RRB A;  2B3A A;  5LXH A;  2DYM A;  4BVU C;  1ISN A;  5BMI A;  3BYT B;  3IAS 1;  5L95 C;  2ICI A;  2J52 A;  4RF1 A;  2KOX A;  5HHD G;  2QIE B;  3DBL B;  1F0Z A;  5HI1 A;  1AW7 A;  2MBB B;  2EKI A;  3FIL B;  2BPS A;  2IDY A;  3NRZ A;  4LNF A;  4C7Y A;  3AUL A;  4W9C A;  5H92 C;  3D32 A;  4EZL A;  3ZUN A;  3VVW B;  2BKR B;  4TKN A;  5D94 A;  1I4Q A;  2JRH A;  3KVF B;  4A6Q A;  4HLE A;  1WRD B;  3BZD B;  3ZW3 A;  2LGX A;  4II3 B;  1Q0W B;  1FFU A;  4MDK E;  3RPF C;  1FPY A;  2Y5P A;  2JYE A;  4FJY A;  2B76 B;  2WXJ A;  2N0S B;  2LGS A;  3KQ4 A;  3RNG C;  1WI0 A;  1C78 A;  2I1K A;  3RT3 B;  3TJP A;  2N9L A;  2INC C;  1D3Z A;  2AL6 A;  3L17 A;  3AN1 A;  4IWO A;  2IZV B;  4BAX A;  4M0W A;  1JRP A;  5IP4 D;  3ZLZ A;  1TS3 A;  2L52 A;  5C1Z A;  2J7Q B;  2BKF A;  2HJ1 A;  2IO0 B;  4UDU C;  3UF8 A;  3ML9 A;  5J17 A;  4J6I A;  3PS6 A;  2LEK A;  1XT9 B;  1Q1O A;  1TKE A;  1I42 A;  3BWU D;  1AYF A;  4W9F A;  2KQ4 X;  3M62 B;  1MVK A;  1WX9 A;  2NPT B;  1UUP A;  2M8S A;  4E74 A;  2KJR A;  3PHX B;  4YTM B;  3HVZ A;  3NVW A;  2E6X A;  5FK9 C;  3JSV A;  3T3O A;  3RCZ A;  3RZF A;  4P1B C;  3JW0 X;  1CJE A;  4GDK B;  2N9E B;  1MHH E;  4Q2J A;  3Q8E A;  2CR5 A;  5EE0 A;  4P16 A;  2KYW A;  1N63 A;  4LNO A;  1H4R A;  3RYT A;  1GB1 A;  4C4V A;  4ICU A;  2A4Z A;  5G55 A;  1TGZ B;  4ARC A;  4PS3 A;  1ZOY B;  1WZ3 A;  2J53 A;  1IBX B;  2D11 A;  3DBR I;  5C2T B;  4K81 A;  2MBO A;  2KTR A;  3Q8F A;  3W5V B;  4YXD B;  2JXT A;  2LMC A;  3PRM B;  1A5R A;  4ANX A;  1XLN A;  2KTF A;  1MI0 A;  2VH2 A;  1GNU A;  1WYG A;  2Y5C A;  5BMH A;  1J19 A;  4ZRP A;  3NOB A;  3A9J B;  3UIP B;  1K52 A;  1PDX A;  4US8 A;  4EEW A;  3ZRC A;  1V97 A;  2QJL A;  1JRU A;  3ZYY X;  3LXF A;  4N9F 4;  5CHW A;  3CWI A;  2OHF A;  2YVC A;  1WR1 A;  1WJN A;  2PMV A;  3TCA A;  2K8B A;  2IBI B;  1WGY A;  1V1P A;  5HKH A;  2M1M A;  4IOI E;  1TKG A;  1V86 A;  2LAS A;  4HRS A;  4HKQ A;  1YQ4 B;  3R7R A;  4KDL B;  2KFJ A;  1FXI A;  1L0X B;  3DBR B;  4NNJ B;  1QOF A;  3ZO5 B;  1ZDX A;  1YX5 B;  2L83 A;  1ZUD 2;  2WXM A;  2DZM A;  1VDV A;  3RUL A;  3H9D A;  4I6L B;  1WGD A;  4PS8 A;  4OHJ A;  1E0Z A;  1YNT E;  2OOB B;  2W54 A;  3W9C B;  1VRA B;  2LGI A;  1ZE3 D;  3WAN A;  2INP E;  1VR9 A;  3ZJT A;  2RMM A;  2XK5 A;  4ZRK A;  1XCT L;  5IAA C;  2FUH B;  3N20 C;  1FEH A;  1JW9 D;  2CHX A;  2LRW A;  1FNV A;  4NY0 A;  3ZIM A;  4B0E A;  1YN4 A;  1OTR B;  4A3P A;  4IUM B;  2O2V B;  2W55 A;  3B2G A;  4CO7 A;  1T0Y A;  1SB3 C;  2WXF A;  3R2T A;  3H7P B;  2HD5 B;  2MHJ A;  3H1U A;  4FHJ A;  4C80 A;  3AE8 B;  1E10 A;  1WMH B;  2AWT A;  5LNK 1;  1QQR A;  4XX5 A;  4WAA A;  4KZC A;  1RFK A;  3U7Z A;  3P1M A;  3DHH C;  2D10 A;  1P7F A;  3SHQ A;  3VR9 B;  1YOV B;  4USA A;  3NVZ A;  4MH8 A;  3QHT A;  1EF1 A;  3W5U B;  3EGR A;  3ALB A;  4HPL B;  4JGH B;  2N7D A;  2KDE B;  1OEY A;  1IPG A;  1UWX A;  2JX5 A;  4EFO A;  1HE8 A;  4LNN A;  1T3Q A;  3SDL C;  3O65 B;  3FKY A;  1E8W A;  1YJ1 A;  2WWZ A;  2CHZ A;  3FIL A;  2FCN A;  2BT6 A;  1SF0 A;  3BK1 A;  1WJ6 A;  2FNJ B;  2MQJ A;  3MTN B;  4A20 A;  1T0R C;  3ZJU A;  4JL9 A;  3B9J A;  4MH0 E;  2N9X A;  2K6D B;  1WJ4 A;  2FCS A;  1J8C A;  5D2M B;  1KJT A;  3RNE C;  3QX1 A;  4L2Y A;  4A90 A;  4MM3 B;  1FCL A;  1F2R I;  1PGB A;  2W3R A;  2D07 B;  3LJ3 A;  2KKC A;  3OG5 A;  1LO5 D;  3H8H A;  2WX1 A;  3ZNZ B;  1HA5 A;  3E56 A;  4G11 A;  2G1E A;  4FUL A;  5H8Y E;  1VZ7 A;  2GBM A;  3PV1 A;  2V3S A;  3LYY A;  3DOW A;  1WM2 A;  2NBW B;  4M00 A;  3RNC C;  2IY1 B;  1R4N I; 
#chains in the Genus database with same CATH homology
 2IO2 B;  3R3M A;  1QZE A;  1UZX B;  1M94 A;  4XC2 A;  3V6E B;  5TR5 A;  1Z2M A;  2MLB A;  3DBL I;  3NS8 A;  5DPT A;  2L05 A;  2XBB C;  4IWP A;  4BFR A;  2ZVN A;  4ICV A;  2N4F A;  2KVR A;  4IWQ A;  4JLC A;  2C7N B;  1P1A A;  2R2Q A;  4PYZ A;  2BYE A;  2LUE A;  2GMI C;  4TUU A;  3VH3 B;  2KX0 A;  2LXC A;  4GDL B;  3VFK A;  2IO1 B;  2RPQ A;  1KM7 A;  2NVU I;  3U30 A;  4WJO A;  1S3S G;  5IA7 A;  2RR9 A;  1GC6 A;  4B95 A;  4DDI D;  2KO3 A;  2HJ8 A;  3VXW A;  1TBE A;  3MHS D;  4K1R B;  4FAD A;  2ZNV C;  4W9K A;  4DXA B;  3CMM B;  3IVF A;  4G0N B;  4ASW C;  4WJQ A;  5KHO A;  1Y8R C;  2J0K A;  4BBN F;  5DPS A;  4HCP B;  1ZGU B;  2KQS A;  2L8J A;  4EUT A;  1ZKH A;  4HCN B;  2EMS A;  2N9P C;  2G4D B;  1V80 A;  3N32 A;  1SIF A;  5DPR A;  2K25 A;  3KUC B;  2LRU A;  4GDK A;  3CF6 E;  3QAQ A;  1X1M A;  2KJ6 A;  3VHT C;  4GIV A;  4BOZ B;  2MP2 A;  3R7Q A;  4NQK E;  4GN1 A;  4XZ4 A;  4AUQ C;  3APF A;  2EKE C;  1U4A A;  3EEC A;  4B6W A;  2GOW A;  4AOF A;  2V1Y A;  5DPW A;  2LGY A;  3PZD A;  2KWU B;  4KZ0 A;  4MGZ E;  4FBJ B;  3NZU A;  2UYZ B;  2I1J A;  2K8C A;  2NBV B;  3VTU A;  3ZTD A;  4W9E A;  4BKG A;  2VRR B;  3VH4 B;  3H7S A;  2L00 B;  2DHZ A;  2CHW A;  1NDD A;  3VAW A;  4IG7 B;  1RRB A;  4KVG B;  4WJN A;  2B3A A;  3KW5 B;  2WX0 A;  5LXH A;  1UEL A;  4NJ7 A;  2DYM A;  4BVU C;  2CU1 A;  3CST A;  1ZW7 A;  2KNB A;  4E71 A;  1ISN A;  1NBF C;  3EFU A;  2Z0E B;  5JHB A;  3OAW A;  4LJP B;  4HVB A;  1V81 A;  3KYD D;  4EZK A;  1L2N A;  4W9D A;  2DYO A;  3V61 A;  1IP9 A;  4AJW A;  4DWF A;  5L95 C;  1UBI A;  1WY8 A;  4OVV A;  4HPM B;  2KOX A;  4NAW A;  1TTN A;  3VTV A;  4DHJ D;  2JZ3 B;  2LJ5 A;  4I6N B;  3VDZ A;  4HDQ A;  2MBB B;  2C7H A;  4TV3 A;  4IM0 A;  4RM9 A;  3WAP A;  2C7M B;  3HM3 A;  4HK2 A;  2BPS A;  3DBS A;  4HJK A;  1V9J A;  2ZNV B;  3AUL A;  4W9C A;  3APC A;  3DVN V;  4URK A;  1GJZ A;  1YX6 B;  3U7D A;  3D32 A;  4EZL A;  3ZUN A;  3VVW B;  2LWP A;  2M4N A;  1I35 A;  3AI5 A;  2BKR B;  1LM8 B;  2NR2 A;  4TKN A;  5D94 A;  3NHE B;  2KX3 A;  2JRH A;  3KVF B;  2C5L C;  1WIA A;  4HLE A;  1WRD B;  3LDZ E;  3OLM D;  3CSF A;  4LDT D;  3ZW3 A;  2IO3 B;  2N1V A;  3TMP B;  2J0J A;  3PPA A;  2LGX A;  2WDT B;  4II3 B;  4II2 B;  1Q0W B;  2KXJ A;  3B08 A;  4ZDV A;  3X23 A;  4MDK E;  4ZRJ A;  2JUO A;  4FJY A;  4GB9 A;  3ZTC A;  3APD A;  4GXB A;  4W9I A;  3A9K A;  1EO6 A;  4G50 A;  4CYE A;  1WI0 A;  1EUV B;  2PE6 B;  4PS7 A;  2I1K A;  3RT3 B;  2N1W A;  3TJP A;  2IYD B;  4A3O A;  5CX3 A;  3PGE A;  1V5T A;  2RD0 A;  3ECI A;  1WZ0 A;  1E8X A;  2ZZP B;  1D3Z A;  2AL6 A;  3L17 A;  4IWO A;  1E7U A;  2NBU A;  2IZV B;  1AAR A;  4KV2 A;  3ZLZ A;  4LJO B;  3TBL D;  3W1Y A;  1WR6 E;  4IM3 A;  2JVC A;  5C1Z A;  1PQS A;  2LI5 A;  2J7Q B;  5CHF A;  4G3X B;  2ZJD A;  1Z5S B;  1WYW B;  2BKF A;  2IO0 B;  2JRI B;  2KFK B;  2REX A;  3PRP B;  4FHK A;  4X57 B;  3UF8 A;  3T8M A;  2R2O A;  2JT4 B;  3ML9 A;  3KH0 A;  3NY5 A;  1K8R B;  3QCA A;  5J17 A;  4J6I A;  1RLF A;  2ZPY A;  3PS6 A;  5E6N A;  1XT9 B;  1Q1O A;  1I42 A;  1C3T A;  2XK5 B;  2GBN A;  4W9F A;  2L0T A;  2FID A;  1VD2 A;  2RGF A;  4EOY A;  2KAN A;  4BKS D;  4IM2 A;  2JF5 A;  3WIM A;  4W9G A;  3M62 B;  3ZNG C;  1WX9 A;  3M63 B;  2BYV E;  2NPT B;  2KMA A;  2KJH B;  3RUI B;  3VUY A;  2M8S A;  2MBH A;  3PLU A;  4E74 A;  2MA9 B;  2KJR A;  3AXC A;  3B1L X;  3PHX B;  3PLV A;  4BKT A;  3JSV A;  5G2N A;  5E6O A;  1TZ1 A;  2PPH A;  3RCZ A;  3RZF A;  2O2V A;  3JW0 X;  2GBJ A;  4GDK B;  2N9E B;  1F9J A;  3H7P A;  2MSE D;  3ZKJ C;  2KC2 A;  3PSE B;  3QIJ A;  2CR5 A;  2KN5 A;  2RSU A;  1WM3 A;  4BKS A;  2MP2 B;  2KK8 A;  4DDG D;  2GBR A;  1WMH A;  3VUW A;  4ANV A;  1LFD A;  1NI2 A;  1H4R A;  3RYT A;  5AZF A;  4ICU A;  2NCN A;  2HE7 A;  2A4Z A;  2KC1 A;  1XD3 B;  5G55 A;  3DQV A;  5BO4 B;  1TGZ B;  3B0A A;  2KD0 A;  1E8Y A;  2MWS B;  2MRP A;  4PS3 A;  4JQW C;  2M17 A;  2KWC A;  3L08 A;  5LXI B;  1WZ3 A;  2PEA A;  3ONS A;  1YQB A;  2KWV B;  2M0X A;  3DDC B;  2N7E A;  3C0R B;  2J0M A;  1WE7 A;  3PHW B;  4PYU A;  2D11 A;  2O6V D;  2KMC A;  3K9P B;  3DBR I;  1SE9 A;  1WGR A;  3IHP C;  2IY0 B;  2MBO A;  3DBH I;  2ZCC A;  4K81 A;  1P98 A;  4P7I A;  2KTR A;  1GC7 A;  1WXM A;  4K7W A;  1WXA A;  3ML8 A;  3L16 A;  4NPN A;  1RAX A;  3QJZ A;  2BWF A;  1KOT A;  4MGY E;  3PRM B;  1A5R A;  4ANX A;  4NAW B;  2KTF A;  5J2R A;  1GNU A;  1WGH A;  1WXV A;  2AEH A;  5AEK B;  3H6N A;  1J19 A;  4DHZ B;  2YLM A;  3NOB A;  4F1S A;  1Q5W B;  3A9J B;  1E8Z A;  4KSL C;  3DVG Y;  3UIP B;  4EEW A;  2L3Z A;  2O6V A;  3ZRC A;  2BF8 B;  1JRU A;  3QAR A;  4M8N A;  2JWZ A;  4N9F 4;  1FXT B;  3PVL A;  2UWQ A;  2KDF B;  5CHW A;  3VQI A;  3JYU A;  2CS4 A;  3AU5 A;  3DVG X;  2FIF A;  3IG3 A;  2ASQ A;  2HTH A;  2YVC A;  4F7Z A;  1V6E A;  4AWJ A;  1YD8 U;  1WR1 A;  4DHJ B;  1WJN A;  2DAF A;  1UGM A;  2K39 A;  1WJU A;  2MW5 A;  3TCA A;  3ZNH B;  2BWE S;  3NZS A;  2K8B A;  1VCB A;  2IBI B;  4MEL A;  1WGY A;  4MM3 A;  4M8M A;  4W9L A;  3ZNI D;  1UBQ A;  3ZVV A;  5HKH A;  2V4L A;  5DCN A;  2LGD A;  2D3G A;  2JY6 A;  3PRZ A;  4GU2 A;  2M1M A;  5J18 A;  3A9K B;  3X0W A;  5KHQ A;  4AJY B;  1V86 A;  3WAM A;  4W9H A;  1IYF A;  5AZH A;  2AYO B;  2C9W B;  2LAS A;  3Q3F A;  4CHK A;  2KLC A;  4WWO A;  4KIK A;  3R7R A;  1LQB A;  2XEW A;  1WH3 A;  4KDL B;  2BYF A;  2EMT A;  3IBE A;  3PRE A;  4LDT B;  2KDB A;  4KDI C;  2KFJ A;  4M0W B;  1E7V A;  2G4S A;  3A1Q A;  4FN2 A;  3EC8 A;  3N30 A;  1P3Q U;  2DYB A;  3SU8 X;  4TQ0 A;  4WQO B;  3V60 A;  2G3Q B;  4NNJ B;  4MJS A;  3AU4 A;  3A33 B;  4HXD A;  1P9D U;  4NJ6 A;  2NS5 A;  3ZO5 B;  1YX5 B;  2DZI A;  1CMX B;  1V49 A;  4GOC A;  2JXX A;  1P0R A;  2KLG A;  1WFY A;  2DZM A;  1WF9 A;  3RUL A;  3H9D A;  4I6L B;  1WGD A;  5CTR C;  2DAJ A;  2OJR A;  3N3K B;  4HWI B;  4PS8 A;  4MEM A;  4NQL B;  3M95 A;  4B9K A;  1OQY A;  3SD5 A;  1H8C A;  1SGH A;  2OOB B;  1YIW A;  1V5O A;  2PJH A;  4GDL A;  3WAN A;  3WAL A;  2XK5 A;  3WAO A;  3UQB A;  4ZRK A;  3QWZ B;  2C60 A;  2Y5B B;  4MGI E;  5IAA C;  2FUH B;  2Z0D B;  3UIN B;  4BBN C;  4ANU A;  2LVQ A;  5EDS A;  1BT0 A;  2CHX A;  2LRW A;  4NY0 A;  3JSV B;  5GMV A;  3ZIM A;  2K6Q A;  1OTR B;  4A3P A;  2NPT A;  4IUM B;  2O2V B;  3V6C B;  5AZG A;  4K7S A;  4CO7 A;  1T0Y A;  2ZCB A;  3H7P B;  4KSK C;  2KZR A;  2HD5 B;  3H1U A;  4FHJ A;  3Q3J A;  4HDO A;  2DZK A;  4W9J A;  1GUA B;  1WMH B;  2AWT A;  1S1Q B;  3DPD A;  3ZDT A;  3L13 A;  3U8Z A;  1MG8 A;  2GBK A;  4WWN A;  4MSM B;  3PTF C;  3L54 A;  3UQA A;  5LLI A;  4FLH A;  1E5W A;  4XX5 A;  4ZYN A;  4WAA A;  2QHO A;  4KZC A;  4WWP A;  5CHV C;  4EZJ A;  2MBQ A;  3VTW A;  1WX8 A;  1GG3 A;  2AL3 A;  2D2Q A;  4F8C B;  3DCG A;  2D10 A;  4DHZ E;  5JH5 C;  4WJP A;  3SHQ A;  2LVP A;  3A4R A;  3KUD B;  1L7Y A;  3QHT A;  1EF1 A;  3QK0 A;  4GMV A;  3TL5 A;  3ALB A;  2MBE A;  3V62 A;  2A5U A;  4HPL B;  4YL8 A;  3W1S A;  3OJ3 A;  5L83 A;  4JGH B;  2N7D A;  2KDE B;  2KDI A;  3P2B A;  2L76 A;  4OVU A;  2KTR B;  2FCQ A;  1OEY A;  1IPG A;  1EF5 A;  3HHM A;  4EFO A;  2Z59 B;  1HE8 A;  3S2A A;  3RZW C;  3HIZ A;  4AP4 C;  2DZJ A;  1RFA A;  3OJ4 B;  2FAZ A;  3O65 B;  5D7G A;  3SDL C;  3K9O B;  3BY4 B;  3GZN I;  1E8W A;  1YJ1 A;  2KQ7 A;  1E90 A;  3HK0 A;  3TIX A;  2WWZ A;  2CHZ A;  1KLV A;  3GOE A;  2FCN A;  2LD9 A;  4BOS C;  1V2Y A;  1C1Y B;  1J0G A;  2K1F A;  4E3C A;  1XQQ A;  1WJ6 A;  3ZDM C;  2FNJ B;  3KYC D;  3ZRF A;  1WXS A;  2MX2 A;  2MQJ A;  2O6V B;  3QA8 A;  3MTN B;  4A20 A;  2JZZ A;  4MGK E;  1WE6 A;  1OEY J;  4JL9 A;  4MH0 E;  3A9J A;  3R66 C;  4DK5 A;  1WX7 A;  2WYQ A;  2N9X A;  3A4S C;  3RD2 A;  4ANW A;  2K6D B;  4FJV B;  5JHA A;  3EHV A;  2W9N A;  4MSQ B;  1WJ4 A;  3WA0 A;  1UD7 A;  2FCS A;  2FCM A;  1J8C A;  1LXD A;  5C23 A;  2KHW B;  5D2M B;  5D6J B;  1KJT A;  2DX5 B;  1G6J A;  3L10 B;  4ZRI A;  2G45 B;  2L7R A;  3QX1 A;  2CKH B;  5E6P A;  2PE9 A;  4GSW A;  4IW0 A;  4GGQ A;  2D07 B;  3LJ3 A;  4K7U A;  4RMA A;  2ZVO A;  4TQ1 A;  4DBG A;  1WGG A;  2KKC A;  3QC8 B;  2L0F A;  2ZEQ A;  2LVO A;  1OGW A;  2DEN B;  3L0W B;  3VUX A;  5FR6 A;  4I6P A;  4KIK B;  2MCN B;  3KUZ A;  3M3J A;  2WX1 A;  3QQ8 B;  1R4M I;  3ZNZ B;  4FA6 A;  4EKU A;  3BIN A;  4RM8 A;  2LXA A;  4G11 A;  4JIO U;  4FUL A;  3IFW B;  2ZPN A;  3I3T B;  3A1Q B;  3HM6 X;  3JVZ X;  4IC7 B;  2GBM A;  4LCD E;  3PV1 A;  2K8H A;  2V3S A;  1UH6 A;  3T9L A;  3MJW A;  2JPH A;  4MJS B;  2BGF A;  2LZ6 A;  3DOW A;  3UGB B;  5JZE B;  3UIO B;  3DVN U;  3PT2 B;  4FJZ A;  3W1S C;  1WM2 A;  2KFK A;  2NBW B;  2IY1 B;  3ENE A;  1R4N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...