1V5OA

Solution structure of the ubiquitin-like domain from mouse hypothetical 1700011n24rik protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GSSGSSGMLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDNVGLRTPGRTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1700011N24Rik protein
publication title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 1700011N24Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v5oA00
3OAWA 4W9HA 2MBEA 2OJRA 3QARA 2JT4B 2N7DA 3L54A 4MGIE 2J0JA 3A9KB 5GMVA 3VTVA 4LCDE 1A5RA 5DCNA 3TCAA 2GBRA 3VXWA 4KIKA 2W9NA 4FHKA 4BBNC 3ZRCA 3PLVA 4AOFA 2MCNB 3R7QA 3ZDTA 4IG7B 2MLBA 3BINA 4DHJD 1GNUA 2GBJA 4N9F4 3DCGA 2FCMA 4IUMB 1J0GA 4ZYNA 2KX3A 1UELA 3NOBA 2DYMA 3RT3B 1SGHA 2NS5A 2CU1A 4BOSC 3H1UA 1E8ZA 4RM9A 5FR6A 3KW5B 3CSTA 4MJSB 3VHTC 2REXA 4MELA 4MGYE 2AEHA 2RPQA 1HE8A 4W9KA 3PLUA 2MP2B 1L2NA 3KUDB 4IWQA 3ZNHB 2XEWA 4G0NB 3DVGX 3PS6A 3HHMA 2FCSA 2NBUA 2PE9A 4NJ7A 5J17A 5KHQA 3IG3A 2K1FA 2FNJB 3ALBA 3UQAA 2D3GA 1C1YB 2KVRA 1WRDB 4OVVA 4MEMA 2KC1A 3TIXA 3VUWA 1WYWB 4WJQA 4BOZB 3UINB 4EZLA 1UBIA 1CMXB 2C60A 3BY4B 3KYCD 3ZKJC 1SE9A 4XC2A 3SD5A 3QX1A 3PPAA 3W1YA 1YX5B 4HCPB 2D10A 4JL9A 3C0RB 4GSWA 2MW5A 2CS4A 2KWCA 3DVGY 4WWPA 2KDIA 5JHAA 2DZMA 3HM3A 2XK5A 3PV1A 4AUQC 3DBSA 4II3B 3V62A 1WFYA 2C7NB 2NR2A 2ZEQA 3PZDA 3VH4B 2PEAA 3Q3FA 2L7RA 4DK5A 4CYEA 2LJ5A 1WJ6A 3N3KB 2I1KA 2AYOB 4A20A 5AZHA 4K81A 1TGZB 2D07B 3QIJA 2JY6A 4W9EA 5E6PA 5G55A 1SIFA 3DBHI 2HE7A 3QA8A 2BGFA 2KKCA 4FJVB 2K8CA 3PHXB 1E7UA 4TQ0A 3IVFA 3ZNGC 4YL8A 1UZXB 2V1YA 3ML8A 2NVUI 4G50A 2O6VA 2KWUB 1TTNA 2JRHA 3PT2B 3ZTDA 2DZKA 1C3TA 1P1AA 3IHPC 2KXJA 3H6NA 1S3SG 2N9XA 4TKNA 4WJOA 3U7DA 3SHQA 2ZCCA 2A5UA 3T8MA 2K25A 4GDKA 4X57B 3PRMB 5DPWA 3MJWA 4KSKC 2FIFA 1KOTA 2FCNA 3ECIA 2L3ZA 2DAFA 2A4ZA 3TJPA 4GGQA 3VUXA 1PQSA 1XD3B 2CHXA 1D3ZA 3H7SA 4NQKE 4ANUA 3L16A 4ZRIA 1WM2A 1WI0A 3A4RA 1V80A 1E5WA 3DVNV 4IC7B 2KLGA 4IM3A 2OOBB 4GB9A 5J2RA 2MBOA 1WJNA 1ISNA 4B95A 2D2QA 1V86A 1WIAA 5D2MB 4ANWA 3SDLC 2NPTB 4NNJB 4A3PA 3RZFA 2J0MA 2G3QB 5LXHA 2AWTA 1NBFC 2KDFB 4JGHB 4FADA 2FIDA 3X0WA 4DDGD 1V9JA 1V2YA 2KHWB 2PJHA 3DQVA 4HPMB 3ENEA 4F8CB 3EHVA 2KLCA 3JSVB 3OJ4B 5LXIB 1WGYA 4DXAB 4KZ0A 4I6NB 4NJ6A 2MP2A 2KFKB 3DBRI 2ASQA 1OTRB 3IFWB 4NAWA 4WWOA 2ZVOA 1J8CA 4PYZA 3M3JA 3H7PA 2LGXA 3ZUNA 4MH0E 3VAWA 1P0RA 1KJTA 2N4FA 1K8RB 4HLEA 1F9JA 2GOWA 2K39A 4EUTA 2KTFA 1R4MI 2DZJA 2I1JA 3A1QB 3JVZX 4MDKE 5JZEB 4AP4C 2Y5BB 2IO1B 2K6DB 2KX0A 2BYVE 2VRRB 4BKSD 1IPGA 4WJNA 1V5OA 2LVOA 3HK0A 2K8HA 1LM8B 3A9JB 3M63B 3NZUA 3RULA 3UIPB 2J7QB 2KTRB 5BO4B 3WALA 2M1MA 3EC8A 1I42A 1WXAA 1OQYA 1KLVA 2DX5B 4GIVA 3R7RA 2BYFA 3EFUA 1YQBA 2BYEA 2ZPYA 2WYQA 3VDZA 2BWFA 1UH6A 2GBMA 3NHEB 3KUCB 4ICVA 3AI5A 2MBQA 3MTNB 4ICUA 1WXMA 2HTHA 4WAAA 2O2VB 2RSUA 4K1RB 4P7IA 2JZZA 4M0WB 4RMAA 2JUOA 3QCAA 3UQBA 2LASA 4EOYA 3AU4A 3VTUA 3VVWB 2V3SA 2L76A 2KK8A 2LWPA 5TR5A 4G3XB 1EF5A 4KSLC 3S2AA 1TBEA 1VCBA 1GG3A 1GC7A 4BBNF 1Q5WB 2KOXA 2L8JA 2ZZPB 3L13A 4E3CA 4ZDVA 1S1QB 4TV3A 4BFRA 4EZJA 2MRPA 2KFJA 3I3TB 1YIWA 4F7ZA 1I35A 1Q1OA 3WANA 4TUUA 1LFDA 4KIKB 2WX1A 3B0AA 4HVBA 2JPHA 2FCQA 2KWVB 1YJ1A 5JHBA 3DPDA 2JZ3B 2L0TA 2M4NA 1L7YA 2KZRA 2DYBA 2Z0EB 4EKUA 3WIMA 2DYOA 2C7MB 4KZCA 2KC2A 3QJZA 4G11A 3PTFC 2KN5A 3VQIA 2KNBA 5LLIA 3N30A 3ZVVA 2FAZA 2CR5A 4I6PA 1E90A 2WDTB 1UD7A 3QAQA 3R66C 4BVUC 2ZPNA 4CHKA 2DZIA 1WR1A 1KM7A 2BKFA 4FJZA 5DPTA 4AWJA 4KDIC 3KYDD 4K7SA 3IBEA 1Z5SB 2FUHB 1WXVA 2N1VA 1LQBA 3GOEA 2BF8B 3APDA 2XBBC 3HIZA 3L17A 4NQLB 3K9PB 4RM8A 1IYFA 2D11A 2KQSA 3U8ZA 4GDLB 3CMMB 2BWES 2DHZA 3MHSD 3T9LA 4DHZE 3N32A 3ZLZA 2NPTA 3W1SC 4KDLB 2GMIC 4HK2A 2KANA 2KDBA 1E7VA 3V6EB 4W9CA 1V5TA 1WGHA 3NY5A 4DHZB 4E74A 4W9FA 1M94A 1EUVB 4FA6A 1RAXA 5D6JB 3ZO5B 1AARA 2WWZA 4K7WA 3UF8A 1R4NI 1TZ1A 1GJZA 2DENB 4DWFA 1QZEA 3A9KA 2M0XA 4JLCA 3PRZA 1V49A 4HJKA 3X23A 4KVGB 2KJRA 4W9DA 3V6CB 2KD0A 2N9PC 3RUIB 1WR6E 3CSFA 3PSEB 5EDSA 3RZWC 3M62B 4AJWA 3VFKA 2LGYA 3RYTA 2HD5B 2MBHA 3LJ3A 1E8XA 4FLHA 1JRUA 4ASWC 3ZIMA 3WAMA 4MSQB 4MSMB 5D94A 1GC6A 3ZNZB 2AL6A 4PS3A 2LRUA 4JIOU 3PREA 2G45B 4MJSA 2KTRA 2NBWB 4HXDA 1V81A 3ML9A 4GOCA 3GZNI 4KV2A 4MGZE 2LVQA 2KO3A 3UGBB 4CO7A 5L83A 2CHZA 2G4SA 5CX3A 4EEWA 1YD8U 2MBBB 2RD0A 2MSED 3U30A 3APCA 4HDQA 3AXCA 4NY0A 3VUYA 2O2VA 4PS8A 3HM6X 4EFOA 3D32A 2KJ6A 1XT9B 2UYZB 3NS8A 3QK0A 5CHWA 3OJ3A 2CHWA 4MM3A 3P2BA 4XX5A 2IO0B 2LUEA 2Z59B 1FXTB 2BPSA 2LRWA 1WGRA 4GDKB 3ZRFA 3DVNU 2JVCA 1WF9A 2IO2B 3A4SC 4E71A 3AULA 3QC8B 1WJUA 4GN1A 5D7GA 3V61A 4MGKE 2LGDA 1WX9A 4GU2A 4IWOA 5AEKB 2MQJA 4PYUA 1EF1A 4PS7A 4F1SA 4LJOB 5JH5C 1WMHB 2L0FA 3WAPA 3PVLA 4HDOA 4K7UA 4LDTB 4AJYB 2KMCA 5CHFA 1WZ3A 5J18A 4TQ1A 3ZDMC 2LI5A 2LVPA 4IW0A 2ZJDA 2Z0DB 4IM0A 2EMSA 3VH3B 4IM2A 3B08A 3KVFB 2JRIB 2B3AA 3L08A 1J19A 2ZNVB 4HPLB 1UGMA 1WE7A 2K8BA 4ZRJA 2IBIB 3RD2A 4A3OA 4FJYA 3QWZB 4HWIB 4EZKA 2J0KA 5DPSA 3PRPB 2AL3A 2ZVNA 4FN2A 2M17A 4W9JA 2M8SA 5DPRA 3RCZA 1IP9A 1NI2A 2YLMA 4W9GA 4NPNA 1WXSA 5AZGA 4NAWB 5CTRC 2JWZA 3A33B 1MG8A 4B6WA 4BKSA 4DBGA 3WA0A 1T0YA 3H7PB 4B9KA 3LDZE 2C7HA 2G4DB 2NBVB 2R2OA 1WJ4A 1P98A 2K6QA 3TBLD 1VD2A 4GDLA 2KMAA 1UBQA 4BKGA 2MA9B 4M8NA 4OVUA 5G2NA 1U4AA 1YX6B 4ANXA 2LZ6A 3QHTA 2BKRB 3VTWA 1XQQA 3QQ8B 3SU8X 1OGWA 1E8YA 4WJPA 5HKHA 1RLFA 2O6VD 5C23A 3JW0X 4ANVA 1RFAA 2IYDB 4I6LB 2EKEC 3V60A 2NCNA 2N7EA 3R3MA 1OEYA 2IO3B 3H9DA 3B1LX 3M95A 1WY8A 3CF6E 4WQOB 5E6NA 3NZSA 2MX2A 1X1MA 4FULA 2CKHB 3ZW3A 1NDDA 2QHOA 3APFA 1RRBA 4FHJA 4W9LA 4XZ4A 4DHJB 1P9DU 1WX8A 3Q3JA 1E8WA 1P3QU 2L00B 4LDTD 2C9WB 2RGFA 3JSVA 2UWQA 3TL5A 3O65B 2PE6B 1EO6A 4GXBA 2KFKA 4J6IA 4DDID 2ZNVC 3KH0A 3ONSA 3ZNID 1G6JA 3OLMD 2EMTA 2N9EB 2DAJA 5CHVC 1ZKHA 1H8CA 2WX0A 3L10B 4URKA 2GBKA 2JF5A 2XK5B 1OEYJ 2L05A 3JYUA 1ZGUB 4ZRKA 3A1QA 5IAAC 2GBNA 4II2B 3PGEA 2YVCA 4LJPB 3K9OB 1Q0WB 3L0WB 2IY1B 1V6EA 2PPHA 1WH3A 3ZTCA 2HJ8A 1WE6A 1Z2MA 2IZVB 1BT0A 3A9JA 4GMVA 2N1WA 3W1SA 3TMPB 2LD9A 1LXDA 2KQ7A 5E6OA 1WMHA 4M8MA 2R2QA 1WM3A 1Y8RC 3DOWA 3PHWB 2V4LA 3EECA 3KUZA 5IA7A 3DDCB 2O6VB 2KJHB 5L95C 3DBLI 4WWNA 4HCNB 1H4RA 5KHOA 1WX7A 2JXXA 3WAOA 4JQWC 1WZ0A 5C1ZA 2ZCBA 2KDEB 1WGDA 5AZFA 4IWPA 4W9IA 4BKTA 2MWSB 1ZW7A 2IY0B 3AU5A 3UIOB 2C5LC 2RR9A 1GUAB 4FBJB 1WGGA 2LXAA 2LXCA
chains in the Genus database with same CATH superfamily
3OAWA 4RH6A 2OJRA 4C4VA 2N7DA 5GMVA 3A9KB 3GZNB 3I57A 1MHXA 4KIKA 4FHKA 2AX5A 4IG7B 2MLBA 3BINA 3AECB 1J0GA 2KX3A 4M02A 4BOSC 3BYTB 5FR6A 3CSTA 2IGHA 4MGYE 2R61A 4ZRPA 3BVZA 2MP2B 4IWQA 1YN4A 2NBUA 2PE9A 2V3NA 5J17A 4HJGE 2D3GA 5D3IB 1WRDB 2DWQA 3TIXA 3VUWA 1PGBA 1XXGA 3BY4B 4JE3B 3AMZA 3BWUD 3U2SC 1L4ZB 2CS4A 2NTTA 4WWPA 5JHAA 3HM3A 2XK5A 2XNAC 4II3B 2C7NB 2JU6X 1HTOA 3PZ8A 4KKJA 1F2RC 1Y56A 2L7RA 4CYEA 1WJ6A 4HEA1 2I1KA 2AYOB 2NTSA 1SIFA 4WH4A 1XF5L 2K8CA 2HJ1A 1E7UA 3PHXB 4TQ0A 3I5JC 3P4RB 1UZXB 1SSNA 4G50A 4B0MA 2BW2A 2JRHA 1L6VA 3PT2B 2KXJA 4JWUC 4WJOA 4GDKA 4X57B 3ZJUA 3MJWA 2ICIA 4KSKC 1C76A 3TJPA 1I4QA 3H7SA 1V8CA 1WM2A 1V80A 4IM3A 4GB9A 4YSYB 2MBOA 2D2QA 2BS2B 3SDLC 2NPTB 4JPSA 4A3PA 1K50A 2AWTA 1JWBD 1ZOYB 4FADA 4HPMB 3ENEA 3OJ4B 2BTEA 1WGYA 3R2TA 4I6NB 4NJ6A 3B9JA 1CQVA 3M3JA 2X8XX 1DYQA 5MPOA 4US9A 2N4FA 1F9JA 3DBLB 3Q8AA 1FFUA 3NVYA 3TEXA 3Q8FA 3W5VB 2AQ2B 1IPGA 4WJNA 4J3OD 2LVOA 3NZUA 4XGAB 3RULA 2J7QB 3WALA 2M1MA 3CIRB 2DX5B 2BYFA 3ZJTA 3VDZA 4A6QA 2ZW1A 3KUCB 3AI5A 3MTNB 4ICUA 1WXMA 3AEFB 1R7SA 4LNIA 5C3JB 4P7IA 2JUOA 2JXTA 4EOYA 2KK8A 2LWPA 4G3XB 2TSSA 1GG3A 1Q5WB 3KWLA 2L8JA 1FCCC 1S1QB 4MH8A 4ZDVA 1Q1OA 4TUUA 3DHIC 4HVBA 3L4PA 3BYYB 2D3BA 2M4NA 2C7MB 4JX1C 3BVGA 5BMGA 2KNBA 2J4XA 5DPTA 1EU4A 1UUPA 3IBEA 1Z5SB 4NQLB 1UNSA 2XBBC 4RCOA 3K9PB 4O1NA 1IYFA 1CZPA 2D11A 3IT6B 1HZ5A 3U8ZA 3UI3A 1AW7A 3J9CA 2B76B 3CMMB 2DHZA 3ZLZA 3W1SC 5IP4D 5H8YE 4W9CA 4OZCA 1V5TA 1WGHA 3IAS1 1BXTA 1TZOA 2MH7A 1FFVA 3AEEB 2Y5CA 3A9KA 2M0XA 4N6EB 4HJKA 2KJRA 3AH7A 3CSFA 3RZWC 4ARIA 3RYTA 2HD5B 2JX5A 3BIID 3U7ZA 1FEHA 3DHGC 2V3PA 2G45B 2KTRA 2NBWB 4HXDA 3ML9A 5EE9A 3GZNI 4KV2A 3UGBB 1CJEA 2MBBB 2MSED 3AXCA 3VUYA 3HM6X 1AWDA 3OJ3A 2IO0B 2E6XA 2RDGA 1FXTB 1L0VB 2BPSA 2LRWA 1JRPA 2JVCA 2IO2B 2OEDA 2WXOA 4GN1A 2LGDA 1WX9A 1QOBA 3B2GA 4PS7A 4F1SA 3I63C 2LGSA 2L0FA 4AJYB 5CHFA 1WZ3A 3R2IA 2JRIB 3L08A 1D4BA 1OQQA 1ET6A 4FJYA 2BVCA 3TEWA 2AQ1B 4WURA 3RCZA 2YLMA 1TJEA 2L32A 1T0RC 1WXSA 3MJ5A 4NAWB 2WXFA 4B6WA 4C4VB 3WA0A 1T0YA 1PYWD 2VZKB 4USAA 2R2OA 1F77A 2K6QA 1UBQA 4BKGA 3KWVA 4OVUA 2MJEA 3P4QB 2Z8LA 2BKRB 2UU7A 3VTWA 2BQQA 3HVDA 4L1BA 2E3TA 1E8YA 1N6ZA 1K53A 2EKEC 2Q5WD 1AYFA 2N7EA 3PO0A 1OFFA 2CU3A 3NZSA 4FULA 4ZYSA 2CKHB 1QQRA 3KLSX 4KGSA 4FHJA 2MHJA 4DHJB 2L00B 2W55A 2CJOA 3VRBB 2DLBA 3ZNID 3MC0B 2N9EB 5CHVC 1ZKHA 1FO4A 1N60A 3TEYA 2GBKA 3GB1A 2XK5B 1L0XB 5IAAC 2YVCA 3L0WB 2DNFA 1WYGA 1C77A 4WWMA 1WE6A 2IZVB 2LHDA 4GMVA 2N1WA 3NJTA 2KQ7A 2M56B 1Y8RC 3RMKC 2WLBA 3NG0A 5BYRA 3DBLI 4WWNA 2ZCBA 2KDEB 5AZFA 1KF6B 2MWSB 3P4SB 2K22A 2WXRA 3AU5A 2C5LC 3IAM1 1WGGA 2LXCA 2IGDA 4MGIE 3VTVA 4LCDE 3TCAA 1M4VA 4N58A 3VXWA 2W9NA 3PLVA 3R7QA 3ZDTA 2BB6A 4DHJD 1UF0A 2FCMA 5LNK1 2CU1A 1V1PA 3H1UA 1E8ZA 3SR6A 4CQNA 4MJSB 4MELA 2WS3B 1HQRD 1TKYA 2YEPB 4W9KA 1T0SC 3NVZA 1UWXA 2QMTA 3KUDB 3ZNHB 3PS6A 3HHMA 2FCSA 5KHQA 2FBWB 2KVRA 4MEMA 2KC1A 1TT5B 4P6VF 4WJQA 1MI0A 1C79A 4EZLA 3ZKJC 1SE9A 2SEBD 1UGJA 2WP9B 1DOYA 2D10A 4JL9A 4S17A 2MW5A 4YWGG 2WXPA 2KDIA 1I4XA 4AUQC 3V62A 2JYEA 5C2TB 1SIJA 1E10A 1OQRA 2NR2A 3PZDA 1WGKA 3Q3FA 4DK5A 4YXDB 2VH2A 4A20A 3N9YC 1VZ8A 2IGGA 2WXLA 4K81A 3ZQ4A 2JY6A 5G55A 3BVMA 1L4DB 5IN7A 4WAFA 4FJVB 2NVUI 1WXQA 2ZW0A 4XDDA 4RGTA 1C9FA 1C3TA 3IHPC 1FMAD 3H6NA 3U7DA 3H8HA 2A5UA 5DPWA 1ENFA 2FIFA 4YTPB 3ECIA 2L3ZA 2RDHA 2A4ZA 3VUXA 1PQSA 1XD3B 5D3DA 3L16A 2QC8A 1WI0A 1QF6A 2OOBB 1A70A 1FNUA 3C8YA 5J2RA 4B95A 1V86A 3RZFA 3X0WA 4ZHPA 1V9JA 2KHWB 2PJHA 4F8CB 3JSVB 3SFDB 1NYRA 4DXAB 3NUHB 1JMLA 4NAWA 1J8CA 3DBRI 2ASQA 1OTRB 3IFWB 2ZVOA 4PYZA 4MACA 3Q8BA 5HFYA 3RI7C 4MH0E 1P0RA 2D5GA 1DOIA 4HLEA 4EUTA 4R3DA 4K3CA 2I1JA 2LJIA 5FKAC 3AEBB 3HK0A 2K8HA 3A9JB 1TS2A 3HVZA 2KTRB 2KDMA 2PVOD 1OQYA 1KLVA 1JQ4A 4GIVA 1XLNA 1N5WA 3KQ4A 1UH6A 2MBQA 2HTHA 4WAAA 2RSUA 4RGMA 1FXIA 2JZZA 4M0WB 3QCAA 5BYQA 3VVWB 2L76A 3CWIA 4KSLC 1XLPA 3ABVB 1VCBA 1AN8A 4BBNF 3O13A 3L13A 3AE7B 4E3CA 4BFRA 4F7ZA 2IJ0A 1IGDA 3B0AA 1XLOA 2KWVB 3DPDA 4HKZE 3EUB2 2KZRA 2Z0EB 2D3CA 1WRIA 3WIMA 2DYOA 4KZCA 2W54A 3PTFC 4A9AA 3VQIA 2LMCA 2FAZA 1YNTE 1E90A 2FUG1 3QAQA 4HRSA 3R66C 4BVUC 4CHKA 5E6JA 2DZIA 1WR1A 2BKFA 1YMHE 3BK2A 4K7SA 2FUHB 2N1VA 3HIZA 2BF8B 1FNVA 3APDA 3SEBA 4ZRQA 2BWES 3T9LA 2GB1A 4KDLB 2GMIC 2WU5B 4RF1A 3IT4B 1T5XD 1J7BA 4DHZB 4W9FA 2CJNA 1M94A 2LHEA 1AARA 2KYWA 2WWZA 3UF8A 1TZ1A 1GJZA 2DENB 4DWFA 1QZEA 4JLCA 1C78A 3PRZA 1V49A 2KQ4X 2PLPA 4ZOHC 2N9PC 2GRIA 1SF0A 5EDSA 4YTMB 2LGYA 1E8XA 4C80A 4ASWC 4KGRA 4MSQB 2LRUA 4MJSA 4XYCA 3N1YC 3FILB 1JALA 4L2YA 5L83A 4MGZE 2YEPF 2CHZA 1KTKA 1YD8U 3U30A 4HDQA 4NY0A 4TMAB 4EFOA 2O2VA 3D32A 5FK9C 1K51A 1XT9B 3QK0A 2CHWA 2I38A 3P2BA 1IBXB 4C7YA 1FRDA 3AULA 3QC8B 1WJUA 3RNCC 4US8A 4GU2A 4IWOA 2HDEA 2MQJA 1F52A 4LJOB 5HHDG 5JH5C 4K7UA 4HDOA 5J18A 3ZDMC 1KFYB 2ZJDA 4IM0A 1SEBD 1GPXA 3VH3B 4A55A 4IM2A 3B08A 3KVFB 2B3AA 4OVZA 2ZNVB 1UGMA 4ZRJA 3E56A 4EZKA 2DBYA 5DPSA 2G1EA 3VR9B 2ZVNA 2M8SA 2H88B 2JWZA 3A33B 1MG8A 2GLSA 4B9KA 4OZBA 1PDXA 1VD2A 1WSPA 4GDLA 5BMHA 4M8NA 3NZ3A 4AQ7A 4XWTA 3OG5A 3FC4A 2IDYA 1XQQA 3QQ8B 1V1PB 3ZJVA 1MVKA 4DXGA 4OHJA 4ANVA 3R3MA 1OEYA 3H9DA 1VDVA 4H2AA 1RRBA 3LXFA 4W9LA 3W2DA 1P9DU 2RGFA 3JSVA 2PIAA 2PE6B 2M19A 1EO6A 2V4IB 4RGOS 2BB5A 3KH0A 2WGSA 1G6JA 3OLMD 3EGRA 1QT9A 4NJCA 2JF5A 4ZRKA 2PVGC 1HEZE 3K9OB 4N59A 2I2YA 1NYQA 2WQYB 1BT0A 3A9JA 1QLBB 3NVVA 4M8MA 1E0ZA 3PHWB 3KUZA 1ZDXA 1YN3A 3DDCB 4YSZB 4XE0A 3W5UB 4HCNB 4JQWC 4M0WA 1PGXA 1WGDA 2V9HA 4IOIE 3V3XA 1ZW7A 2WHIA 3UIOB 1FRRA 1WGRA 2LXAA 4ITKA 1N61A 2MBEA 4W9HA 3QARA 2JT4B 3L54A 2J0JA 3DBRB 1I4HA 1A5RA 2GBRA 4M01A 3ZRCA 4AOFA 1NEKB 1VZ6A 1N63A 1EM7A 5BYSA 4AS1A 1GNUA 1JWAD 3DCGA 4IUMB 1SE4A 3NOBA 2DYMA 1SGHA 4D2KA 2X38A 3RNFC 3KW5B 1TS4A 3VHTC 2FE8A 4IKGA 1HE8A 2JYTA 3PLUA 2MJ3A 3DVGX 4NJ7A 2KT7A 2K3UA 3IG3A 1NVID 5IOIA 2FNJB 3ALBA 2BT6A 4OVVA 4LNNA 1ET9A 3UINB 2C60A 3KYCD 4XC2A 2Y3AA 1ZPSA 3Q14C 3QX1A 3PPAA 3W1YA 1QOAA 3C0RB 5EE1A 4RGNA 3AM9A 4M00A 1YOVB 1WFYA 2WXJA 2ZEQA 2PEAA 5AZHA 3QIJA 4BZAA 5E6PA 2WXMA 2BGFA 3FILA 3MC8A 2H89B 3IVFA 3ZNGC 4YL8A 2V1YA 2GI9A 2LEKA 3AEAB 3ZTDA 2DZKA 2N9LA 1IBXA 1S3SG 2N9XA 1FXAA 3SHQA 3ZGZA 3I9V1 1PGAA 3PRMB 4C00A 1TYGB 2FCNA 2DAFA 3TSSA 2CHXA 1D3ZA 3AEDB 3NRZA 1SBBB 2D3AA 1IGCA 2LFIA 1L0YB 1ISNA 1JW9D 1MFWA 1F1HA 1E9MA 4NNJB 4KX6B 2G3QB 2KDFB 4JGHB 1KLGD 5EE0A 4DDGD 4EE2A 3DQVA 2JSVX 2KLCA 2W3SA 5LXIB 4WWOA 2L52A 2LGXA 1TKEA 4KKIA 3ZXRA 2HTME 3VAWA 1KJTA 2KTFA 1RWSA 5JZEB 1VRAB 2Y5BB 2KX0A 4BKSD 2QDFA 3RN9C 1V5OA 1C4AA 1LM8B 2N0SB 3UIPB 5BO4B 3EC8A 1I42A 1WXAA 1YQBA 2ACZB 2BYEA 2ZPYA 2WYQA 2BWFA 3NHEB 2GBMA 1BUIC 2O2VB 4XDCA 3UQBA 2JZPA 2V3SA 4KGTA 5TR5A 1DGJA 3GP7A 1TBEA 3Q69A 2KAJA 2KOXA 2ZZPB 2KACA 4TV3A 3I3TB 2KFJA 1SE3A 2WXQA 1I35A 1D6EC 5T8IA 3WANA 4LLGM 1QOGA 1EU3A 1TS3A 1VLBA 2KVZA 3Q3MC 2JPHA 3WCQA 5JHBA 2L0TA 3AEGB 1SE2A 3QJZA 4G11A 2KN5A 3ZVVA 5LLIA 3N30A 1J7AA 1MJDA 3RNBC 3LYYA 4FJZA 3KYDD 3GOEA 3NVWA 3L17A 1LQBA 2INPE 1GOZA 2QJLA 3IXSA 2KQSA 4GDLB 4DQOC 3MHSD 4DHZE 4HK2A 3V6EB 2K5PA 2EELA 4E74A 1ZP0B 1BMLC 1E6EB 4FA6A 1RAXA 1E7PB 5D6JB 3ZO5B 3U52E 1R4NI 2WDRB 3X23A 4KVGB 3P1MA 1FIQA 1WR6E 1YQ3B 4AJWA 1FM0D 2WXHA 2MBHA 4FLHA 3ZIMA 4MSMB 3ZNZB 5D94A 2BS4B 3ETRA 1L6UA 4JIOU 3PREA 1QKZA 2AQ3B 1V81A 1L5PA 2QIEB 1F2RI 2LVQA 4PK1A 4CO7A 5CX3A 2RD0A 3APCA 3Q2AC 2KJ6A 3NS8A 5G5HA 4YSXB 4A90A 2Z59B 3ZRFA 1WF9A 3A4SC 4E71A 3V61A 4P1BC 2JQRB 2N7JA 5AEKB 4PYUA 1EF1A 3P42A 1P7EA 2KMMA 1I4GA 1ZE3D 4TQ1A 4IW0A 2LVPA 2Z0DB 2EMSA 1XO3A 4HPLB 3RD2A 1WE7A 4MT5A 1R4MB 4A3OA 3QWZB 3DWMA 3AE6B 1IP9A 5DPRA 2M17A 1HA5A 4W9JA 1FNWA 4W9GA 4NPNA 1GB1A 3RNGC 4BKSA 4DBGA 3H7PB 2C7HA 1JROA 1ACCA 2KMAA 4OZAA 1VR9A 1RM6C 1U4AA 2K0PA 1YN5A 4OW0A 3SU8X 1XEEA 4C7ZA 5HKHA 1RLFA 2O6VD 5C23A 2IYDB 2QEJC 2WXKA 2IO3B 3B1LX 4WQOB 3V05A 3B2FA 1MHHE 2MX2A 1X1MA 3AE3B 1DOXA 1NDDA 2QHOA 3APFA 2J52A 5IO9A 2MJDA 5AUKA 1P3QU 2WU2B 4BAXA 2C9WB 3TL5A 1N62A 3NS1A 4P1CC 1VZ7A 4GXBA 4J6IA 4DDID 3ONSA 2EMTA 2DAJA 1T3QA 1H8CA 1I4PA 3L10B 1IUEA 3AN1A 2L05A 4LJPB 2IY1B 1V6EA 2PPHA 1WH3A 3AE4B 3ZTCA 3RPFC 1Z2MA 1QILA 3W1SA 2LD9A 5E6OA 1WMHA 2WNMA 4HROA 5IA7A 3URYA 4ZHOA 2KJHB 1I4RA 1WX7A 2JXXA 5H92C 3WAOA 1D5ZC 1NENB 4W9IA 3AE1B 1WWTA 5G5GA 3EFCA 5DCNA 1VJKA 4BBNC 4YT0B 2MCNB 1TY0A 2GBJA 4N9F4 1NI3A 4ZYNA 1V97A 1UELA 3RT3B 1STEA 2NS5A 4QAYA 4RM9A 2REXA 2AEHA 2RPQA 4WIPA 1L2NA 2XEWA 4G0NB 3HUIA 3FKYA 4Q2JA 2K1FA 1JWUD 3UQAA 1C1YB 4MM3B 4C56C 3AE2B 1WYWB 4BOZB 1UBIA 1CMXB 3SD5A 1I7HA 1TY2A 1YX5B 1HZ6A 1LGRA 4HCPB 4GSWA 2KWCA 3SFEB 3DVGY 4ARCA 4B0EA 2DZMA 3PV1A 3DBSA 5BMIA 3OWEB 3VH4B 2LJ5A 3N3KB 1TGZB 3MFGA 2D07B 4W9EA 5HI1A 3DBHI 2HE7A 2ON8A 3QA8A 2NMQA 1MG4A 2KKCA 3GS2A 5EE3A 4LTUA 1C4CA 4YTNB 2PMVA 1RYJA 3ML8A 2O6VA 2KWUB 1TTNA 1N5XA 1P1AA 3U4EG 4TKNA 2ZCCA 3T8MA 2K25A 1FPYA 1T0QC 1KOTA 4GGQA 2ONQA 4NQKE 4ANUA 4ZRIA 1RFKA 3A4RA 1E5WA 3DVNV 4IC7B 1R4NB 2WXGA 2KLGA 1XCQL 1WJNA 1WIAA 2QSDA 5D2MB 4ANWA 4XWWA 2J0MA 5LXHA 1NBFC 5FR3A 2FIDA 1V2YA 3EHVA 3Q3NC 4KZ0A 2MP2A 2KFKB 2W3RA 3T3NA 3H7PA 3ZUNA 4ACFA 2RDBC 2WDQB 1K8RB 2GOWA 2BYTA 2K39A 2SAKA 3GE8C 1R4MI 2DZJA 3A1QB 3JVZX 4MDKE 3LB8C 4AP4C 2VH1A 2IO1B 2K6DB 2BYVE 2VRRB 3AB5A 4L23A 4RF0A 3M63B 4WQMA 2RMMA 1GAQB 3ZYYX 3Q3OC 3BK1A 3R7RA 4DXFA 3EFUA 4ICVA 1MPEA 1HTQA 4K1RB 1YJIA 4UDUC 4RMAA 1ZXHA 2LASA 2W82A 2WXNA 3AU4A 1JWSD 3VTUA 1KRHA 1JWMD 1GB4A 1EF5A 3S2AA 2IPKD 1GC7A 4LNOA 5TSSA 4EZJA 2MRPA 1YIWA 1LFDA 3R8BA 2Y5PA 4KIKB 2WX1A 3Q8CA 2FCQA 1P7FA 2L1AA 1YJ1A 3HRDD 2JZ3B 3TUOA 1L7YA 2DYBA 4EKUA 3EA6A 3AV8A 1KLUD 2KC2A 1ESFA 1KH0A 2J42A 2WDVB 1PUTA 4NZLB 2LGIA 2CR5A 4I6PA 2WDTB 3AE5B 1UD7A 2ZPNA 1XLQA 4S0RA 3VRAB 4A8XC 1KM7A 4AWJA 4KDIC 5JXVA 1WXVA 1CK1A 1C4PA 5AUIA 1B9RA 3W9CB 3FAHA 4RM8A 2INDC 3C19A 4TSSA 3N32A 2NPTA 1FCLA 4IDIA 2OHFA 2KANA 1EWYC 3E9SA 2KDBA 1UWMA 1E7VA 4REZA 3NY5A 1XCTL 1EUVB 3P4PB 4K7WA 4LNFA 4PT5A 1SXTA 4W9DA 3Q6BA 3V6CB 2KD0A 3RUIB 3PSEB 3N20C 3M62B 3VFKA 3PZ7A 2M0AA 3LJ3A 1SB3C 1JRUA 2VZKD 3WAMA 1GC6A 2AL6A 4PS3A 2G9HD 2PW9A 1TS5A 4GOCA 2KO3A 4HKQA 2G4SA 4EEWA 3P63A 3VR8B 4PS8A 2UYZB 2J53A 3TEZA 2V0GA 5CHWA 4MM3A 4XX5A 2LUMA 2LUEA 4GDKB 4JWSC 1D5MC 3DVNU 4LNKA 5D7GA 4MGKE 1WMHB 3WAPA 3PVLA 4LDTB 2KMCA 2LI5A 2JWUA 4HPPA 2INNE 2RPVA 4LK0M 1PFDA 2XN9C 1K52A 3RNAC 1J19A 1ZXIA 2K8BA 2IBIB 1HXYD 4HWIB 3N1XC 2J0KA 3MC9A 3PRPB 2AL3A 4FN2A 1Q10A 1NI2A 5AZGA 5CTRC 3T3OA 4RFBA 5HG2A 2INCC 3LDZE 2G4DB 5GXGB 2NBVB 2QCZA 1WJ4A 1P98A 3TBLD 2N9KA 2KWDA 2MA9B 3DWGC 5G2NA 1YX6B 4ANXA 2LZ6A 3QHTA 1ROEA 4FXCA 5IKCM 2PTLA 2BS3B 1B1ZA 1OGWA 1ZUD2 4WJPA 4K3BA 4P16A 3JW0X 2MEKA 1RFAA 4I6LB 3V60A 2NCNA 3M95A 1WY8A 3CF6E 5E6NA 1F0ZA 1ZDVA 3ZW3A 3MP9A 2QILA 4XZ4A 1WX8A 3Q3JA 1E8WA 3AE9B 4LDTD 2UWQA 3O65B 1QOFA 3DBHB 2KFKA 3BZDB 2ZNVC 1SJED 1LO5D 3DHHC 2WX0A 4URKA 1TKGA 1OEYJ 2EKIA 1FD6A 1TIFA 1ZGUB 3JYUA 3A1QA 2GBNA 4II2B 3PGEA 1YQ4B 1SJHD 2BBCA 1Q0WB 3Q8EA 2KN4A 3MHZA 1EWCA 2PKOA 1JCKB 3ZXVA 2HJ8A 4NAMA 3RFZB 3TMPB 1LXDA 2R2QA 1WM3A 3DOWA 2V4LA 3EECA 1YJJA 2K9XA 2OJWA 4RNAA 1J7CA 2O6VB 4GLSC 1V1OA 1D5XC 5L95C 5KHOA 1H4RA 2WXIA 3N1ZC 1WZ0A 5C1ZA 3GE3C 5I4DA 4IWPA 4BKTA 2IY0B 3AE8B 2RR9A 1GUAB 3RNEC 4FBJB 1T6BX 2L83A
chains in the Genus database with same CATH topology
3OAWA 4W9HA 2MBEA 2OJRA 3QARA 2JT4B 2N7DA 3L54A 4MGIE 2J0JA 3A9KB 5GMVA 3VTVA 4LCDE 1A5RA 5DCNA 3TCAA 2GBRA 3VXWA 4KIKA 2W9NA 4FHKA 4BBNC 3ZRCA 3PLVA 4AOFA 2MCNB 3R7QA 3ZDTA 4IG7B 2MLBA 3BINA 4DHJD 1GNUA 2GBJA 4N9F4 3DCGA 2FCMA 4IUMB 1J0GA 4ZYNA 2KX3A 1UELA 3NOBA 2DYMA 3RT3B 1SGHA 2NS5A 2CU1A 4BOSC 3H1UA 1E8ZA 4RM9A 5FR6A 3KW5B 3CSTA 4MJSB 3VHTC 2REXA 4MELA 4MGYE 2AEHA 2RPQA 1HE8A 4W9KA 3PLUA 2MP2B 1L2NA 3KUDB 4IWQA 3ZNHB 2XEWA 4G0NB 3DVGX 3PS6A 3HHMA 2FCSA 2NBUA 2PE9A 4NJ7A 5J17A 5KHQA 3IG3A 2K1FA 2FNJB 3ALBA 3UQAA 2D3GA 1C1YB 2KVRA 1WRDB 4OVVA 4MEMA 2KC1A 3TIXA 3VUWA 1WYWB 4WJQA 4BOZB 3UINB 4EZLA 1UBIA 1CMXB 2C60A 3BY4B 3KYCD 3ZKJC 1SE9A 4XC2A 3SD5A 3QX1A 3PPAA 3W1YA 1YX5B 4HCPB 2D10A 4JL9A 3C0RB 4GSWA 2MW5A 2CS4A 2KWCA 3DVGY 4WWPA 2KDIA 5JHAA 2DZMA 3HM3A 2XK5A 3PV1A 4AUQC 3DBSA 4II3B 3V62A 1WFYA 2C7NB 2NR2A 2ZEQA 3PZDA 3VH4B 2PEAA 3Q3FA 2L7RA 4DK5A 4CYEA 2LJ5A 1WJ6A 3N3KB 2I1KA 2AYOB 4A20A 5AZHA 4K81A 1TGZB 2D07B 3QIJA 2JY6A 4W9EA 5E6PA 5G55A 1SIFA 3DBHI 2HE7A 3QA8A 2BGFA 2KKCA 4FJVB 2K8CA 3PHXB 1E7UA 4TQ0A 3IVFA 3ZNGC 4YL8A 1UZXB 2V1YA 3ML8A 2NVUI 4G50A 2O6VA 2KWUB 1TTNA 2JRHA 3PT2B 3ZTDA 2DZKA 1C3TA 1P1AA 3IHPC 2KXJA 3H6NA 1S3SG 2N9XA 4TKNA 4WJOA 3U7DA 3SHQA 2ZCCA 2A5UA 3T8MA 2K25A 4GDKA 4X57B 3PRMB 5DPWA 3MJWA 4KSKC 2FIFA 1KOTA 2FCNA 3ECIA 2L3ZA 2DAFA 2A4ZA 3TJPA 4GGQA 3VUXA 1PQSA 1XD3B 2CHXA 1D3ZA 3H7SA 4NQKE 4ANUA 3L16A 4ZRIA 1WM2A 1WI0A 3A4RA 1V80A 1E5WA 3DVNV 4IC7B 2KLGA 4IM3A 2OOBB 4GB9A 5J2RA 2MBOA 1WJNA 1ISNA 4B95A 2D2QA 1V86A 1WIAA 5D2MB 4ANWA 3SDLC 2NPTB 4NNJB 4A3PA 3RZFA 2J0MA 2G3QB 5LXHA 2AWTA 1NBFC 2KDFB 4JGHB 4FADA 2FIDA 3X0WA 4DDGD 1V9JA 1V2YA 2KHWB 2PJHA 3DQVA 4HPMB 3ENEA 4F8CB 3EHVA 2KLCA 3JSVB 3OJ4B 5LXIB 1WGYA 4DXAB 4KZ0A 4I6NB 4NJ6A 2MP2A 2KFKB 3DBRI 2ASQA 1OTRB 3IFWB 4NAWA 4WWOA 2ZVOA 1J8CA 4PYZA 3M3JA 3H7PA 2LGXA 3ZUNA 4MH0E 3VAWA 1P0RA 1KJTA 2N4FA 1K8RB 4HLEA 1F9JA 2GOWA 2K39A 4EUTA 2KTFA 1R4MI 2DZJA 2I1JA 3A1QB 3JVZX 4MDKE 5JZEB 4AP4C 2Y5BB 2IO1B 2K6DB 2KX0A 2BYVE 2VRRB 4BKSD 1IPGA 4WJNA 1V5OA 2LVOA 3HK0A 2K8HA 1LM8B 3A9JB 3M63B 3NZUA 3RULA 3UIPB 2J7QB 2KTRB 5BO4B 3WALA 2M1MA 3EC8A 1I42A 1WXAA 1OQYA 1KLVA 2DX5B 4GIVA 3R7RA 2BYFA 3EFUA 1YQBA 2BYEA 2ZPYA 2WYQA 3VDZA 2BWFA 1UH6A 2GBMA 3NHEB 3KUCB 4ICVA 3AI5A 2MBQA 3MTNB 4ICUA 1WXMA 2HTHA 4WAAA 2O2VB 2RSUA 4K1RB 4P7IA 2JZZA 4M0WB 4RMAA 2JUOA 3QCAA 3UQBA 2LASA 4EOYA 3AU4A 3VTUA 3VVWB 2V3SA 2L76A 2KK8A 2LWPA 5TR5A 4G3XB 1EF5A 4KSLC 3S2AA 1TBEA 1VCBA 1GG3A 1GC7A 4BBNF 1Q5WB 2KOXA 2L8JA 2ZZPB 3L13A 4E3CA 4ZDVA 1S1QB 4TV3A 4BFRA 4EZJA 2MRPA 2KFJA 3I3TB 1YIWA 4F7ZA 1I35A 1Q1OA 3WANA 4TUUA 1LFDA 4KIKB 2WX1A 3B0AA 4HVBA 2JPHA 2FCQA 2KWVB 1YJ1A 5JHBA 3DPDA 2JZ3B 2L0TA 2M4NA 1L7YA 2KZRA 2DYBA 2Z0EB 4EKUA 3WIMA 2DYOA 2C7MB 4KZCA 2KC2A 3QJZA 4G11A 3PTFC 2KN5A 3VQIA 2KNBA 5LLIA 3N30A 3ZVVA 2FAZA 2CR5A 4I6PA 1E90A 2WDTB 1UD7A 3QAQA 3R66C 4BVUC 2ZPNA 4CHKA 2DZIA 1WR1A 1KM7A 2BKFA 4FJZA 5DPTA 4AWJA 4KDIC 3KYDD 4K7SA 3IBEA 1Z5SB 2FUHB 1WXVA 2N1VA 1LQBA 3GOEA 2BF8B 3APDA 2XBBC 3HIZA 3L17A 4NQLB 3K9PB 4RM8A 1IYFA 2D11A 2KQSA 3U8ZA 4GDLB 3CMMB 2BWES 2DHZA 3MHSD 3T9LA 4DHZE 3N32A 3ZLZA 2NPTA 3W1SC 4KDLB 2GMIC 4HK2A 2KANA 2KDBA 1E7VA 3V6EB 4W9CA 1V5TA 1WGHA 3NY5A 4DHZB 4E74A 4W9FA 1M94A 1EUVB 4FA6A 1RAXA 5D6JB 3ZO5B 1AARA 2WWZA 4K7WA 3UF8A 1R4NI 1TZ1A 1GJZA 2DENB 4DWFA 1QZEA 3A9KA 2M0XA 4JLCA 3PRZA 1V49A 4HJKA 3X23A 4KVGB 2KJRA 4W9DA 3V6CB 2KD0A 2N9PC 3RUIB 1WR6E 3CSFA 3PSEB 5EDSA 3RZWC 3M62B 4AJWA 3VFKA 2LGYA 3RYTA 2HD5B 2MBHA 3LJ3A 1E8XA 4FLHA 1JRUA 4ASWC 3ZIMA 3WAMA 4MSQB 4MSMB 5D94A 1GC6A 3ZNZB 2AL6A 4PS3A 2LRUA 4JIOU 3PREA 2G45B 4MJSA 2KTRA 2NBWB 4HXDA 1V81A 3ML9A 4GOCA 3GZNI 4KV2A 4MGZE 2LVQA 2KO3A 3UGBB 4CO7A 5L83A 2CHZA 2G4SA 5CX3A 4EEWA 1YD8U 2MBBB 2RD0A 2MSED 3U30A 3APCA 4HDQA 3AXCA 4NY0A 3VUYA 2O2VA 4PS8A 3HM6X 4EFOA 3D32A 2KJ6A 1XT9B 2UYZB 3NS8A 3QK0A 5CHWA 3OJ3A 2CHWA 4MM3A 3P2BA 4XX5A 2IO0B 2LUEA 2Z59B 1FXTB 2BPSA 2LRWA 1WGRA 4GDKB 3ZRFA 3DVNU 2JVCA 1WF9A 2IO2B 3A4SC 4E71A 3AULA 3QC8B 1WJUA 4GN1A 5D7GA 3V61A 4MGKE 2LGDA 1WX9A 4GU2A 4IWOA 5AEKB 2MQJA 4PYUA 1EF1A 4PS7A 4F1SA 4LJOB 5JH5C 1WMHB 2L0FA 3WAPA 3PVLA 4HDOA 4K7UA 4LDTB 4AJYB 2KMCA 5CHFA 1WZ3A 5J18A 4TQ1A 3ZDMC 2LI5A 2LVPA 4IW0A 2ZJDA 2Z0DB 4IM0A 2EMSA 3VH3B 4IM2A 3B08A 3KVFB 2JRIB 2B3AA 3L08A 1J19A 2ZNVB 4HPLB 1UGMA 1WE7A 2K8BA 4ZRJA 2IBIB 3RD2A 4A3OA 4FJYA 3QWZB 4HWIB 4EZKA 2J0KA 5DPSA 3PRPB 2AL3A 2ZVNA 4FN2A 2M17A 4W9JA 2M8SA 5DPRA 3RCZA 1IP9A 1NI2A 2YLMA 4W9GA 4NPNA 1WXSA 5AZGA 4NAWB 5CTRC 2JWZA 3A33B 1MG8A 4B6WA 4BKSA 4DBGA 3WA0A 1T0YA 3H7PB 4B9KA 3LDZE 2C7HA 2G4DB 2NBVB 2R2OA 1WJ4A 1P98A 2K6QA 3TBLD 1VD2A 4GDLA 2KMAA 1UBQA 4BKGA 2MA9B 4M8NA 4OVUA 5G2NA 1U4AA 1YX6B 4ANXA 2LZ6A 3QHTA 2BKRB 3VTWA 1XQQA 3QQ8B 3SU8X 1OGWA 1E8YA 4WJPA 5HKHA 1RLFA 2O6VD 5C23A 3JW0X 4ANVA 1RFAA 2IYDB 4I6LB 2EKEC 3V60A 2NCNA 2N7EA 3R3MA 1OEYA 2IO3B 3H9DA 3B1LX 3M95A 1WY8A 3CF6E 4WQOB 5E6NA 3NZSA 2MX2A 1X1MA 4FULA 2CKHB 3ZW3A 1NDDA 2QHOA 3APFA 1RRBA 4FHJA 4W9LA 4XZ4A 4DHJB 1P9DU 1WX8A 3Q3JA 1E8WA 1P3QU 2L00B 4LDTD 2C9WB 2RGFA 3JSVA 2UWQA 3TL5A 3O65B 2PE6B 1EO6A 4GXBA 2KFKA 4J6IA 4DDID 2ZNVC 3KH0A 3ONSA 3ZNID 1G6JA 3OLMD 2EMTA 2N9EB 2DAJA 5CHVC 1ZKHA 1H8CA 2WX0A 3L10B 4URKA 2GBKA 2JF5A 2XK5B 1OEYJ 2L05A 3JYUA 1ZGUB 4ZRKA 3A1QA 5IAAC 2GBNA 4II2B 3PGEA 2YVCA 4LJPB 3K9OB 1Q0WB 3L0WB 2IY1B 1V6EA 2PPHA 1WH3A 3ZTCA 2HJ8A 1WE6A 1Z2MA 2IZVB 1BT0A 3A9JA 4GMVA 2N1WA 3W1SA 3TMPB 2LD9A 1LXDA 2KQ7A 5E6OA 1WMHA 4M8MA 2R2QA 1WM3A 1Y8RC 3DOWA 3PHWB 2V4LA 3EECA 3KUZA 5IA7A 3DDCB 2O6VB 2KJHB 5L95C 3DBLI 4WWNA 4HCNB 1H4RA 5KHOA 1WX7A 2JXXA 3WAOA 4JQWC 1WZ0A 5C1ZA 2ZCBA 2KDEB 1WGDA 5AZFA 4IWPA 4W9IA 4BKTA 2MWSB 1ZW7A 2IY0B 3AU5A 3UIOB 2C5LC 2RR9A 1GUAB 4FBJB 1WGGA 2LXAA 2LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAW A;  4W9H A;  2MBE A;  2OJR A;  3QAR A;  2JT4 B;  2N7D A;  3L54 A;  4MGI E;  2J0J A;  3A9K B;  5GMV A;  3VTV A;  4LCD E;  1A5R A;  5DCN A;  3TCA A;  2GBR A;  3VXW A;  4KIK A;  2W9N A;  4FHK A;  4BBN C;  3ZRC A;  3PLV A;  4AOF A;  2MCN B;  3R7Q A;  3ZDT A;  4IG7 B;  2MLB A;  3BIN A;  4DHJ D;  1GNU A;  2GBJ A;  4N9F 4;  3DCG A;  2FCM A;  4IUM B;  1J0G A;  4ZYN A;  2KX3 A;  1UEL A;  3NOB A;  2DYM A;  3RT3 B;  1SGH A;  2NS5 A;  2CU1 A;  4BOS C;  3H1U A;  1E8Z A;  4RM9 A;  5FR6 A;  3KW5 B;  3CST A;  4MJS B;  3VHT C;  2REX A;  4MEL A;  4MGY E;  2AEH A;  2RPQ A;  1HE8 A;  4W9K A;  3PLU A;  2MP2 B;  1L2N A;  3KUD B;  4IWQ A;  3ZNH B;  2XEW A;  4G0N B;  3DVG X;  3PS6 A;  3HHM A;  2FCS A;  2NBU A;  2PE9 A;  4NJ7 A;  5J17 A;  5KHQ A;  3IG3 A;  2K1F A;  2FNJ B;  3ALB A;  3UQA A;  2D3G A;  1C1Y B;  2KVR A;  1WRD B;  4OVV A;  4MEM A;  2KC1 A;  3TIX A;  3VUW A;  1WYW B;  4WJQ A;  4BOZ B;  3UIN B;  4EZL A;  1UBI A;  1CMX B;  2C60 A;  3BY4 B;  3KYC D;  3ZKJ C;  1SE9 A;  4XC2 A;  3SD5 A;  3QX1 A;  3PPA A;  3W1Y A;  1YX5 B;  4HCP B;  2D10 A;  4JL9 A;  3C0R B;  4GSW A;  2MW5 A;  2CS4 A;  2KWC A;  3DVG Y;  4WWP A;  2KDI A;  5JHA A;  2DZM A;  3HM3 A;  2XK5 A;  3PV1 A;  4AUQ C;  3DBS A;  4II3 B;  3V62 A;  1WFY A;  2C7N B;  2NR2 A;  2ZEQ A;  3PZD A;  3VH4 B;  2PEA A;  3Q3F A;  2L7R A;  4DK5 A;  4CYE A;  2LJ5 A;  1WJ6 A;  3N3K B;  2I1K A;  2AYO B;  4A20 A;  5AZH A;  4K81 A;  1TGZ B;  2D07 B;  3QIJ A;  2JY6 A;  4W9E A;  5E6P A;  5G55 A;  1SIF A;  3DBH I;  2HE7 A;  3QA8 A;  2BGF A;  2KKC A;  4FJV B;  2K8C A;  3PHX B;  1E7U A;  4TQ0 A;  3IVF A;  3ZNG C;  4YL8 A;  1UZX B;  2V1Y A;  3ML8 A;  2NVU I;  4G50 A;  2O6V A;  2KWU B;  1TTN A;  2JRH A;  3PT2 B;  3ZTD A;  2DZK A;  1C3T A;  1P1A A;  3IHP C;  2KXJ A;  3H6N A;  1S3S G;  2N9X A;  4TKN A;  4WJO A;  3U7D A;  3SHQ A;  2ZCC A;  2A5U A;  3T8M A;  2K25 A;  4GDK A;  4X57 B;  3PRM B;  5DPW A;  3MJW A;  4KSK C;  2FIF A;  1KOT A;  2FCN A;  3ECI A;  2L3Z A;  2DAF A;  2A4Z A;  3TJP A;  4GGQ A;  3VUX A;  1PQS A;  1XD3 B;  2CHX A;  1D3Z A;  3H7S A;  4NQK E;  4ANU A;  3L16 A;  4ZRI A;  1WM2 A;  1WI0 A;  3A4R A;  1V80 A;  1E5W A;  3DVN V;  4IC7 B;  2KLG A;  4IM3 A;  2OOB B;  4GB9 A;  5J2R A;  2MBO A;  1WJN A;  1ISN A;  4B95 A;  2D2Q A;  1V86 A;  1WIA A;  5D2M B;  4ANW A;  3SDL C;  2NPT B;  4NNJ B;  4A3P A;  3RZF A;  2J0M A;  2G3Q B;  5LXH A;  2AWT A;  1NBF C;  2KDF B;  4JGH B;  4FAD A;  2FID A;  3X0W A;  4DDG D;  1V9J A;  1V2Y A;  2KHW B;  2PJH A;  3DQV A;  4HPM B;  3ENE A;  4F8C B;  3EHV A;  2KLC A;  3JSV B;  3OJ4 B;  5LXI B;  1WGY A;  4DXA B;  4KZ0 A;  4I6N B;  4NJ6 A;  2MP2 A;  2KFK B;  3DBR I;  2ASQ A;  1OTR B;  3IFW B;  4NAW A;  4WWO A;  2ZVO A;  1J8C A;  4PYZ A;  3M3J A;  3H7P A;  2LGX A;  3ZUN A;  4MH0 E;  3VAW A;  1P0R A;  1KJT A;  2N4F A;  1K8R B;  4HLE A;  1F9J A;  2GOW A;  2K39 A;  4EUT A;  2KTF A;  1R4M I;  2DZJ A;  2I1J A;  3A1Q B;  3JVZ X;  4MDK E;  5JZE B;  4AP4 C;  2Y5B B;  2IO1 B;  2K6D B;  2KX0 A;  2BYV E;  2VRR B;  4BKS D;  1IPG A;  4WJN A;  1V5O A;  2LVO A;  3HK0 A;  2K8H A;  1LM8 B;  3A9J B;  3M63 B;  3NZU A;  3RUL A;  3UIP B;  2J7Q B;  2KTR B;  5BO4 B;  3WAL A;  2M1M A;  3EC8 A;  1I42 A;  1WXA A;  1OQY A;  1KLV A;  2DX5 B;  4GIV A;  3R7R A;  2BYF A;  3EFU A;  1YQB A;  2BYE A;  2ZPY A;  2WYQ A;  3VDZ A;  2BWF A;  1UH6 A;  2GBM A;  3NHE B;  3KUC B;  4ICV A;  3AI5 A;  2MBQ A;  3MTN B;  4ICU A;  1WXM A;  2HTH A;  4WAA A;  2O2V B;  2RSU A;  4K1R B;  4P7I A;  2JZZ A;  4M0W B;  4RMA A;  2JUO A;  3QCA A;  3UQB A;  2LAS A;  4EOY A;  3AU4 A;  3VTU A;  3VVW B;  2V3S A;  2L76 A;  2KK8 A;  2LWP A;  5TR5 A;  4G3X B;  1EF5 A;  4KSL C;  3S2A A;  1TBE A;  1VCB A;  1GG3 A;  1GC7 A;  4BBN F;  1Q5W B;  2KOX A;  2L8J A;  2ZZP B;  3L13 A;  4E3C A;  4ZDV A;  1S1Q B;  4TV3 A;  4BFR A;  4EZJ A;  2MRP A;  2KFJ A;  3I3T B;  1YIW A;  4F7Z A;  1I35 A;  1Q1O A;  3WAN A;  4TUU A;  1LFD A;  4KIK B;  2WX1 A;  3B0A A;  4HVB A;  2JPH A;  2FCQ A;  2KWV B;  1YJ1 A;  5JHB A;  3DPD A;  2JZ3 B;  2L0T A;  2M4N A;  1L7Y A;  2KZR A;  2DYB A;  2Z0E B;  4EKU A;  3WIM A;  2DYO A;  2C7M B;  4KZC A;  2KC2 A;  3QJZ A;  4G11 A;  3PTF C;  2KN5 A;  3VQI A;  2KNB A;  5LLI A;  3N30 A;  3ZVV A;  2FAZ A;  2CR5 A;  4I6P A;  1E90 A;  2WDT B;  1UD7 A;  3QAQ A;  3R66 C;  4BVU C;  2ZPN A;  4CHK A;  2DZI A;  1WR1 A;  1KM7 A;  2BKF A;  4FJZ A;  5DPT A;  4AWJ A;  4KDI C;  3KYD D;  4K7S A;  3IBE A;  1Z5S B;  2FUH B;  1WXV A;  2N1V A;  1LQB A;  3GOE A;  2BF8 B;  3APD A;  2XBB C;  3HIZ A;  3L17 A;  4NQL B;  3K9P B;  4RM8 A;  1IYF A;  2D11 A;  2KQS A;  3U8Z A;  4GDL B;  3CMM B;  2BWE S;  2DHZ A;  3MHS D;  3T9L A;  4DHZ E;  3N32 A;  3ZLZ A;  2NPT A;  3W1S C;  4KDL B;  2GMI C;  4HK2 A;  2KAN A;  2KDB A;  1E7V A;  3V6E B;  4W9C A;  1V5T A;  1WGH A;  3NY5 A;  4DHZ B;  4E74 A;  4W9F A;  1M94 A;  1EUV B;  4FA6 A;  1RAX A;  5D6J B;  3ZO5 B;  1AAR A;  2WWZ A;  4K7W A;  3UF8 A;  1R4N I;  1TZ1 A;  1GJZ A;  2DEN B;  4DWF A;  1QZE A;  3A9K A;  2M0X A;  4JLC A;  3PRZ A;  1V49 A;  4HJK A;  3X23 A;  4KVG B;  2KJR A;  4W9D A;  3V6C B;  2KD0 A;  2N9P C;  3RUI B;  1WR6 E;  3CSF A;  3PSE B;  5EDS A;  3RZW C;  3M62 B;  4AJW A;  3VFK A;  2LGY A;  3RYT A;  2HD5 B;  2MBH A;  3LJ3 A;  1E8X A;  4FLH A;  1JRU A;  4ASW C;  3ZIM A;  3WAM A;  4MSQ B;  4MSM B;  5D94 A;  1GC6 A;  3ZNZ B;  2AL6 A;  4PS3 A;  2LRU A;  4JIO U;  3PRE A;  2G45 B;  4MJS A;  2KTR A;  2NBW B;  4HXD A;  1V81 A;  3ML9 A;  4GOC A;  3GZN I;  4KV2 A;  4MGZ E;  2LVQ A;  2KO3 A;  3UGB B;  4CO7 A;  5L83 A;  2CHZ A;  2G4S A;  5CX3 A;  4EEW A;  1YD8 U;  2MBB B;  2RD0 A;  2MSE D;  3U30 A;  3APC A;  4HDQ A;  3AXC A;  4NY0 A;  3VUY A;  2O2V A;  4PS8 A;  3HM6 X;  4EFO A;  3D32 A;  2KJ6 A;  1XT9 B;  2UYZ B;  3NS8 A;  3QK0 A;  5CHW A;  3OJ3 A;  2CHW A;  4MM3 A;  3P2B A;  4XX5 A;  2IO0 B;  2LUE A;  2Z59 B;  1FXT B;  2BPS A;  2LRW A;  1WGR A;  4GDK B;  3ZRF A;  3DVN U;  2JVC A;  1WF9 A;  2IO2 B;  3A4S C;  4E71 A;  3AUL A;  3QC8 B;  1WJU A;  4GN1 A;  5D7G A;  3V61 A;  4MGK E;  2LGD A;  1WX9 A;  4GU2 A;  4IWO A;  5AEK B;  2MQJ A;  4PYU A;  1EF1 A;  4PS7 A;  4F1S A;  4LJO B;  5JH5 C;  1WMH B;  2L0F A;  3WAP A;  3PVL A;  4HDO A;  4K7U A;  4LDT B;  4AJY B;  2KMC A;  5CHF A;  1WZ3 A;  5J18 A;  4TQ1 A;  3ZDM C;  2LI5 A;  2LVP A;  4IW0 A;  2ZJD A;  2Z0D B;  4IM0 A;  2EMS A;  3VH3 B;  4IM2 A;  3B08 A;  3KVF B;  2JRI B;  2B3A A;  3L08 A;  1J19 A;  2ZNV B;  4HPL B;  1UGM A;  1WE7 A;  2K8B A;  4ZRJ A;  2IBI B;  3RD2 A;  4A3O A;  4FJY A;  3QWZ B;  4HWI B;  4EZK A;  2J0K A;  5DPS A;  3PRP B;  2AL3 A;  2ZVN A;  4FN2 A;  2M17 A;  4W9J A;  2M8S A;  5DPR A;  3RCZ A;  1IP9 A;  1NI2 A;  2YLM A;  4W9G A;  4NPN A;  1WXS A;  5AZG A;  4NAW B;  5CTR C;  2JWZ A;  3A33 B;  1MG8 A;  4B6W A;  4BKS A;  4DBG A;  3WA0 A;  1T0Y A;  3H7P B;  4B9K A;  3LDZ E;  2C7H A;  2G4D B;  2NBV B;  2R2O A;  1WJ4 A;  1P98 A;  2K6Q A;  3TBL D;  1VD2 A;  4GDL A;  2KMA A;  1UBQ A;  4BKG A;  2MA9 B;  4M8N A;  4OVU A;  5G2N A;  1U4A A;  1YX6 B;  4ANX A;  2LZ6 A;  3QHT A;  2BKR B;  3VTW A;  1XQQ A;  3QQ8 B;  3SU8 X;  1OGW A;  1E8Y A;  4WJP A;  5HKH A;  1RLF A;  2O6V D;  5C23 A;  3JW0 X;  4ANV A;  1RFA A;  2IYD B;  4I6L B;  2EKE C;  3V60 A;  2NCN A;  2N7E A;  3R3M A;  1OEY A;  2IO3 B;  3H9D A;  3B1L X;  3M95 A;  1WY8 A;  3CF6 E;  4WQO B;  5E6N A;  3NZS A;  2MX2 A;  1X1M A;  4FUL A;  2CKH B;  3ZW3 A;  1NDD A;  2QHO A;  3APF A;  1RRB A;  4FHJ A;  4W9L A;  4XZ4 A;  4DHJ B;  1P9D U;  1WX8 A;  3Q3J A;  1E8W A;  1P3Q U;  2L00 B;  4LDT D;  2C9W B;  2RGF A;  3JSV A;  2UWQ A;  3TL5 A;  3O65 B;  2PE6 B;  1EO6 A;  4GXB A;  2KFK A;  4J6I A;  4DDI D;  2ZNV C;  3KH0 A;  3ONS A;  3ZNI D;  1G6J A;  3OLM D;  2EMT A;  2N9E B;  2DAJ A;  5CHV C;  1ZKH A;  1H8C A;  2WX0 A;  3L10 B;  4URK A;  2GBK A;  2JF5 A;  2XK5 B;  1OEY J;  2L05 A;  3JYU A;  1ZGU B;  4ZRK A;  3A1Q A;  5IAA C;  2GBN A;  4II2 B;  3PGE A;  2YVC A;  4LJP B;  3K9O B;  1Q0W B;  3L0W B;  2IY1 B;  1V6E A;  2PPH A;  1WH3 A;  3ZTC A;  2HJ8 A;  1WE6 A;  1Z2M A;  2IZV B;  1BT0 A;  3A9J A;  4GMV A;  2N1W A;  3W1S A;  3TMP B;  2LD9 A;  1LXD A;  2KQ7 A;  5E6O A;  1WMH A;  4M8M A;  2R2Q A;  1WM3 A;  1Y8R C;  3DOW A;  3PHW B;  2V4L A;  3EEC A;  3KUZ A;  5IA7 A;  3DDC B;  2O6V B;  2KJH B;  5L95 C;  3DBL I;  4WWN A;  4HCN B;  1H4R A;  5KHO A;  1WX7 A;  2JXX A;  3WAO A;  4JQW C;  1WZ0 A;  5C1Z A;  2ZCB A;  2KDE B;  1WGD A;  5AZF A;  4IWP A;  4W9I A;  4BKT A;  2MWS B;  1ZW7 A;  2IY0 B;  3AU5 A;  3UIO B;  2C5L C;  2RR9 A;  1GUA B;  4FBJ B;  1WGG A;  2LXA A;  2LXC A; 
#chains in the Genus database with same CATH topology
 3OAW A;  4RH6 A;  2OJR A;  4C4V A;  2N7D A;  5GMV A;  3A9K B;  3GZN B;  3I57 A;  1MHX A;  4KIK A;  4FHK A;  2AX5 A;  4IG7 B;  2MLB A;  3BIN A;  3AEC B;  1J0G A;  2KX3 A;  4M02 A;  4BOS C;  3BYT B;  5FR6 A;  3CST A;  2IGH A;  4MGY E;  2R61 A;  4ZRP A;  3BVZ A;  2MP2 B;  4IWQ A;  1YN4 A;  2NBU A;  2PE9 A;  2V3N A;  5J17 A;  4HJG E;  2D3G A;  5D3I B;  1WRD B;  2DWQ A;  3TIX A;  3VUW A;  1PGB A;  1XXG A;  3BY4 B;  4JE3 B;  3AMZ A;  3BWU D;  3U2S C;  1L4Z B;  2CS4 A;  2NTT A;  4WWP A;  5JHA A;  3HM3 A;  2XK5 A;  2XNA C;  4II3 B;  2C7N B;  2JU6 X;  1HTO A;  3PZ8 A;  4KKJ A;  1F2R C;  1Y56 A;  2L7R A;  4CYE A;  1WJ6 A;  4HEA 1;  2I1K A;  2AYO B;  2NTS A;  1SIF A;  4WH4 A;  1XF5 L;  2K8C A;  2HJ1 A;  1E7U A;  3PHX B;  4TQ0 A;  3I5J C;  3P4R B;  1UZX B;  1SSN A;  4G50 A;  4B0M A;  2BW2 A;  2JRH A;  1L6V A;  3PT2 B;  2KXJ A;  4JWU C;  4WJO A;  4GDK A;  4X57 B;  3ZJU A;  3MJW A;  2ICI A;  4KSK C;  1C76 A;  3TJP A;  1I4Q A;  3H7S A;  1V8C A;  1WM2 A;  1V80 A;  4IM3 A;  4GB9 A;  4YSY B;  2MBO A;  2D2Q A;  2BS2 B;  3SDL C;  2NPT B;  4JPS A;  4A3P A;  1K50 A;  2AWT A;  1JWB D;  1ZOY B;  4FAD A;  4HPM B;  3ENE A;  3OJ4 B;  2BTE A;  1WGY A;  3R2T A;  4I6N B;  4NJ6 A;  3B9J A;  1CQV A;  3M3J A;  2X8X X;  1DYQ A;  5MPO A;  4US9 A;  2N4F A;  1F9J A;  3DBL B;  3Q8A A;  1FFU A;  3NVY A;  3TEX A;  3Q8F A;  3W5V B;  2AQ2 B;  1IPG A;  4WJN A;  4J3O D;  2LVO A;  3NZU A;  4XGA B;  3RUL A;  2J7Q B;  3WAL A;  2M1M A;  3CIR B;  2DX5 B;  2BYF A;  3ZJT A;  3VDZ A;  4A6Q A;  2ZW1 A;  3KUC B;  3AI5 A;  3MTN B;  4ICU A;  1WXM A;  3AEF B;  1R7S A;  4LNI A;  5C3J B;  4P7I A;  2JUO A;  2JXT A;  4EOY A;  2KK8 A;  2LWP A;  4G3X B;  2TSS A;  1GG3 A;  1Q5W B;  3KWL A;  2L8J A;  1FCC C;  1S1Q B;  4MH8 A;  4ZDV A;  1Q1O A;  4TUU A;  3DHI C;  4HVB A;  3L4P A;  3BYY B;  2D3B A;  2M4N A;  2C7M B;  4JX1 C;  3BVG A;  5BMG A;  2KNB A;  2J4X A;  5DPT A;  1EU4 A;  1UUP A;  3IBE A;  1Z5S B;  4NQL B;  1UNS A;  2XBB C;  4RCO A;  3K9P B;  4O1N A;  1IYF A;  1CZP A;  2D11 A;  3IT6 B;  1HZ5 A;  3U8Z A;  3UI3 A;  1AW7 A;  3J9C A;  2B76 B;  3CMM B;  2DHZ A;  3ZLZ A;  3W1S C;  5IP4 D;  5H8Y E;  4W9C A;  4OZC A;  1V5T A;  1WGH A;  3IAS 1;  1BXT A;  1TZO A;  2MH7 A;  1FFV A;  3AEE B;  2Y5C A;  3A9K A;  2M0X A;  4N6E B;  4HJK A;  2KJR A;  3AH7 A;  3CSF A;  3RZW C;  4ARI A;  3RYT A;  2HD5 B;  2JX5 A;  3BII D;  3U7Z A;  1FEH A;  3DHG C;  2V3P A;  2G45 B;  2KTR A;  2NBW B;  4HXD A;  3ML9 A;  5EE9 A;  3GZN I;  4KV2 A;  3UGB B;  1CJE A;  2MBB B;  2MSE D;  3AXC A;  3VUY A;  3HM6 X;  1AWD A;  3OJ3 A;  2IO0 B;  2E6X A;  2RDG A;  1FXT B;  1L0V B;  2BPS A;  2LRW A;  1JRP A;  2JVC A;  2IO2 B;  2OED A;  2WXO A;  4GN1 A;  2LGD A;  1WX9 A;  1QOB A;  3B2G A;  4PS7 A;  4F1S A;  3I63 C;  2LGS A;  2L0F A;  4AJY B;  5CHF A;  1WZ3 A;  3R2I A;  2JRI B;  3L08 A;  1D4B A;  1OQQ A;  1ET6 A;  4FJY A;  2BVC A;  3TEW A;  2AQ1 B;  4WUR A;  3RCZ A;  2YLM A;  1TJE A;  2L32 A;  1T0R C;  1WXS A;  3MJ5 A;  4NAW B;  2WXF A;  4B6W A;  4C4V B;  3WA0 A;  1T0Y A;  1PYW D;  2VZK B;  4USA A;  2R2O A;  1F77 A;  2K6Q A;  1UBQ A;  4BKG A;  3KWV A;  4OVU A;  2MJE A;  3P4Q B;  2Z8L A;  2BKR B;  2UU7 A;  3VTW A;  2BQQ A;  3HVD A;  4L1B A;  2E3T A;  1E8Y A;  1N6Z A;  1K53 A;  2EKE C;  2Q5W D;  1AYF A;  2N7E A;  3PO0 A;  1OFF A;  2CU3 A;  3NZS A;  4FUL A;  4ZYS A;  2CKH B;  1QQR A;  3KLS X;  4KGS A;  4FHJ A;  2MHJ A;  4DHJ B;  2L00 B;  2W55 A;  2CJO A;  3VRB B;  2DLB A;  3ZNI D;  3MC0 B;  2N9E B;  5CHV C;  1ZKH A;  1FO4 A;  1N60 A;  3TEY A;  2GBK A;  3GB1 A;  2XK5 B;  1L0X B;  5IAA C;  2YVC A;  3L0W B;  2DNF A;  1WYG A;  1C77 A;  4WWM A;  1WE6 A;  2IZV B;  2LHD A;  4GMV A;  2N1W A;  3NJT A;  2KQ7 A;  2M56 B;  1Y8R C;  3RMK C;  2WLB A;  3NG0 A;  5BYR A;  3DBL I;  4WWN A;  2ZCB A;  2KDE B;  5AZF A;  1KF6 B;  2MWS B;  3P4S B;  2K22 A;  2WXR A;  3AU5 A;  2C5L C;  3IAM 1;  1WGG A;  2LXC A;  2IGD A;  4MGI E;  3VTV A;  4LCD E;  3TCA A;  1M4V A;  4N58 A;  3VXW A;  2W9N A;  3PLV A;  3R7Q A;  3ZDT A;  2BB6 A;  4DHJ D;  1UF0 A;  2FCM A;  5LNK 1;  2CU1 A;  1V1P A;  3H1U A;  1E8Z A;  3SR6 A;  4CQN A;  4MJS B;  4MEL A;  2WS3 B;  1HQR D;  1TKY A;  2YEP B;  4W9K A;  1T0S C;  3NVZ A;  1UWX A;  2QMT A;  3KUD B;  3ZNH B;  3PS6 A;  3HHM A;  2FCS A;  5KHQ A;  2FBW B;  2KVR A;  4MEM A;  2KC1 A;  1TT5 B;  4P6V F;  4WJQ A;  1MI0 A;  1C79 A;  4EZL A;  3ZKJ C;  1SE9 A;  2SEB D;  1UGJ A;  2WP9 B;  1DOY A;  2D10 A;  4JL9 A;  4S17 A;  2MW5 A;  4YWG G;  2WXP A;  2KDI A;  1I4X A;  4AUQ C;  3V62 A;  2JYE A;  5C2T B;  1SIJ A;  1E10 A;  1OQR A;  2NR2 A;  3PZD A;  1WGK A;  3Q3F A;  4DK5 A;  4YXD B;  2VH2 A;  4A20 A;  3N9Y C;  1VZ8 A;  2IGG A;  2WXL A;  4K81 A;  3ZQ4 A;  2JY6 A;  5G55 A;  3BVM A;  1L4D B;  5IN7 A;  4WAF A;  4FJV B;  2NVU I;  1WXQ A;  2ZW0 A;  4XDD A;  4RGT A;  1C9F A;  1C3T A;  3IHP C;  1FMA D;  3H6N A;  3U7D A;  3H8H A;  2A5U A;  5DPW A;  1ENF A;  2FIF A;  4YTP B;  3ECI A;  2L3Z A;  2RDH A;  2A4Z A;  3VUX A;  1PQS A;  1XD3 B;  5D3D A;  3L16 A;  2QC8 A;  1WI0 A;  1QF6 A;  2OOB B;  1A70 A;  1FNU A;  3C8Y A;  5J2R A;  4B95 A;  1V86 A;  3RZF A;  3X0W A;  4ZHP A;  1V9J A;  2KHW B;  2PJH A;  4F8C B;  3JSV B;  3SFD B;  1NYR A;  4DXA B;  3NUH B;  1JML A;  4NAW A;  1J8C A;  3DBR I;  2ASQ A;  1OTR B;  3IFW B;  2ZVO A;  4PYZ A;  4MAC A;  3Q8B A;  5HFY A;  3RI7 C;  4MH0 E;  1P0R A;  2D5G A;  1DOI A;  4HLE A;  4EUT A;  4R3D A;  4K3C A;  2I1J A;  2LJI A;  5FKA C;  3AEB B;  3HK0 A;  2K8H A;  3A9J B;  1TS2 A;  3HVZ A;  2KTR B;  2KDM A;  2PVO D;  1OQY A;  1KLV A;  1JQ4 A;  4GIV A;  1XLN A;  1N5W A;  3KQ4 A;  1UH6 A;  2MBQ A;  2HTH A;  4WAA A;  2RSU A;  4RGM A;  1FXI A;  2JZZ A;  4M0W B;  3QCA A;  5BYQ A;  3VVW B;  2L76 A;  3CWI A;  4KSL C;  1XLP A;  3ABV B;  1VCB A;  1AN8 A;  4BBN F;  3O13 A;  3L13 A;  3AE7 B;  4E3C A;  4BFR A;  4F7Z A;  2IJ0 A;  1IGD A;  3B0A A;  1XLO A;  2KWV B;  3DPD A;  4HKZ E;  3EUB 2;  2KZR A;  2Z0E B;  2D3C A;  1WRI A;  3WIM A;  2DYO A;  4KZC A;  2W54 A;  3PTF C;  4A9A A;  3VQI A;  2LMC A;  2FAZ A;  1YNT E;  1E90 A;  2FUG 1;  3QAQ A;  4HRS A;  3R66 C;  4BVU C;  4CHK A;  5E6J A;  2DZI A;  1WR1 A;  2BKF A;  1YMH E;  3BK2 A;  4K7S A;  2FUH B;  2N1V A;  3HIZ A;  2BF8 B;  1FNV A;  3APD A;  3SEB A;  4ZRQ A;  2BWE S;  3T9L A;  2GB1 A;  4KDL B;  2GMI C;  2WU5 B;  4RF1 A;  3IT4 B;  1T5X D;  1J7B A;  4DHZ B;  4W9F A;  2CJN A;  1M94 A;  2LHE A;  1AAR A;  2KYW A;  2WWZ A;  3UF8 A;  1TZ1 A;  1GJZ A;  2DEN B;  4DWF A;  1QZE A;  4JLC A;  1C78 A;  3PRZ A;  1V49 A;  2KQ4 X;  2PLP A;  4ZOH C;  2N9P C;  2GRI A;  1SF0 A;  5EDS A;  4YTM B;  2LGY A;  1E8X A;  4C80 A;  4ASW C;  4KGR A;  4MSQ B;  2LRU A;  4MJS A;  4XYC A;  3N1Y C;  3FIL B;  1JAL A;  4L2Y A;  5L83 A;  4MGZ E;  2YEP F;  2CHZ A;  1KTK A;  1YD8 U;  3U30 A;  4HDQ A;  4NY0 A;  4TMA B;  4EFO A;  2O2V A;  3D32 A;  5FK9 C;  1K51 A;  1XT9 B;  3QK0 A;  2CHW A;  2I38 A;  3P2B A;  1IBX B;  4C7Y A;  1FRD A;  3AUL A;  3QC8 B;  1WJU A;  3RNC C;  4US8 A;  4GU2 A;  4IWO A;  2HDE A;  2MQJ A;  1F52 A;  4LJO B;  5HHD G;  5JH5 C;  4K7U A;  4HDO A;  5J18 A;  3ZDM C;  1KFY B;  2ZJD A;  4IM0 A;  1SEB D;  1GPX A;  3VH3 B;  4A55 A;  4IM2 A;  3B08 A;  3KVF B;  2B3A A;  4OVZ A;  2ZNV B;  1UGM A;  4ZRJ A;  3E56 A;  4EZK A;  2DBY A;  5DPS A;  2G1E A;  3VR9 B;  2ZVN A;  2M8S A;  2H88 B;  2JWZ A;  3A33 B;  1MG8 A;  2GLS A;  4B9K A;  4OZB A;  1PDX A;  1VD2 A;  1WSP A;  4GDL A;  5BMH A;  4M8N A;  3NZ3 A;  4AQ7 A;  4XWT A;  3OG5 A;  3FC4 A;  2IDY A;  1XQQ A;  3QQ8 B;  1V1P B;  3ZJV A;  1MVK A;  4DXG A;  4OHJ A;  4ANV A;  3R3M A;  1OEY A;  3H9D A;  1VDV A;  4H2A A;  1RRB A;  3LXF A;  4W9L A;  3W2D A;  1P9D U;  2RGF A;  3JSV A;  2PIA A;  2PE6 B;  2M19 A;  1EO6 A;  2V4I B;  4RGO S;  2BB5 A;  3KH0 A;  2WGS A;  1G6J A;  3OLM D;  3EGR A;  1QT9 A;  4NJC A;  2JF5 A;  4ZRK A;  2PVG C;  1HEZ E;  3K9O B;  4N59 A;  2I2Y A;  1NYQ A;  2WQY B;  1BT0 A;  3A9J A;  1QLB B;  3NVV A;  4M8M A;  1E0Z A;  3PHW B;  3KUZ A;  1ZDX A;  1YN3 A;  3DDC B;  4YSZ B;  4XE0 A;  3W5U B;  4HCN B;  4JQW C;  4M0W A;  1PGX A;  1WGD A;  2V9H A;  4IOI E;  3V3X A;  1ZW7 A;  2WHI A;  3UIO B;  1FRR A;  1WGR A;  2LXA A;  4ITK A;  1N61 A;  2MBE A;  4W9H A;  3QAR A;  2JT4 B;  3L54 A;  2J0J A;  3DBR B;  1I4H A;  1A5R A;  2GBR A;  4M01 A;  3ZRC A;  4AOF A;  1NEK B;  1VZ6 A;  1N63 A;  1EM7 A;  5BYS A;  4AS1 A;  1GNU A;  1JWA D;  3DCG A;  4IUM B;  1SE4 A;  3NOB A;  2DYM A;  1SGH A;  4D2K A;  2X38 A;  3RNF C;  3KW5 B;  1TS4 A;  3VHT C;  2FE8 A;  4IKG A;  1HE8 A;  2JYT A;  3PLU A;  2MJ3 A;  3DVG X;  4NJ7 A;  2KT7 A;  2K3U A;  3IG3 A;  1NVI D;  5IOI A;  2FNJ B;  3ALB A;  2BT6 A;  4OVV A;  4LNN A;  1ET9 A;  3UIN B;  2C60 A;  3KYC D;  4XC2 A;  2Y3A A;  1ZPS A;  3Q14 C;  3QX1 A;  3PPA A;  3W1Y A;  1QOA A;  3C0R B;  5EE1 A;  4RGN A;  3AM9 A;  4M00 A;  1YOV B;  1WFY A;  2WXJ A;  2ZEQ A;  2PEA A;  5AZH A;  3QIJ A;  4BZA A;  5E6P A;  2WXM A;  2BGF A;  3FIL A;  3MC8 A;  2H89 B;  3IVF A;  3ZNG C;  4YL8 A;  2V1Y A;  2GI9 A;  2LEK A;  3AEA B;  3ZTD A;  2DZK A;  2N9L A;  1IBX A;  1S3S G;  2N9X A;  1FXA A;  3SHQ A;  3ZGZ A;  3I9V 1;  1PGA A;  3PRM B;  4C00 A;  1TYG B;  2FCN A;  2DAF A;  3TSS A;  2CHX A;  1D3Z A;  3AED B;  3NRZ A;  1SBB B;  2D3A A;  1IGC A;  2LFI A;  1L0Y B;  1ISN A;  1JW9 D;  1MFW A;  1F1H A;  1E9M A;  4NNJ B;  4KX6 B;  2G3Q B;  2KDF B;  4JGH B;  1KLG D;  5EE0 A;  4DDG D;  4EE2 A;  3DQV A;  2JSV X;  2KLC A;  2W3S A;  5LXI B;  4WWO A;  2L52 A;  2LGX A;  1TKE A;  4KKI A;  3ZXR A;  2HTM E;  3VAW A;  1KJT A;  2KTF A;  1RWS A;  5JZE B;  1VRA B;  2Y5B B;  2KX0 A;  4BKS D;  2QDF A;  3RN9 C;  1V5O A;  1C4A A;  1LM8 B;  2N0S B;  3UIP B;  5BO4 B;  3EC8 A;  1I42 A;  1WXA A;  1YQB A;  2ACZ B;  2BYE A;  2ZPY A;  2WYQ A;  2BWF A;  3NHE B;  2GBM A;  1BUI C;  2O2V B;  4XDC A;  3UQB A;  2JZP A;  2V3S A;  4KGT A;  5TR5 A;  1DGJ A;  3GP7 A;  1TBE A;  3Q69 A;  2KAJ A;  2KOX A;  2ZZP B;  2KAC A;  4TV3 A;  3I3T B;  2KFJ A;  1SE3 A;  2WXQ A;  1I35 A;  1D6E C;  5T8I A;  3WAN A;  4LLG M;  1QOG A;  1EU3 A;  1TS3 A;  1VLB A;  2KVZ A;  3Q3M C;  2JPH A;  3WCQ A;  5JHB A;  2L0T A;  3AEG B;  1SE2 A;  3QJZ A;  4G11 A;  2KN5 A;  3ZVV A;  5LLI A;  3N30 A;  1J7A A;  1MJD A;  3RNB C;  3LYY A;  4FJZ A;  3KYD D;  3GOE A;  3NVW A;  3L17 A;  1LQB A;  2INP E;  1GOZ A;  2QJL A;  3IXS A;  2KQS A;  4GDL B;  4DQO C;  3MHS D;  4DHZ E;  4HK2 A;  3V6E B;  2K5P A;  2EEL A;  4E74 A;  1ZP0 B;  1BML C;  1E6E B;  4FA6 A;  1RAX A;  1E7P B;  5D6J B;  3ZO5 B;  3U52 E;  1R4N I;  2WDR B;  3X23 A;  4KVG B;  3P1M A;  1FIQ A;  1WR6 E;  1YQ3 B;  4AJW A;  1FM0 D;  2WXH A;  2MBH A;  4FLH A;  3ZIM A;  4MSM B;  3ZNZ B;  5D94 A;  2BS4 B;  3ETR A;  1L6U A;  4JIO U;  3PRE A;  1QKZ A;  2AQ3 B;  1V81 A;  1L5P A;  2QIE B;  1F2R I;  2LVQ A;  4PK1 A;  4CO7 A;  5CX3 A;  2RD0 A;  3APC A;  3Q2A C;  2KJ6 A;  3NS8 A;  5G5H A;  4YSX B;  4A90 A;  2Z59 B;  3ZRF A;  1WF9 A;  3A4S C;  4E71 A;  3V61 A;  4P1B C;  2JQR B;  2N7J A;  5AEK B;  4PYU A;  1EF1 A;  3P42 A;  1P7E A;  2KMM A;  1I4G A;  1ZE3 D;  4TQ1 A;  4IW0 A;  2LVP A;  2Z0D B;  2EMS A;  1XO3 A;  4HPL B;  3RD2 A;  1WE7 A;  4MT5 A;  1R4M B;  4A3O A;  3QWZ B;  3DWM A;  3AE6 B;  1IP9 A;  5DPR A;  2M17 A;  1HA5 A;  4W9J A;  1FNW A;  4W9G A;  4NPN A;  1GB1 A;  3RNG C;  4BKS A;  4DBG A;  3H7P B;  2C7H A;  1JRO A;  1ACC A;  2KMA A;  4OZA A;  1VR9 A;  1RM6 C;  1U4A A;  2K0P A;  1YN5 A;  4OW0 A;  3SU8 X;  1XEE A;  4C7Z A;  5HKH A;  1RLF A;  2O6V D;  5C23 A;  2IYD B;  2QEJ C;  2WXK A;  2IO3 B;  3B1L X;  4WQO B;  3V05 A;  3B2F A;  1MHH E;  2MX2 A;  1X1M A;  3AE3 B;  1DOX A;  1NDD A;  2QHO A;  3APF A;  2J52 A;  5IO9 A;  2MJD A;  5AUK A;  1P3Q U;  2WU2 B;  4BAX A;  2C9W B;  3TL5 A;  1N62 A;  3NS1 A;  4P1C C;  1VZ7 A;  4GXB A;  4J6I A;  4DDI D;  3ONS A;  2EMT A;  2DAJ A;  1T3Q A;  1H8C A;  1I4P A;  3L10 B;  1IUE A;  3AN1 A;  2L05 A;  4LJP B;  2IY1 B;  1V6E A;  2PPH A;  1WH3 A;  3AE4 B;  3ZTC A;  3RPF C;  1Z2M A;  1QIL A;  3W1S A;  2LD9 A;  5E6O A;  1WMH A;  2WNM A;  4HRO A;  5IA7 A;  3URY A;  4ZHO A;  2KJH B;  1I4R A;  1WX7 A;  2JXX A;  5H92 C;  3WAO A;  1D5Z C;  1NEN B;  4W9I A;  3AE1 B;  1WWT A;  5G5G A;  3EFC A;  5DCN A;  1VJK A;  4BBN C;  4YT0 B;  2MCN B;  1TY0 A;  2GBJ A;  4N9F 4;  1NI3 A;  4ZYN A;  1V97 A;  1UEL A;  3RT3 B;  1STE A;  2NS5 A;  4QAY A;  4RM9 A;  2REX A;  2AEH A;  2RPQ A;  4WIP A;  1L2N A;  2XEW A;  4G0N B;  3HUI A;  3FKY A;  4Q2J A;  2K1F A;  1JWU D;  3UQA A;  1C1Y B;  4MM3 B;  4C56 C;  3AE2 B;  1WYW B;  4BOZ B;  1UBI A;  1CMX B;  3SD5 A;  1I7H A;  1TY2 A;  1YX5 B;  1HZ6 A;  1LGR A;  4HCP B;  4GSW A;  2KWC A;  3SFE B;  3DVG Y;  4ARC A;  4B0E A;  2DZM A;  3PV1 A;  3DBS A;  5BMI A;  3OWE B;  3VH4 B;  2LJ5 A;  3N3K B;  1TGZ B;  3MFG A;  2D07 B;  4W9E A;  5HI1 A;  3DBH I;  2HE7 A;  2ON8 A;  3QA8 A;  2NMQ A;  1MG4 A;  2KKC A;  3GS2 A;  5EE3 A;  4LTU A;  1C4C A;  4YTN B;  2PMV A;  1RYJ A;  3ML8 A;  2O6V A;  2KWU B;  1TTN A;  1N5X A;  1P1A A;  3U4E G;  4TKN A;  2ZCC A;  3T8M A;  2K25 A;  1FPY A;  1T0Q C;  1KOT A;  4GGQ A;  2ONQ A;  4NQK E;  4ANU A;  4ZRI A;  1RFK A;  3A4R A;  1E5W A;  3DVN V;  4IC7 B;  1R4N B;  2WXG A;  2KLG A;  1XCQ L;  1WJN A;  1WIA A;  2QSD A;  5D2M B;  4ANW A;  4XWW A;  2J0M A;  5LXH A;  1NBF C;  5FR3 A;  2FID A;  1V2Y A;  3EHV A;  3Q3N C;  4KZ0 A;  2MP2 A;  2KFK B;  2W3R A;  3T3N A;  3H7P A;  3ZUN A;  4ACF A;  2RDB C;  2WDQ B;  1K8R B;  2GOW A;  2BYT A;  2K39 A;  2SAK A;  3GE8 C;  1R4M I;  2DZJ A;  3A1Q B;  3JVZ X;  4MDK E;  3LB8 C;  4AP4 C;  2VH1 A;  2IO1 B;  2K6D B;  2BYV E;  2VRR B;  3AB5 A;  4L23 A;  4RF0 A;  3M63 B;  4WQM A;  2RMM A;  1GAQ B;  3ZYY X;  3Q3O C;  3BK1 A;  3R7R A;  4DXF A;  3EFU A;  4ICV A;  1MPE A;  1HTQ A;  4K1R B;  1YJI A;  4UDU C;  4RMA A;  1ZXH A;  2LAS A;  2W82 A;  2WXN A;  3AU4 A;  1JWS D;  3VTU A;  1KRH A;  1JWM D;  1GB4 A;  1EF5 A;  3S2A A;  2IPK D;  1GC7 A;  4LNO A;  5TSS A;  4EZJ A;  2MRP A;  1YIW A;  1LFD A;  3R8B A;  2Y5P A;  4KIK B;  2WX1 A;  3Q8C A;  2FCQ A;  1P7F A;  2L1A A;  1YJ1 A;  3HRD D;  2JZ3 B;  3TUO A;  1L7Y A;  2DYB A;  4EKU A;  3EA6 A;  3AV8 A;  1KLU D;  2KC2 A;  1ESF A;  1KH0 A;  2J42 A;  2WDV B;  1PUT A;  4NZL B;  2LGI A;  2CR5 A;  4I6P A;  2WDT B;  3AE5 B;  1UD7 A;  2ZPN A;  1XLQ A;  4S0R A;  3VRA B;  4A8X C;  1KM7 A;  4AWJ A;  4KDI C;  5JXV A;  1WXV A;  1CK1 A;  1C4P A;  5AUI A;  1B9R A;  3W9C B;  3FAH A;  4RM8 A;  2IND C;  3C19 A;  4TSS A;  3N32 A;  2NPT A;  1FCL A;  4IDI A;  2OHF A;  2KAN A;  1EWY C;  3E9S A;  2KDB A;  1UWM A;  1E7V A;  4REZ A;  3NY5 A;  1XCT L;  1EUV B;  3P4P B;  4K7W A;  4LNF A;  4PT5 A;  1SXT A;  4W9D A;  3Q6B A;  3V6C B;  2KD0 A;  3RUI B;  3PSE B;  3N20 C;  3M62 B;  3VFK A;  3PZ7 A;  2M0A A;  3LJ3 A;  1SB3 C;  1JRU A;  2VZK D;  3WAM A;  1GC6 A;  2AL6 A;  4PS3 A;  2G9H D;  2PW9 A;  1TS5 A;  4GOC A;  2KO3 A;  4HKQ A;  2G4S A;  4EEW A;  3P63 A;  3VR8 B;  4PS8 A;  2UYZ B;  2J53 A;  3TEZ A;  2V0G A;  5CHW A;  4MM3 A;  4XX5 A;  2LUM A;  2LUE A;  4GDK B;  4JWS C;  1D5M C;  3DVN U;  4LNK A;  5D7G A;  4MGK E;  1WMH B;  3WAP A;  3PVL A;  4LDT B;  2KMC A;  2LI5 A;  2JWU A;  4HPP A;  2INN E;  2RPV A;  4LK0 M;  1PFD A;  2XN9 C;  1K52 A;  3RNA C;  1J19 A;  1ZXI A;  2K8B A;  2IBI B;  1HXY D;  4HWI B;  3N1X C;  2J0K A;  3MC9 A;  3PRP B;  2AL3 A;  4FN2 A;  1Q10 A;  1NI2 A;  5AZG A;  5CTR C;  3T3O A;  4RFB A;  5HG2 A;  2INC C;  3LDZ E;  2G4D B;  5GXG B;  2NBV B;  2QCZ A;  1WJ4 A;  1P98 A;  3TBL D;  2N9K A;  2KWD A;  2MA9 B;  3DWG C;  5G2N A;  1YX6 B;  4ANX A;  2LZ6 A;  3QHT A;  1ROE A;  4FXC A;  5IKC M;  2PTL A;  2BS3 B;  1B1Z A;  1OGW A;  1ZUD 2;  4WJP A;  4K3B A;  4P16 A;  3JW0 X;  2MEK A;  1RFA A;  4I6L B;  3V60 A;  2NCN A;  3M95 A;  1WY8 A;  3CF6 E;  5E6N A;  1F0Z A;  1ZDV A;  3ZW3 A;  3MP9 A;  2QIL A;  4XZ4 A;  1WX8 A;  3Q3J A;  1E8W A;  3AE9 B;  4LDT D;  2UWQ A;  3O65 B;  1QOF A;  3DBH B;  2KFK A;  3BZD B;  2ZNV C;  1SJE D;  1LO5 D;  3DHH C;  2WX0 A;  4URK A;  1TKG A;  1OEY J;  2EKI A;  1FD6 A;  1TIF A;  1ZGU B;  3JYU A;  3A1Q A;  2GBN A;  4II2 B;  3PGE A;  1YQ4 B;  1SJH D;  2BBC A;  1Q0W B;  3Q8E A;  2KN4 A;  3MHZ A;  1EWC A;  2PKO A;  1JCK B;  3ZXV A;  2HJ8 A;  4NAM A;  3RFZ B;  3TMP B;  1LXD A;  2R2Q A;  1WM3 A;  3DOW A;  2V4L A;  3EEC A;  1YJJ A;  2K9X A;  2OJW A;  4RNA A;  1J7C A;  2O6V B;  4GLS C;  1V1O A;  1D5X C;  5L95 C;  5KHO A;  1H4R A;  2WXI A;  3N1Z C;  1WZ0 A;  5C1Z A;  3GE3 C;  5I4D A;  4IWP A;  4BKT A;  2IY0 B;  3AE8 B;  2RR9 A;  1GUA B;  3RNE C;  4FBJ B;  1T6B X;  2L83 A; 
#chains in the Genus database with same CATH homology
 3OAW A;  4W9H A;  2MBE A;  2OJR A;  3QAR A;  2JT4 B;  2N7D A;  3L54 A;  4MGI E;  2J0J A;  3A9K B;  5GMV A;  3VTV A;  4LCD E;  1A5R A;  5DCN A;  3TCA A;  2GBR A;  3VXW A;  4KIK A;  2W9N A;  4FHK A;  4BBN C;  3ZRC A;  3PLV A;  4AOF A;  2MCN B;  3R7Q A;  3ZDT A;  4IG7 B;  2MLB A;  3BIN A;  4DHJ D;  1GNU A;  2GBJ A;  4N9F 4;  3DCG A;  2FCM A;  4IUM B;  1J0G A;  4ZYN A;  2KX3 A;  1UEL A;  3NOB A;  2DYM A;  3RT3 B;  1SGH A;  2NS5 A;  2CU1 A;  4BOS C;  3H1U A;  1E8Z A;  4RM9 A;  5FR6 A;  3KW5 B;  3CST A;  4MJS B;  3VHT C;  2REX A;  4MEL A;  4MGY E;  2AEH A;  2RPQ A;  1HE8 A;  4W9K A;  3PLU A;  2MP2 B;  1L2N A;  3KUD B;  4IWQ A;  3ZNH B;  2XEW A;  4G0N B;  3DVG X;  3PS6 A;  3HHM A;  2FCS A;  2NBU A;  2PE9 A;  4NJ7 A;  5J17 A;  5KHQ A;  3IG3 A;  2K1F A;  2FNJ B;  3ALB A;  3UQA A;  2D3G A;  1C1Y B;  2KVR A;  1WRD B;  4OVV A;  4MEM A;  2KC1 A;  3TIX A;  3VUW A;  1WYW B;  4WJQ A;  4BOZ B;  3UIN B;  4EZL A;  1UBI A;  1CMX B;  2C60 A;  3BY4 B;  3KYC D;  3ZKJ C;  1SE9 A;  4XC2 A;  3SD5 A;  3QX1 A;  3PPA A;  3W1Y A;  1YX5 B;  4HCP B;  2D10 A;  4JL9 A;  3C0R B;  4GSW A;  2MW5 A;  2CS4 A;  2KWC A;  3DVG Y;  4WWP A;  2KDI A;  5JHA A;  2DZM A;  3HM3 A;  2XK5 A;  3PV1 A;  4AUQ C;  3DBS A;  4II3 B;  3V62 A;  1WFY A;  2C7N B;  2NR2 A;  2ZEQ A;  3PZD A;  3VH4 B;  2PEA A;  3Q3F A;  2L7R A;  4DK5 A;  4CYE A;  2LJ5 A;  1WJ6 A;  3N3K B;  2I1K A;  2AYO B;  4A20 A;  5AZH A;  4K81 A;  1TGZ B;  2D07 B;  3QIJ A;  2JY6 A;  4W9E A;  5E6P A;  5G55 A;  1SIF A;  3DBH I;  2HE7 A;  3QA8 A;  2BGF A;  2KKC A;  4FJV B;  2K8C A;  3PHX B;  1E7U A;  4TQ0 A;  3IVF A;  3ZNG C;  4YL8 A;  1UZX B;  2V1Y A;  3ML8 A;  2NVU I;  4G50 A;  2O6V A;  2KWU B;  1TTN A;  2JRH A;  3PT2 B;  3ZTD A;  2DZK A;  1C3T A;  1P1A A;  3IHP C;  2KXJ A;  3H6N A;  1S3S G;  2N9X A;  4TKN A;  4WJO A;  3U7D A;  3SHQ A;  2ZCC A;  2A5U A;  3T8M A;  2K25 A;  4GDK A;  4X57 B;  3PRM B;  5DPW A;  3MJW A;  4KSK C;  2FIF A;  1KOT A;  2FCN A;  3ECI A;  2L3Z A;  2DAF A;  2A4Z A;  3TJP A;  4GGQ A;  3VUX A;  1PQS A;  1XD3 B;  2CHX A;  1D3Z A;  3H7S A;  4NQK E;  4ANU A;  3L16 A;  4ZRI A;  1WM2 A;  1WI0 A;  3A4R A;  1V80 A;  1E5W A;  3DVN V;  4IC7 B;  2KLG A;  4IM3 A;  2OOB B;  4GB9 A;  5J2R A;  2MBO A;  1WJN A;  1ISN A;  4B95 A;  2D2Q A;  1V86 A;  1WIA A;  5D2M B;  4ANW A;  3SDL C;  2NPT B;  4NNJ B;  4A3P A;  3RZF A;  2J0M A;  2G3Q B;  5LXH A;  2AWT A;  1NBF C;  2KDF B;  4JGH B;  4FAD A;  2FID A;  3X0W A;  4DDG D;  1V9J A;  1V2Y A;  2KHW B;  2PJH A;  3DQV A;  4HPM B;  3ENE A;  4F8C B;  3EHV A;  2KLC A;  3JSV B;  3OJ4 B;  5LXI B;  1WGY A;  4DXA B;  4KZ0 A;  4I6N B;  4NJ6 A;  2MP2 A;  2KFK B;  3DBR I;  2ASQ A;  1OTR B;  3IFW B;  4NAW A;  4WWO A;  2ZVO A;  1J8C A;  4PYZ A;  3M3J A;  3H7P A;  2LGX A;  3ZUN A;  4MH0 E;  3VAW A;  1P0R A;  1KJT A;  2N4F A;  1K8R B;  4HLE A;  1F9J A;  2GOW A;  2K39 A;  4EUT A;  2KTF A;  1R4M I;  2DZJ A;  2I1J A;  3A1Q B;  3JVZ X;  4MDK E;  5JZE B;  4AP4 C;  2Y5B B;  2IO1 B;  2K6D B;  2KX0 A;  2BYV E;  2VRR B;  4BKS D;  1IPG A;  4WJN A;  1V5O A;  2LVO A;  3HK0 A;  2K8H A;  1LM8 B;  3A9J B;  3M63 B;  3NZU A;  3RUL A;  3UIP B;  2J7Q B;  2KTR B;  5BO4 B;  3WAL A;  2M1M A;  3EC8 A;  1I42 A;  1WXA A;  1OQY A;  1KLV A;  2DX5 B;  4GIV A;  3R7R A;  2BYF A;  3EFU A;  1YQB A;  2BYE A;  2ZPY A;  2WYQ A;  3VDZ A;  2BWF A;  1UH6 A;  2GBM A;  3NHE B;  3KUC B;  4ICV A;  3AI5 A;  2MBQ A;  3MTN B;  4ICU A;  1WXM A;  2HTH A;  4WAA A;  2O2V B;  2RSU A;  4K1R B;  4P7I A;  2JZZ A;  4M0W B;  4RMA A;  2JUO A;  3QCA A;  3UQB A;  2LAS A;  4EOY A;  3AU4 A;  3VTU A;  3VVW B;  2V3S A;  2L76 A;  2KK8 A;  2LWP A;  5TR5 A;  4G3X B;  1EF5 A;  4KSL C;  3S2A A;  1TBE A;  1VCB A;  1GG3 A;  1GC7 A;  4BBN F;  1Q5W B;  2KOX A;  2L8J A;  2ZZP B;  3L13 A;  4E3C A;  4ZDV A;  1S1Q B;  4TV3 A;  4BFR A;  4EZJ A;  2MRP A;  2KFJ A;  3I3T B;  1YIW A;  4F7Z A;  1I35 A;  1Q1O A;  3WAN A;  4TUU A;  1LFD A;  4KIK B;  2WX1 A;  3B0A A;  4HVB A;  2JPH A;  2FCQ A;  2KWV B;  1YJ1 A;  5JHB A;  3DPD A;  2JZ3 B;  2L0T A;  2M4N A;  1L7Y A;  2KZR A;  2DYB A;  2Z0E B;  4EKU A;  3WIM A;  2DYO A;  2C7M B;  4KZC A;  2KC2 A;  3QJZ A;  4G11 A;  3PTF C;  2KN5 A;  3VQI A;  2KNB A;  5LLI A;  3N30 A;  3ZVV A;  2FAZ A;  2CR5 A;  4I6P A;  1E90 A;  2WDT B;  1UD7 A;  3QAQ A;  3R66 C;  4BVU C;  2ZPN A;  4CHK A;  2DZI A;  1WR1 A;  1KM7 A;  2BKF A;  4FJZ A;  5DPT A;  4AWJ A;  4KDI C;  3KYD D;  4K7S A;  3IBE A;  1Z5S B;  2FUH B;  1WXV A;  2N1V A;  1LQB A;  3GOE A;  2BF8 B;  3APD A;  2XBB C;  3HIZ A;  3L17 A;  4NQL B;  3K9P B;  4RM8 A;  1IYF A;  2D11 A;  2KQS A;  3U8Z A;  4GDL B;  3CMM B;  2BWE S;  2DHZ A;  3MHS D;  3T9L A;  4DHZ E;  3N32 A;  3ZLZ A;  2NPT A;  3W1S C;  4KDL B;  2GMI C;  4HK2 A;  2KAN A;  2KDB A;  1E7V A;  3V6E B;  4W9C A;  1V5T A;  1WGH A;  3NY5 A;  4DHZ B;  4E74 A;  4W9F A;  1M94 A;  1EUV B;  4FA6 A;  1RAX A;  5D6J B;  3ZO5 B;  1AAR A;  2WWZ A;  4K7W A;  3UF8 A;  1R4N I;  1TZ1 A;  1GJZ A;  2DEN B;  4DWF A;  1QZE A;  3A9K A;  2M0X A;  4JLC A;  3PRZ A;  1V49 A;  4HJK A;  3X23 A;  4KVG B;  2KJR A;  4W9D A;  3V6C B;  2KD0 A;  2N9P C;  3RUI B;  1WR6 E;  3CSF A;  3PSE B;  5EDS A;  3RZW C;  3M62 B;  4AJW A;  3VFK A;  2LGY A;  3RYT A;  2HD5 B;  2MBH A;  3LJ3 A;  1E8X A;  4FLH A;  1JRU A;  4ASW C;  3ZIM A;  3WAM A;  4MSQ B;  4MSM B;  5D94 A;  1GC6 A;  3ZNZ B;  2AL6 A;  4PS3 A;  2LRU A;  4JIO U;  3PRE A;  2G45 B;  4MJS A;  2KTR A;  2NBW B;  4HXD A;  1V81 A;  3ML9 A;  4GOC A;  3GZN I;  4KV2 A;  4MGZ E;  2LVQ A;  2KO3 A;  3UGB B;  4CO7 A;  5L83 A;  2CHZ A;  2G4S A;  5CX3 A;  4EEW A;  1YD8 U;  2MBB B;  2RD0 A;  2MSE D;  3U30 A;  3APC A;  4HDQ A;  3AXC A;  4NY0 A;  3VUY A;  2O2V A;  4PS8 A;  3HM6 X;  4EFO A;  3D32 A;  2KJ6 A;  1XT9 B;  2UYZ B;  3NS8 A;  3QK0 A;  5CHW A;  3OJ3 A;  2CHW A;  4MM3 A;  3P2B A;  4XX5 A;  2IO0 B;  2LUE A;  2Z59 B;  1FXT B;  2BPS A;  2LRW A;  1WGR A;  4GDK B;  3ZRF A;  3DVN U;  2JVC A;  1WF9 A;  2IO2 B;  3A4S C;  4E71 A;  3AUL A;  3QC8 B;  1WJU A;  4GN1 A;  5D7G A;  3V61 A;  4MGK E;  2LGD A;  1WX9 A;  4GU2 A;  4IWO A;  5AEK B;  2MQJ A;  4PYU A;  1EF1 A;  4PS7 A;  4F1S A;  4LJO B;  5JH5 C;  1WMH B;  2L0F A;  3WAP A;  3PVL A;  4HDO A;  4K7U A;  4LDT B;  4AJY B;  2KMC A;  5CHF A;  1WZ3 A;  5J18 A;  4TQ1 A;  3ZDM C;  2LI5 A;  2LVP A;  4IW0 A;  2ZJD A;  2Z0D B;  4IM0 A;  2EMS A;  3VH3 B;  4IM2 A;  3B08 A;  3KVF B;  2JRI B;  2B3A A;  3L08 A;  1J19 A;  2ZNV B;  4HPL B;  1UGM A;  1WE7 A;  2K8B A;  4ZRJ A;  2IBI B;  3RD2 A;  4A3O A;  4FJY A;  3QWZ B;  4HWI B;  4EZK A;  2J0K A;  5DPS A;  3PRP B;  2AL3 A;  2ZVN A;  4FN2 A;  2M17 A;  4W9J A;  2M8S A;  5DPR A;  3RCZ A;  1IP9 A;  1NI2 A;  2YLM A;  4W9G A;  4NPN A;  1WXS A;  5AZG A;  4NAW B;  5CTR C;  2JWZ A;  3A33 B;  1MG8 A;  4B6W A;  4BKS A;  4DBG A;  3WA0 A;  1T0Y A;  3H7P B;  4B9K A;  3LDZ E;  2C7H A;  2G4D B;  2NBV B;  2R2O A;  1WJ4 A;  1P98 A;  2K6Q A;  3TBL D;  1VD2 A;  4GDL A;  2KMA A;  1UBQ A;  4BKG A;  2MA9 B;  4M8N A;  4OVU A;  5G2N A;  1U4A A;  1YX6 B;  4ANX A;  2LZ6 A;  3QHT A;  2BKR B;  3VTW A;  1XQQ A;  3QQ8 B;  3SU8 X;  1OGW A;  1E8Y A;  4WJP A;  5HKH A;  1RLF A;  2O6V D;  5C23 A;  3JW0 X;  4ANV A;  1RFA A;  2IYD B;  4I6L B;  2EKE C;  3V60 A;  2NCN A;  2N7E A;  3R3M A;  1OEY A;  2IO3 B;  3H9D A;  3B1L X;  3M95 A;  1WY8 A;  3CF6 E;  4WQO B;  5E6N A;  3NZS A;  2MX2 A;  1X1M A;  4FUL A;  2CKH B;  3ZW3 A;  1NDD A;  2QHO A;  3APF A;  1RRB A;  4FHJ A;  4W9L A;  4XZ4 A;  4DHJ B;  1P9D U;  1WX8 A;  3Q3J A;  1E8W A;  1P3Q U;  2L00 B;  4LDT D;  2C9W B;  2RGF A;  3JSV A;  2UWQ A;  3TL5 A;  3O65 B;  2PE6 B;  1EO6 A;  4GXB A;  2KFK A;  4J6I A;  4DDI D;  2ZNV C;  3KH0 A;  3ONS A;  3ZNI D;  1G6J A;  3OLM D;  2EMT A;  2N9E B;  2DAJ A;  5CHV C;  1ZKH A;  1H8C A;  2WX0 A;  3L10 B;  4URK A;  2GBK A;  2JF5 A;  2XK5 B;  1OEY J;  2L05 A;  3JYU A;  1ZGU B;  4ZRK A;  3A1Q A;  5IAA C;  2GBN A;  4II2 B;  3PGE A;  2YVC A;  4LJP B;  3K9O B;  1Q0W B;  3L0W B;  2IY1 B;  1V6E A;  2PPH A;  1WH3 A;  3ZTC A;  2HJ8 A;  1WE6 A;  1Z2M A;  2IZV B;  1BT0 A;  3A9J A;  4GMV A;  2N1W A;  3W1S A;  3TMP B;  2LD9 A;  1LXD A;  2KQ7 A;  5E6O A;  1WMH A;  4M8M A;  2R2Q A;  1WM3 A;  1Y8R C;  3DOW A;  3PHW B;  2V4L A;  3EEC A;  3KUZ A;  5IA7 A;  3DDC B;  2O6V B;  2KJH B;  5L95 C;  3DBL I;  4WWN A;  4HCN B;  1H4R A;  5KHO A;  1WX7 A;  2JXX A;  3WAO A;  4JQW C;  1WZ0 A;  5C1Z A;  2ZCB A;  2KDE B;  1WGD A;  5AZF A;  4IWP A;  4W9I A;  4BKT A;  2MWS B;  1ZW7 A;  2IY0 B;  3AU5 A;  3UIO B;  2C5L C;  2RR9 A;  1GUA B;  4FBJ B;  1WGG A;  2LXA A;  2LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...