1V5OA

Solution structure of the ubiquitin-like domain from mouse hypothetical 1700011n24rik protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GSSGSSGMLITVYCVRRDLTEVTFSLQVNPDFELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDNVGLRTPGRTPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 1700011N24Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords 1700011N24Rik protein
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v5oA00
1V49A 1UD7A 1E8YA 3ZO5B 2KZRA 4EEWA 5C1ZA 1H4RA 4W9JA 3VDZA 2WX0A 4ZRIA 2LGYA 2IZVB 2MBOA 2O2VA 4FULA 3HM6X 2DX5B 3A33B 4I6NB 3CSTA 2MWSB 2HJ8A 1SGHA 2C5LC 3O65B 3Q3FA 2LASA 2D07B 2PE9A 1M94A 2REXA 3R7RA 4TUUA 3UQAA 3A9JB 2KK8A 4PS7A 3PRMB 4YL8A 2NBUA 1RLFA 4FBJB 2KX0A 2MCNB 5TR5A 4KIKB 1J8CA 2RR9A 4GSWA 2LVOA 2J0KA 3RZWC 3KVFB 2FIFA 1WXSA 4X57B 2A5UA 4LDTD 5CHVC 1YX5B 5D2MB 3Q3JA 1TTNA 3P2BA 4FN2A 2MP2B 4FJZA 3DBHI 2NBVB 3CF6E 3PV1A 4GXBA 2L8JA 4HCNB 5IAAC 1OTRB 2CKHB 5G55A 1CMXB 2GBMA 5GMVA 4W9IA 3H7SA 4KVGB 2ZNVC 4GDKB 4KDLB 4W9DA 2K25A 4E3CA 3U7DA 5KHQA 2KC1A 1WF9A 1E8XA 3ZNGC 1P0RA 3RUIB 4HPLB 2JRHA 4LCDE 2CS4A 1SIFA 2DZKA 3IHPC 4I6PA 3ZNZB 2XK5A 2R2OA 2N9EB 4MM3A 2OOBB 3A1QB 4M0WB 2HE7A 3BINA 5E6NA 3RYTA 1SE9A 2FNJB 4GOCA 2D2QA 4G50A 2L0FA 4A3OA 5JHAA 3PLUA 5G2NA 3WAPA 3EC8A 4NJ7A 1WGYA 1E8WA 1RRBA 4KZCA 3TBLD 4JIOU 4W9FA 3L0WB 1V86A 3B1LX 1HE8A 3QARA 4K1RB 3WANA 4F7ZA 5L95C 2ZCCA 5DPWA 2KTFA 2NS5A 5DPSA 3D32A 1VCBA 2MBQA 4WAAA 2M8SA 4XC2A 1E7UA 2BKFA 1P1AA 3PREA 5J18A 3H7PA 1PQSA 2AYOB 4GDLA 1E8ZA 2FIDA 2PPHA 4NAWA 4DDID 1WXVA 4CO7A 1WGRA 4GN1A 3DBLI 2NVUI 3VAWA 4W9GA 3H6NA 2KANA 4G0NB 1WGDA 3ZW3A 2G4SA 1LFDA 2N7EA 3HIZA 3ZKJC 4JLCA 3M62B 4MDKE 2BYFA 4EZLA 1QZEA 4A3PA 2IO1B 5AZFA 3QK0A 3HM3A 1TZ1A 2MLBA 5CTRC 3VVWB 1FXTB 1I42A 3KYCD 1LM8B 4BKGA 1IPGA 2M1MA 4ZYNA 1J19A 2J7QB 2KDFB 3UGBB 5LLIA 5JH5C 1KM7A 3ZUNA 3PSEB 5IA7A 2D11A 4II2B 3DVNV 1EO6A 3VTVA 5JZEB 3L17A 4RM8A 2KQ7A 3DDCB 4BVUC 2DZMA 1LQBA 4WJNA 2KJHB 3KYDD 2G3QB 3W1SC 2NPTB 2L00B 2RGFA 3ZTCA 1EF1A 4F8CB 3PGEA 3V62A 5DCNA 5J2RA 1G6JA 3ONSA 3TL5A 2N7DA 2LXAA 3PRPB 4FADA 1KOTA 2FCQA 3TCAA 4CYEA 2FCNA 4DHJD 1WJ4A 3RD2A 2LXCA 2KFKB 4HVBA 3ZVVA 2BWES 2KJRA 4NJ6A 2KN5A 2KWVB 4HCPB 3ALBA 1TGZB 4URKA 1WM3A 4BFRA 3APCA 4WWPA 2ZEQA 3KUZA 2ZJDA 4OVUA 2YLMA 2PE6B 2FUHB 5C23A 1R4NI 2KTRB 3A9KB 4TV3A 3QWZB 3R66C 1YJ1A 2NR2A 1S1QB 3WIMA 3DPDA 4N9F4 4NY0A 5FR6A 4ANWA 4XZ4A 3APDA 1WX9A 3QIJA 1IP9A 1D3ZA 3IVFA 2CR5A 1WRDB 2KWCA 2WYQA 1V81A 2RD0A 3V6CB 5JHBA 1WXMA 3MTNB 2BYEA 4W9HA 2G45B 3JVZX 3VHTC 1OEYA 4ANVA 3PVLA 2C60A 4A20A 4MEMA 4KV2A 2ZPNA 3AI5A 2DYOA 1OQYA 3EHVA 2GOWA 3C0RB 1UGMA 2JPHA 2PJHA 4HWIB 2NCNA 1XQQA 2AWTA 3EECA 3VH3B 3X23A 4B95A 1OEYJ 2ZVNA 2WX1A 3TIXA 4HXDA 2A4ZA 2K1FA 4M8NA 2LJ5A 2KHWB 3U8ZA 5AEKB 3KW5B 2UWQA 3HHMA 4JGHB 2N9XA 5EDSA 4GDLB 2K6DB 4ANXA 2DAJA 4FJYA 2EMTA 3GZNI 4LDTB 2ZVOA 4NQLB 2I1KA 2MSED 3AU4A 2ZCBA 2KXJA 2GMIC 2KLCA 4BKSA 2KC2A 2NPTA 3SU8X 5LXIB 2N1VA 1V2YA 3AULA 4MSMB 3M3JA 3ZDMC 4K7UA 1L7YA 1H8CA 1LXDA 4II3B 3S2AA 2I1JA 2LVQA 2ASQA 3PHWB 4WJPA 4CHKA 1UELA 2LUEA 2M0XA 3ZIMA 2BWFA 3L13A 1E5WA 5HKHA 3CSFA 3IBEA 2Y5BB 1GJZA 3PZDA 2IY1B 2D10A 2DZJA 4FHJA 3A1QA 4AP4C 2DENB 3DBRI 2VRRB 2KFJA 4XX5A 2MBHA 2KOXA 3PS6A 1WIAA 1C3TA 2BPSA 3A4RA 2JF5A 3W1SA 1I35A 4MGKE 5AZGA 2JRIB 2PEAA 2JXXA 4LJPB 2IO0B 4DHZE 2JVCA 3SDLC 1Z5SB 3BY4B 5LXHA 4IM2A 3H7PB 4FHKA 5D7GA 4FJVB 4GDKA 1Q0WB 1YQBA 2MQJA 3DOWA 2K39A 2CHWA 1ZGUB 3ENEA 4KSKC 2L7RA 3N32A 4IW0A 4PYZA 5CX3A 3DCGA 2KDBA 3QJZA 3T8MA 3ZLZA 1WJNA 1KJTA 3ECIA 3N3KB 3W1YA 3JSVB 4AJYB 2GBKA 2O6VB 2LGXA 3DVNU 2EKEC 2N4FA 2M4NA 2N1WA 4GMVA 2HTHA 4GGQA 2MX2A 4BOSC 1GNUA 1E7VA 1WY8A 4ZRJA 4BBNC 5KHOA 2IY0B 4IWQA 2WWZA 4MELA 1WMHA 1WFYA 3VUYA 1WE7A 1X1MA 2BKRB 3R3MA 3QHTA 2DYMA 2KDEB 4HDQA 4W9KA 2XK5B 1YD8U 3ZRFA 3QQ8B 3SD5A 4K81A 3UIPB 3X0WA 2LGDA 3L54A 3VTUA 1ISNA 2LZ6A 4G3XB 3AU5A 1UBQA 4AOFA 3IG3A 2KO3A 4EUTA 4IC7B 1MG8A 3KUCB 3JW0X 4MGZE 4NQKE 2L76A 4HPMB 1IYFA 2KD0A 2KVRA 2K8CA 4K7SA 5CHFA 3WAMA 1P98A 2ZPYA 3OJ3A 4BKSD 4MH0E 4PYUA 4RMAA 2MP2A 2KLGA 4IG7B 3M63B 3DVGX 2Z0EB 4I6LB 4E71A 4EZKA 1GC7A 2B3AA 4MGYE 3K9PB 5BO4B 2CHXA 3OAWA 4IM3A 4W9CA 4DHZB 1RFAA 2CU1A 3VH4B 4DXAB 4MJSB 4NNJB 3VTWA 4HK2A 4DDGD 1UH6A 2J0MA 2CHZA 2KNBA 4AUQC 4RM9A 1JRUA 1VD2A 4TQ0A 2JT4B 2KX3A 3A9JA 4GIVA 4E74A 1UZXB 2IO3B 2KKCA 2KTRA 1AARA 1WXAA 1T0YA 2W9NA 1WR6E 3V60A 3ZDTA 1V5TA 4IUMB 2O2VB 3H9DA 4KSLC 1V80A 3L08A 2K6QA 4EOYA 1GUAB 2JUOA 2MA9B 3OJ4B 5AZHA 4BOZB 2KFKA 4BKTA 4NPNA 3JSVA 3I3TB 4GB9A 4M8MA 3DVGY 1Y8RC 3NS8A 3KUDB 2NBWB 1WJUA 2R2QA 1YIWA 2DAFA 2LI5A 2YVCA 2JY6A 2D3GA 2RPQA 2LRUA 4DHJB 2EMSA 2AEHA 4LJOB 3ML9A 2OJRA 2QHOA 4AJWA 3JYUA 3VFKA 3T9LA 1GG3A 1RAXA 2L0TA 3UF8A 4FLHA 4IWPA 3L16A 4TQ1A 3VUWA 4DBGA 2C7HA 4KDIC 2IYDB 4HDOA 2WDTB 4K7WA 3PLVA 3H1UA 3NOBA 2IO2B 4HJKA 3CMMB 4BBNF 2K8HA 4HLEA 2O6VA 4ASWC 2Z0DB 5CHWA 2DYBA 2FAZA 4AWJA 3APFA 4DWFA 2G4DB 4W9LA 4WJQA 3RULA 1R4MI 2M17A 1YX6B 4GU2A 1K8RB 4J6IA 1WI0A 3PPAA 2GBRA 2JWZA 4P7IA 4PS3A 3K9OB 4W9EA 1E90A 4JL9A 4EFOA 3M95A 2L05A 4JQWC 4NAWB 1WGGA 2BGFA 1GC6A 1V6EA 3B08A 3QAQA 4F1SA 1ZW7A 4KIKA 3RZFA 4ZDVA 3TJPA 2UYZB 2LRWA 1WYWB 2KWUB 3OLMD 3GOEA 1V9JA 3QA8A 1Z2MA 3PT2B 1Q1OA 3VQIA 4DK5A 4IM0A 1NBFC 3VUXA 3ZNHB 2AL3A 2BYVE 3ZRCA 1U4AA 2GBJA 2KQSA 2Z59B 5DPTA 5D6JB 4FA6A 2J0JA 3A4SC 1NI2A 1L2NA 4ZRKA 2DZIA 3QCAA 3ZNID 1WX8A 2XEWA 3N30A 1UBIA 1A5RA 1C1YB 2RSUA 5J17A 1WZ0A 2LD9A 2MBEA 3PHXB 3UIOB 3AXCA 4MSQB 3NHEB 3MHSD 3V6EB 3IFWB 1WGHA 2JZZA 1XD3B 2HD5B 3QX1A 1F9JA 1WMHB 5D94A 3MJWA 3UINB 1ZKHA 2FCMA 2LVPA 2V1YA 3NZUA 3TMPB 5E6OA 2AL6A 3V61A 3WAOA 2V3SA 3L10B 1WM2A 2MRPA 3DQVA 3WA0A 3ZTDA 4PS8A 4MGIE 2C9WB 1BT0A 2KMCA 4ICUA 1S3SG 3LDZE 1WX7A 1XT9B 3RT3B 3B0AA 3WALA 1NDDA 4B9KA 2FCSA 2DHZA 1WH3A 3PTFC 1P9DU 5E6PA 4WWOA 2LWPA 1TBEA 2C7NB 3DBSA 3U30A 2O6VD 4B6WA 2KMAA 4ANUA 1P3QU 3NY5A 2K8BA 1EF5A 2IBIB 3UQBA 4WJOA 1Q5WB 2JZ3B 3ML8A 3VXWA 4IWOA 1KLVA 2C7MB 1V5OA 2V4LA 4MJSA 1WE6A 3KH0A 4OVVA 1J0GA 3R7QA 2L3ZA 2N9PC 3LJ3A 2BF8B 1WZ3A 3NZSA 1WR1A 4TKNA 4WWNA 5DPRA 1OGWA 3QC8B 2ZNVB 2XBBC 4ICVA 2MBBB 2KJ6A 3EFUA 4G11A 2MW5A 3RCZA 3SHQA 5L83A 1EUVB 2KDIA 3HK0A 4KZ0A 3PRZA 4WQOB 1WJ6A 4EZJA 2ZZPB 3A9KA 2GBNA 4EKUA
chains in the Genus database with same CATH superfamily
1JWMD 2KZRA 2LEKA 2WX0A 4I6NB 3ZXRA 3Q3FA 1WXQA 2D07B 1M94A 2KK8A 1I4PA 3PRMB 1XEEA 1RM6C 1YN3A 2KX0A 2WXJA 5TR5A 3MC8A 1J8CA 4K3CA 3KVFB 2FIFA 1WXSA 4LDTD 1E6EB 1J7CA 5D2MB 1QLBB 1TTNA 3P2BA 2QCZA 2NBVB 4HCNB 2OEDA 5G55A 3L4PA 1ESFA 1I4GA 4W9IA 4KVGB 4E3CA 2K25A 5MPOA 2QEJC 2DZKA 3ZNZB 3A1QB 4JE3B 5FKAC 5TSSA 5E6NA 1I4XA 1EU4A 3EC8A 4P1BC 4NJ7A 1WGYA 4KZCA 3N20C 1XLNA 4K1RB 4RF1A 3BIID 5DPSA 3D32A 2MBQA 2M8SA 2K22A 4ZOHC 4YTMB 3H7PA 4GDLA 1E8ZA 2FIDA 4DDID 4CO7A 2ZW1A 3AE8B 1IBXA 2KANA 4NZLB 2ICIA 2N7EA 1MVKA 3HIZA 1DGJA 4JLCA 2Z8LA 5AZFA 3HM3A 4DQOC 2MLBA 1QKZA 1FXTB 3RFZB 4YT0B 1I42A 1IPGA 1N63A 3UGBB 3DWMA 1JW9D 4J3OD 2D11A 4M02A 2WXHA 3DDCB 1HQRD 2DZMA 1QOGA 1JMLA 2KJHB 2G3QB 3PGEA 2N7DA 2LXAA 2MJDA 4OHJA 1J7AA 4CYEA 2FCNA 3RD2A 2KFKB 3TEYA 2XNAC 2KWVB 3ALBA 2ZJDA 3FAHA 4OVUA 5EE0A 2PE6B 4C4VA 4IKGA 2M19A 2KTRB 3A9KB 3NVZA 3AEDB 3R66C 1YJ1A 1S1QB 3DPDA 2PTLA 1JWBD 3APDA 3QIJA 1D3ZA 3IVFA 1FEHA 2CR5A 2WXQA 2WYQA 3ABVB 2RD0A 1WXMA 3JVZX 3VHTC 4ANVA 3HVDA 1GB1A 2IDYA 4BAXA 4MEMA 2OJWA 2NTTA 3AI5A 1UGMA 4GLSC 1MJDA 4HWIB 2WX1A 3TIXA 3KWLA 2K1FA 1R4NB 5AEKB 5EDSA 2UWQA 2K6DB 2EMTA 2KXJA 2KLCA 3IXSA 4L2YA 4BKSA 2WU5B 4MSMB 1C4AA 1LXDA 2I1JA 3PZ8A 2LVQA 3ZIMA 1HEZE 2DNFA 1TYGB 3IBEA 1KF6B 1SXTA 3C8YA 3PZDA 3FILA 3A1QA 1VRAB 2DENB 3ZGZA 2N0SB 3AMZA 2KOXA 3W1SA 1I35A 1IBXB 1VZ8A 2G9HD 4XDCA 2JU6X 4DXGA 4C7ZA 5LXHA 4M01A 1T5XD 1YQBA 2NMQA 4H2AA 1ZGUB 5CX3A 1SEBD 1FRRA 2KAJA 3T8MA 2WP9B 1ET9A 1SSNA 3W1YA 2GBKA 2O6VB 1DOIA 1V1PA 1N60A 2LGXA 2N4FA 2HTHA 4GGQA 2MX2A 1WY8A 1YN4A 1WE7A 2DYMA 3DHHC 2V4IB 2XK5B 3QQ8B 5BYSA 2MJEA 3X0WA 5HHDG 2KACA 2BB6A 3I9V1 3AU5A 4ZRPA 3TSSA 4AOFA 3IG3A 2KO3A 4MGZE 5LNK1 1QILA 3EGRA 3AEBB 4CQNA 4K7SA 1P98A 2ZPYA 4BKSD 1HTQA 3P4QB 3DVGX 2Z0EB 1JWSD 1GC7A 2B3AA 5BO4B 2G1EA 3FKYA 3GE3C 3IAM1 4NNJB 3RNFC 1FM0D 5H8YE 4AUQC 4RM9A 2KX3A 3IAS1 2KKCA 1PGXA 4ARCA 3V60A 1TKGA 4DXFA 4JX1C 3H9DA 4KSLC 3L08A 5JXVA 1YJIA 4LTUA 3NZ3A 3GZNB 3KQ4A 1KLGD 1YIWA 2D3BA 3AEAB 1AYFA 2YVCA 1TS2A 3ML9A 1RAXA 2L0TA 3L16A 4S17A 2IYDB 1VLBA 2WDTB 4HJKA 1N5WA 4HLEA 2O6VA 2FAZA 3HRDD 3APFA 4DWFA 4W9LA 2M17A 4J6IA 1WI0A 3PPAA 4ITKA 4PS3A 2ZW0A 2OHFA 3K9OB 2L05A 1V6EA 4F1SA 1ZW7A 4KIKA 3RZFA 1WYWB 3GOEA 4N58A 1QOAA 1Q1OA 1SIJA 3FILB 3VUXA 3ZNHB 2AL3A 2BYVE 3E9SA 1SB3C 3RNGC 4ZRKA 2XEWA 5J17A 1CK1A 3PHXB 2WS3B 5HG2A 1XD3B 2HD5B 1J7BA 1WMHB 5D94A 3MJWA 3U2SC 2TSSA 3UINB 2V1YA 1EM7A 2WGSA 5BYRA 1DOXA 1VJKA 1WX7A 1FCLA 2X38A 1P9DU 2M56B 3Q6BA 2RMMA 4M0WA 1TBEA 1P3QU 4WJOA 4IWOA 1WE6A 3KH0A 4A9AA 4ARIA 1Q10A 3QC8B 2MW5A 3RCZA 1QOBA 2V9HA 3UI3A 4EZJA 3A9KA 2INCC 1PDXA 4HKZE 1E8YA 5I4DA 4EEWA 1K50A 5C1ZA 4W9JA 3VDZA 5AUIA 1ZP0B 4RGNA 1C76A 4FULA 3HM6X 3A33B 3RI7C 2GRIA 3UQAA 1STEA 3NS1A 4PS7A 1PUTA 3IT6B 4FBJB 2BS2B 2Y3AA 3NVYA 3I57A 3VR9B 3Q8EA 4FJZA 4PK1A 2L8JA 1D5XC 2GBMA 2MEKA 3H7SA 2ZNVC 4GDKB 3NRZA 3ZJVA 2QILA 2KC1A 1WF9A 2W82A 1FNUA 2JRHA 3P63A 1JRPA 4LCDE 3IHPC 2IGGA 2XK5A 1JALA 4GOCA 2D2QA 4G50A 2L0FA 4A3OA 5JHAA 3PLUA 3WAPA 3RN9C 5IN7A 1ACCA 2LGIA 1E8WA 3TBLD 4JIOU 1V86A 5DPWA 2J42A 2ZCCA 2KTFA 2NS5A 1E7UA 1FMAD 2BKFA 1I4RA 3B2FA 3PREA 4K3BA 1PQSA 2LFIA 4NAWA 5H92C 1MPEA 4GN1A 3ZW3A 1LFDA 2DLBA 4QAYA 2INDC 2IO1B 5CTRC 3LYYA 3AM9A 3ZJTA 4BKGA 5JZEB 3L17A 5C3JB 1NYQA 1C79A 3KYDD 3W1SC 2NPTB 2L00B 2RGFA 3C19A 4ACFA 1ZDVA 3AH7A 1FNVA 4L23A 1KOTA 1SF0A 2AQ3B 4DHJD 1WJ4A 2LXCA 2AX5A 3ZVVA 4Q2JA 2WXNA 1N6ZA 2WXIA 2BBCA 3KUZA 2YLMA 4BZAA 2NTSA 4XWWA 1UWXA 1K52A 2NR2A 4B0EA 3GS2A 3V05A 2IGDA 4XGAB 2PMVA 4ANWA 1YOVB 5HI1A 2QIEB 1TJEA 5JHBA 2WDQB 1L5PA 1V1OA 2BYEA 3MHZA 2J52A 3PVLA 4KV2A 2QC8A 2ZPNA 2GOWA 3C0RB 2W55A 3OWEB 1HZ6A 2NCNA 1XQQA 3VH3B 3X23A 1FXAA 5E6JA 3Q8CA 4M8NA 4P1CC 1EWCA 5EE9A 1K53A 5BMIA 4JGHB 2GB1A 4FJYA 2ZVOA 4NQLB 3LXFA 2KC2A 3SU8X 5LXIB 3AULA 3M3JA 1L7YA 3MFGA 3TEWA 4II3B 3S2AA 4WJPA 4XYCA 2LUEA 1FCCC 3L13A 4LNNA 3AE1B 4AP4C 2Y5PA 3Q8FA 1NVID 2VRRB 1C3TA 3SEBA 1L0YB 3BY4B 5D7GA 3H7PB 4FJVB 1F2RI 1Q0WB 4REZA 4KGSA 2K39A 2WXRA 4KSKC 3N32A 4PYZA 3ZLZA 1WJNA 3ECIA 3N3KB 3W5VB 4ZYSA 1WSPA 2MJ3A 2FE8A 2JSVX 3DVNU 2D5GA 2M4NA 2PLPA 1OQRA 2IY0B 4IWQA 2WWZA 1WMHA 1SJHD 3VUYA 1GB4A 2JYEA 2BKRB 3QHTA 3MC9A 2SEBD 2N9LA 2E3TA 1YD8U 4YSYB 3UIPB 1ISNA 4EUTA 4IC7B 3JW0X 2CU3A 2KD0A 1XLQA 1VZ6A 3Q8BA 2K8CA 2YEPF 2Y5CA 2WXGA 5CHFA 4MH0E 4PYUA 4IG7B 3RNCC 3TUOA 4WIPA 3KWVA 1F52A 1ZXIA 4MGYE 4WURA 2CHXA 3OAWA 4IM3A 4M00A 3AECB 4OZCA 4W9CA 2CU1A 2H89B 4HK2A 1GAQB 1UGJA 1JQ4A 1JRUA 3P1MA 4JWUC 2RDHA 4E74A 2PVGC 1P7FA 1VZ7A 2AQ2B 3ZDTA 1E7PB 1V5TA 4LLGM 2O2VB 4N6EB 3AE9B 3PZ7A 2WU2B 1HZ5A 4RGTA 3OJ4B 4BOZB 4NPNA 2NBWB 2JY6A 2LRUA 2EMSA 2AEHA 4WH4A 2LHEA 1QOFA 2OJRA 3Q2AC 2QHOA 3JYUA 1EWYC 3T9LA 1GG3A 4FLHA 3ETRA 4IWPA 1F0ZA 4HDOA 4K7WA 3H1UA 2IO2B 4BBNF 2K8HA 4ASWC 2Z0DB 5CHWA 2DYBA 2G4DB 1YX6B 4GU2A 1YQ3B 2GBRA 4RH6A 3N1YC 2BT6A 2JX5A 4JL9A 1YJJA 4JQWC 4NAWB 1WGGA 2BGFA 3Q14C 4C80A 3AB5A 3RNAC 2INNE 1TS3A 1Z2MA 3VQIA 3BK1A 3ZRCA 2GBJA 2KQSA 5DPTA 2K3UA 5D6JB 3W2DA 3A4SC 1NI2A 4B0MA 1KRHA 2KN4A 3ZJUA 1WZ0A 2MBEA 3UIOB 3AXCA 4MSQB 3URYA 2WDVB 2W54A 1WGHA 2JZZA 2L52A 1F9JA 2FUG1 2FCMA 2LVPA 3U52E 5E6OA 2V3SA 4O1NA 1TT5B 4C00A 2C9WB 1S3SG 3RT3B 1XT9B 3T3NA 1NDDA 4B9KA 2DHZA 1WH3A 4WWOA 1BMLC 1VR9A 3P4SB 4MACA 2LWPA 2C7NB 2QJLA 2O6VD 1KLUD 4B6WA 3NY5A 3RPFC 1EF5A 1PFDA 3VXWA 4USAA 1V5OA 4KKJA 5AUKA 2V4LA 4ZHOA 1J0GA 3LJ3A 1MG4A 2BF8B 3NZSA 4WWNA 2WXFA 1OGWA 1L6VA 1Y56A 3SHQA 2KDIA 4KZ0A 3O13A 3PRZA 3VR8B 1NYRA 1UD7A 1H4RA 3EA6A 2LGYA 2IZVB 1TS5A 1KH0A 3CSTA 2MWSB 2QDFA 1SGHA 3OG5A 3A9JB 4YL8A 3Q3MC 1UF0A 3RNEC 2VZKD 2MCNB 4KIKB 2RR9A 4YTPB 2J0KA 3RZWC 4X57B 3J9CA 1NEKB 3P4PB 5IO9A 2MP2B 3PV1A 1VDVA 1OTRB 2CKHB 4XWTA 1CMXB 4FXCA 3W9CB 4S0RA 4KDLB 4W9DA 3U7DA 5KHQA 1E8XA 2V3NA 1P0RA 3RUIB 4HPLB 1UNSA 1I4QA 2MH7A 1YN5A 1SIFA 2CS4A 4I6PA 4TSSA 2N9EB 4M0WB 3BINA 1SE9A 2FNJB 5G2NA 1RRBA 2L83A 4W9FA 3L0WB 1SJED 1XLOA 2M0AA 3U4EG 1T0RC 4XC2A 2IPKD 2AYOB 1ET6A 1WGRA 1SE3A 3DBLI 5FK9C 4RGMA 3ZKJC 1T3QA 2BYFA 1QZEA 4A3PA 2PW9A 3VVWB 3KYCD 1LM8B 4ZYNA 3AE3B 2J7QB 5JH5C 1KM7A 3ZUNA 1I7HA 4II2B 3DVNV 1EO6A 4RM8A 4BVUC 1HA5A 4TMAB 1EF1A 4F8CB 4A6QA 3V62A 5DCNA 1G6JA 3ONSA 4A90A 1GOZA 4FADA 2JYTA 4YSXB 3TCAA 2AQ1B 3AE2B 2B76B 4HVBA 2LMCA 2KJRA 1A70A 4HCPB 4URKA 3LB8C 1N62A 3APCA 4WWPA 3BVMA 2ZEQA 3PO0A 1OQQA 1TZOA 2RDBC 4TV3A 4D2KA 3QWZB 3DWGC 1FPYA 1R7SA 4N9F4 4KGRA 4NY0A 2D3CA 2KWDA 2ON8A 2KMMA 4WQMA 5T8IA 1IGCA 1IP9A 4NAMA 4LNKA 1WRDB 3AEFB 1B9RA 1V81A 3V6CB 1TY0A 2ONQA 1MHHE 1OEYA 4OZAA 2C60A 4A20A 2EELA 3B2GA 3EECA 2AWTA 1OEYJ 4HXDA 2A4ZA 2CJNA 4OVZA 2LJ5A 1D5ZC 2KHWB 3U8ZA 1LO5D 2BW2A 3HHMA 3KW5B 3P42A 4ANXA 3GZNI 4LDTB 3BYYB 2I1KA 2MSED 2ZCBA 2GMIC 3GP7A 2N1VA 1V2YA 2CJOA 1CQVA 3ZDMC 4K7UA 4CHKA 3PHWB 3N1XC 2M0XA 3CSFA 2Y5BB 2GI9A 2IY1B 2I2YA 1CJEA 2YEPB 1FFVA 2V0GA 3MJ5A 4XX5A 2MHJA 3A4RA 1XCQL 4MT5A 2JWUA 3DBLB 3ZXVA 1FO4A 3EFCA 3AV8A 4MGKE 5AZGA 2JRIB 2PEAA 3DHGC 2JXXA 4LJPB 2IO0B 4DHZE 1Z5SB 1FFUA 1XO3A 4IM2A 4FHKA 3N9YC 2LGSA 2CHWA 3ENEA 4IW0A 3SFEB 3RMKC 3QJZA 2GLSA 4HRSA 4C4VB 1TKYA 3WCQA 4BOSC 1E7VA 3NUHB 4BBNC 1IGDA 2LJIA 1X1MA 3R3MA 2PVOD 4W9KA 3KLSX 3ZRFA 1F1HA 3SD5A 4YWGG 2LGDA 3VTUA 2LZ6A 4G3XB 1UBQA 1TKEA 2L76A 1ZDXA 4HPMB 1IYFA 2MP2A 2KLGA 2L32A 3M63B 5HFYA 4I6LB 4E71A 4R3DA 2BS4B 4DHZB 3VH4B 4DXAB 3VTWA 4XDDA 4DDGD 1UH6A 1V97A 1MI0A 2J0MA 4RCOA 2KNBA 4TQ0A 2JT4B 3AE4B 4GIVA 1UZXB 2KTRA 3T3OA 2W9NA 1T0YA 4PT5A 2K5PA 4IUMB 4N59A 4KX6B 1N5XA 4LNOA 4EOYA 2K6QA 1GUAB 2JUOA 2MA9B 1AWDA 1V1PB 2KFKA 3JSVA 1JROA 3Q3OC 3DVGY 1Y8RC 3NS8A 1PGAA 3KUDB 1WJUA 4WAFA 2LI5A 1D5MC 1HXYD 4LJOB 4AJWA 3VFKA 4TQ1A 3GB1A 3VUWA 4LNIA 4DBGA 2C7HA 5GXGB 1C77A 1FD6A 3NOBA 2QSDA 1PYWD 2DWQA 1XLPA 1I4HA 3DBHB 2Q5WD 2JXTA 4WJQA 1R4MI 3RULA 1F2RC 1L6UA 4LK0M 1E90A 4EFOA 3M95A 2L1AA 1GC6A 3QAQA 3BVZA 4ZHPA 4ZDVA 2LRWA 3VRAB 1ZUD2 1V9JA 3PT2B 4IM0A 1NBFC 3P4RB 2Z59B 3BYTB 5D3DA 4HPPA 4FA6A 3QCAA 3ZNID 1WX8A 1A5RA 1C1YB 4KGTA 2LD9A 3CIRB 3NHEB 2IJ0A 3E56A 3R8BA 1ZKHA 1DOYA 4HKQA 1TS4A 3NZUA 3TMPB 2AL6A 2WXOA 3GE8C 3L10B 3DQVA 2MRPA 3ZTDA 4PS8A 4MGIE 1BT0A 1ENFA 2KMCA 4ICUA 3AEEB 3W5UB 3WALA 1WWTA 5G5GA 1GPXA 1RFKA 3DBSA 4US9A 2KMAA 1RWSA 4P6VF 2LUMA 2KYWA 1JWAD 1ZPSA 2JZ3B 2WLBA 1BUIC 1ZOYB 4OVVA 1C4PA 2L3ZA 1D6EC 4TKNA 1WZ3A 5DPRA 4ICVA 2MBBB 2KJ6A 3EFUA 4G11A 5L83A 5J2RA 4WQOB 1WJ6A 1MHXA 4EKUA 3NVWA 1V49A 3ZO5B 4ZRIA 2JQRB 2MBOA 2O2VA 2DX5B 1K51A 2HJ8A 2C5LC 3O65B 2LASA 4NJCA 2PE9A 2REXA 2H88B 3R7RA 4TUUA 1WRIA 1C4CA 1JWUD 3H8HA 4JWSC 1SBBB 2NBUA 1RLFA 3BZDB 4GSWA 2LVOA 3ZYYX 1JCKB 2A5UA 1FRDA 5CHVC 1YX5B 3Q3JA 4P16A 1F77A 4FN2A 3DBHI 2K9XA 3CF6E 3SR6A 4GXBA 4RNAA 5IAAC 2PKOA 3AN1A 5GMVA 1T0SC 3N1ZC 1T0QC 2J4XA 5BMGA 1B1ZA 5BYQA 3ZNGC 2D3AA 4MM3B 4A55A 2WHIA 2R2OA 4MM3A 2OOBB 2HE7A 3RYTA 4HEA1 3EUB2 1QT9A 2BVCA 2FBWB 2WXKA 3B1LX 1HE8A 3QARA 4RFBA 3WANA 5L95C 4F7ZA 1VCBA 4WAAA 4WWMA 3AEGB 1LGRA 1NENB 1P1AA 5G5HA 5J18A 3SFDB 3AE5B 2PPHA 1WXVA 1PGBA 2NVUI 3VAWA 4W9GA 3H6NA 4G0NB 1WGDA 2G4SA 2VH2A 4MDKE 3M62B 4EZLA 1UUPA 4EE2A 3QK0A 1ROEA 1TZ1A 1XF5L 2M1MA 4C7YA 1J19A 2KDFB 5LLIA 2PIAA 2HJ1A 3PSEB 5IA7A 3VTVA 1AN8A 2KQ7A 1LQBA 3MC0B 4WJNA 5FR3A 3ZTCA 3TL5A 2I38A 3PRPB 2FCQA 1L4ZB 4IOIE 1YQ4B 5BMHA 4UDUC 2BWES 2E6XA 4NJ6A 2KN5A 5C2TB 1TGZB 1WM3A 4BFRA 3U7ZA 2SAKA 2FUHB 5C23A 1R4NI 1YMHE 2BS3B 3WIMA 5FR6A 1QQRA 1EU3A 4XZ4A 1WX9A 2BQQA 2KWCA 3I5JC 2WNMA 1KTKA 3MTNB 4W9HA 2G45B 2DBYA 2IGHA 4RF0A 2X8XX 3BVGA 3TEXA 1L4DB 3R2IA 1FIQA 1UWMA 2DYOA 1OQYA 3EHVA 3Q8AA 2JPHA 2PJHA 2WQYB 2HDEA 2BYTA 1KFYB 4HJGE 4B95A 2ZVNA 1BXTA 1ZXHA 2N7JA 2LHDA 1M4VA 4L1BA 3RNBC 2N9XA 4GDLB 2DAJA 2KT7A 3AU4A 2NPTA 3HVZA 4HROA 2J53A 1H8CA 1TIFA 2ASQA 4MH8A 3NJTA 4IDIA 1UELA 3V3XA 2BWFA 1E5WA 4YTNB 5HKHA 3AE7B 4LNFA 2WDRB 1GJZA 2D10A 4OZBA 2DZJA 4FHJA 1WYGA 5IOIA 3Q3NC 3DBRI 1AW7A 2KFJA 2MBHA 3PS6A 1WIAA 2BPSA 2JF5A 4YSZB 1D4BA 2HTME 2JVCA 3SDLC 4GDKA 3DOWA 2MQJA 4YXDB 3DHIC 1OFFA 2L7RA 5EE3A 1E9MA 1XXGA 1FNWA 3DCGA 2KDBA 1KJTA 3JSVB 4AJYB 1L0XB 4GMVA 4JPSA 2EKEC 2N1WA 1GNUA 4ZRJA 2BTEA 1TY2A 5KHOA 4MELA 1WFYA 2KDEB 4HDQA 1DYQA 4C56C 4K81A 3L54A 5IKCM 3BK2A 2VZKB 1MG8A 3KUCB 3NG0A 3HUIA 3AE6B 3NVVA 4NQKE 2KVRA 3WAMA 3OJ3A 1WGKA 3VRBB 2ACZB 4RMAA 2RPVA 4EZKA 1NI3A 1V8CA 1C9FA 3K9PB 1N61A 1RFAA 4A8XC 4MJSB 2W3RA 2WXLA 5D3IB 2CHZA 1VD2A 3A9JA 2IO3B 4ZRQA 1AARA 1WXAA 1WR6E 1V80A 1RYJA 5AZHA 4BKTA 2XN9C 3I3TB 4GB9A 4M8MA 1QF6A 2R2QA 2DAFA 4AQ7A 2D3GA 2RPQA 2R61A 4DHJB 2UU7A 1T6BX 1L0VB 1XCTL 3IT4B 1SE2A 1FXIA 2KDMA 3UF8A 4KDIC 3PLVA 3CMMB 3Q69A 2RDGA 3I63C 4AWJA 1IUEA 3DBRB 5IP4D 1K8RB 2QMTA 3B9JA 2JWZA 4P7IA 4W9EA 3B08A 3TJPA 2UYZB 1ZE3D 2KWUB 3OLMD 1SE4A 3QA8A 4DK5A 1P7EA 1U4AA 2WXPA 2JZPA 2W3SA 4XE0A 3MP9A 2J0JA 4RGOS 1L2NA 2DZIA 3N30A 1UBIA 2RSUA 2VH1A 4KKIA 4US8A 3MHSD 1R4MB 2N9KA 3V6EB 3IFWB 3QX1A 1YNTE 2V3PA 3BWUD 2EKIA 3V61A 3WAOA 3ZQ4A 1WM2A 3WA0A 3LDZE 3B0AA 4AS1A 2FCSA 2WXMA 3CWIA 3PTFC 5E6PA 3R2TA 1C78A 3U30A 1MFWA 1E0ZA 4ANUA 1CZPA 2K8BA 1HTOA 2INPE 2IBIB 3UQBA 1Q5WB 3ML8A 2KQ4X 1KLVA 2C7MB 4OW0A 4MJSA 3R7QA 2BB5A 3TEZA 3FC4A 2N9PC 5EE1A 1WR1A 2ZNVB 2XBBC 2K0PA 1EUVB 3HK0A 1E10A 2ZZPB 2GBNA 2KVZA
chains in the Genus database with same CATH topology
1V49A 1UD7A 1E8YA 3ZO5B 2KZRA 4EEWA 5C1ZA 1H4RA 4W9JA 3VDZA 2WX0A 4ZRIA 2LGYA 2IZVB 2MBOA 2O2VA 4FULA 3HM6X 2DX5B 3A33B 4I6NB 3CSTA 2MWSB 2HJ8A 1SGHA 2C5LC 3O65B 3Q3FA 2LASA 2D07B 2PE9A 1M94A 2REXA 3R7RA 4TUUA 3UQAA 3A9JB 2KK8A 4PS7A 3PRMB 4YL8A 2NBUA 1RLFA 4FBJB 2KX0A 2MCNB 5TR5A 4KIKB 1J8CA 2RR9A 4GSWA 2LVOA 2J0KA 3RZWC 3KVFB 2FIFA 1WXSA 4X57B 2A5UA 4LDTD 5CHVC 1YX5B 5D2MB 3Q3JA 1TTNA 3P2BA 4FN2A 2MP2B 4FJZA 3DBHI 2NBVB 3CF6E 3PV1A 4GXBA 2L8JA 4HCNB 5IAAC 1OTRB 2CKHB 5G55A 1CMXB 2GBMA 5GMVA 4W9IA 3H7SA 4KVGB 2ZNVC 4GDKB 4KDLB 4W9DA 2K25A 4E3CA 3U7DA 5KHQA 2KC1A 1WF9A 1E8XA 3ZNGC 1P0RA 3RUIB 4HPLB 2JRHA 4LCDE 2CS4A 1SIFA 2DZKA 3IHPC 4I6PA 3ZNZB 2XK5A 2R2OA 2N9EB 4MM3A 2OOBB 3A1QB 4M0WB 2HE7A 3BINA 5E6NA 3RYTA 1SE9A 2FNJB 4GOCA 2D2QA 4G50A 2L0FA 4A3OA 5JHAA 3PLUA 5G2NA 3WAPA 3EC8A 4NJ7A 1WGYA 1E8WA 1RRBA 4KZCA 3TBLD 4JIOU 4W9FA 3L0WB 1V86A 3B1LX 1HE8A 3QARA 4K1RB 3WANA 4F7ZA 5L95C 2ZCCA 5DPWA 2KTFA 2NS5A 5DPSA 3D32A 1VCBA 2MBQA 4WAAA 2M8SA 4XC2A 1E7UA 2BKFA 1P1AA 3PREA 5J18A 3H7PA 1PQSA 2AYOB 4GDLA 1E8ZA 2FIDA 2PPHA 4NAWA 4DDID 1WXVA 4CO7A 1WGRA 4GN1A 3DBLI 2NVUI 3VAWA 4W9GA 3H6NA 2KANA 4G0NB 1WGDA 3ZW3A 2G4SA 1LFDA 2N7EA 3HIZA 3ZKJC 4JLCA 3M62B 4MDKE 2BYFA 4EZLA 1QZEA 4A3PA 2IO1B 5AZFA 3QK0A 3HM3A 1TZ1A 2MLBA 5CTRC 3VVWB 1FXTB 1I42A 3KYCD 1LM8B 4BKGA 1IPGA 2M1MA 4ZYNA 1J19A 2J7QB 2KDFB 3UGBB 5LLIA 5JH5C 1KM7A 3ZUNA 3PSEB 5IA7A 2D11A 4II2B 3DVNV 1EO6A 3VTVA 5JZEB 3L17A 4RM8A 2KQ7A 3DDCB 4BVUC 2DZMA 1LQBA 4WJNA 2KJHB 3KYDD 2G3QB 3W1SC 2NPTB 2L00B 2RGFA 3ZTCA 1EF1A 4F8CB 3PGEA 3V62A 5DCNA 5J2RA 1G6JA 3ONSA 3TL5A 2N7DA 2LXAA 3PRPB 4FADA 1KOTA 2FCQA 3TCAA 4CYEA 2FCNA 4DHJD 1WJ4A 3RD2A 2LXCA 2KFKB 4HVBA 3ZVVA 2BWES 2KJRA 4NJ6A 2KN5A 2KWVB 4HCPB 3ALBA 1TGZB 4URKA 1WM3A 4BFRA 3APCA 4WWPA 2ZEQA 3KUZA 2ZJDA 4OVUA 2YLMA 2PE6B 2FUHB 5C23A 1R4NI 2KTRB 3A9KB 4TV3A 3QWZB 3R66C 1YJ1A 2NR2A 1S1QB 3WIMA 3DPDA 4N9F4 4NY0A 5FR6A 4ANWA 4XZ4A 3APDA 1WX9A 3QIJA 1IP9A 1D3ZA 3IVFA 2CR5A 1WRDB 2KWCA 2WYQA 1V81A 2RD0A 3V6CB 5JHBA 1WXMA 3MTNB 2BYEA 4W9HA 2G45B 3JVZX 3VHTC 1OEYA 4ANVA 3PVLA 2C60A 4A20A 4MEMA 4KV2A 2ZPNA 3AI5A 2DYOA 1OQYA 3EHVA 2GOWA 3C0RB 1UGMA 2JPHA 2PJHA 4HWIB 2NCNA 1XQQA 2AWTA 3EECA 3VH3B 3X23A 4B95A 1OEYJ 2ZVNA 2WX1A 3TIXA 4HXDA 2A4ZA 2K1FA 4M8NA 2LJ5A 2KHWB 3U8ZA 5AEKB 3KW5B 2UWQA 3HHMA 4JGHB 2N9XA 5EDSA 4GDLB 2K6DB 4ANXA 2DAJA 4FJYA 2EMTA 3GZNI 4LDTB 2ZVOA 4NQLB 2I1KA 2MSED 3AU4A 2ZCBA 2KXJA 2GMIC 2KLCA 4BKSA 2KC2A 2NPTA 3SU8X 5LXIB 2N1VA 1V2YA 3AULA 4MSMB 3M3JA 3ZDMC 4K7UA 1L7YA 1H8CA 1LXDA 4II3B 3S2AA 2I1JA 2LVQA 2ASQA 3PHWB 4WJPA 4CHKA 1UELA 2LUEA 2M0XA 3ZIMA 2BWFA 3L13A 1E5WA 5HKHA 3CSFA 3IBEA 2Y5BB 1GJZA 3PZDA 2IY1B 2D10A 2DZJA 4FHJA 3A1QA 4AP4C 2DENB 3DBRI 2VRRB 2KFJA 4XX5A 2MBHA 2KOXA 3PS6A 1WIAA 1C3TA 2BPSA 3A4RA 2JF5A 3W1SA 1I35A 4MGKE 5AZGA 2JRIB 2PEAA 2JXXA 4LJPB 2IO0B 4DHZE 2JVCA 3SDLC 1Z5SB 3BY4B 5LXHA 4IM2A 3H7PB 4FHKA 5D7GA 4FJVB 4GDKA 1Q0WB 1YQBA 2MQJA 3DOWA 2K39A 2CHWA 1ZGUB 3ENEA 4KSKC 2L7RA 3N32A 4IW0A 4PYZA 5CX3A 3DCGA 2KDBA 3QJZA 3T8MA 3ZLZA 1WJNA 1KJTA 3ECIA 3N3KB 3W1YA 3JSVB 4AJYB 2GBKA 2O6VB 2LGXA 3DVNU 2EKEC 2N4FA 2M4NA 2N1WA 4GMVA 2HTHA 4GGQA 2MX2A 4BOSC 1GNUA 1E7VA 1WY8A 4ZRJA 4BBNC 5KHOA 2IY0B 4IWQA 2WWZA 4MELA 1WMHA 1WFYA 3VUYA 1WE7A 1X1MA 2BKRB 3R3MA 3QHTA 2DYMA 2KDEB 4HDQA 4W9KA 2XK5B 1YD8U 3ZRFA 3QQ8B 3SD5A 4K81A 3UIPB 3X0WA 2LGDA 3L54A 3VTUA 1ISNA 2LZ6A 4G3XB 3AU5A 1UBQA 4AOFA 3IG3A 2KO3A 4EUTA 4IC7B 1MG8A 3KUCB 3JW0X 4MGZE 4NQKE 2L76A 4HPMB 1IYFA 2KD0A 2KVRA 2K8CA 4K7SA 5CHFA 3WAMA 1P98A 2ZPYA 3OJ3A 4BKSD 4MH0E 4PYUA 4RMAA 2MP2A 2KLGA 4IG7B 3M63B 3DVGX 2Z0EB 4I6LB 4E71A 4EZKA 1GC7A 2B3AA 4MGYE 3K9PB 5BO4B 2CHXA 3OAWA 4IM3A 4W9CA 4DHZB 1RFAA 2CU1A 3VH4B 4DXAB 4MJSB 4NNJB 3VTWA 4HK2A 4DDGD 1UH6A 2J0MA 2CHZA 2KNBA 4AUQC 4RM9A 1JRUA 1VD2A 4TQ0A 2JT4B 2KX3A 3A9JA 4GIVA 4E74A 1UZXB 2IO3B 2KKCA 2KTRA 1AARA 1WXAA 1T0YA 2W9NA 1WR6E 3V60A 3ZDTA 1V5TA 4IUMB 2O2VB 3H9DA 4KSLC 1V80A 3L08A 2K6QA 4EOYA 1GUAB 2JUOA 2MA9B 3OJ4B 5AZHA 4BOZB 2KFKA 4BKTA 4NPNA 3JSVA 3I3TB 4GB9A 4M8MA 3DVGY 1Y8RC 3NS8A 3KUDB 2NBWB 1WJUA 2R2QA 1YIWA 2DAFA 2LI5A 2YVCA 2JY6A 2D3GA 2RPQA 2LRUA 4DHJB 2EMSA 2AEHA 4LJOB 3ML9A 2OJRA 2QHOA 4AJWA 3JYUA 3VFKA 3T9LA 1GG3A 1RAXA 2L0TA 3UF8A 4FLHA 4IWPA 3L16A 4TQ1A 3VUWA 4DBGA 2C7HA 4KDIC 2IYDB 4HDOA 2WDTB 4K7WA 3PLVA 3H1UA 3NOBA 2IO2B 4HJKA 3CMMB 4BBNF 2K8HA 4HLEA 2O6VA 4ASWC 2Z0DB 5CHWA 2DYBA 2FAZA 4AWJA 3APFA 4DWFA 2G4DB 4W9LA 4WJQA 3RULA 1R4MI 2M17A 1YX6B 4GU2A 1K8RB 4J6IA 1WI0A 3PPAA 2GBRA 2JWZA 4P7IA 4PS3A 3K9OB 4W9EA 1E90A 4JL9A 4EFOA 3M95A 2L05A 4JQWC 4NAWB 1WGGA 2BGFA 1GC6A 1V6EA 3B08A 3QAQA 4F1SA 1ZW7A 4KIKA 3RZFA 4ZDVA 3TJPA 2UYZB 2LRWA 1WYWB 2KWUB 3OLMD 3GOEA 1V9JA 3QA8A 1Z2MA 3PT2B 1Q1OA 3VQIA 4DK5A 4IM0A 1NBFC 3VUXA 3ZNHB 2AL3A 2BYVE 3ZRCA 1U4AA 2GBJA 2KQSA 2Z59B 5DPTA 5D6JB 4FA6A 2J0JA 3A4SC 1NI2A 1L2NA 4ZRKA 2DZIA 3QCAA 3ZNID 1WX8A 2XEWA 3N30A 1UBIA 1A5RA 1C1YB 2RSUA 5J17A 1WZ0A 2LD9A 2MBEA 3PHXB 3UIOB 3AXCA 4MSQB 3NHEB 3MHSD 3V6EB 3IFWB 1WGHA 2JZZA 1XD3B 2HD5B 3QX1A 1F9JA 1WMHB 5D94A 3MJWA 3UINB 1ZKHA 2FCMA 2LVPA 2V1YA 3NZUA 3TMPB 5E6OA 2AL6A 3V61A 3WAOA 2V3SA 3L10B 1WM2A 2MRPA 3DQVA 3WA0A 3ZTDA 4PS8A 4MGIE 2C9WB 1BT0A 2KMCA 4ICUA 1S3SG 3LDZE 1WX7A 1XT9B 3RT3B 3B0AA 3WALA 1NDDA 4B9KA 2FCSA 2DHZA 1WH3A 3PTFC 1P9DU 5E6PA 4WWOA 2LWPA 1TBEA 2C7NB 3DBSA 3U30A 2O6VD 4B6WA 2KMAA 4ANUA 1P3QU 3NY5A 2K8BA 1EF5A 2IBIB 3UQBA 4WJOA 1Q5WB 2JZ3B 3ML8A 3VXWA 4IWOA 1KLVA 2C7MB 1V5OA 2V4LA 4MJSA 1WE6A 3KH0A 4OVVA 1J0GA 3R7QA 2L3ZA 2N9PC 3LJ3A 2BF8B 1WZ3A 3NZSA 1WR1A 4TKNA 4WWNA 5DPRA 1OGWA 3QC8B 2ZNVB 2XBBC 4ICVA 2MBBB 2KJ6A 3EFUA 4G11A 2MW5A 3RCZA 3SHQA 5L83A 1EUVB 2KDIA 3HK0A 4KZ0A 3PRZA 4WQOB 1WJ6A 4EZJA 2ZZPB 3A9KA 2GBNA 4EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V49 A;  1UD7 A;  1E8Y A;  3ZO5 B;  2KZR A;  4EEW A;  5C1Z A;  1H4R A;  4W9J A;  3VDZ A;  2WX0 A;  4ZRI A;  2LGY A;  2IZV B;  2MBO A;  2O2V A;  4FUL A;  3HM6 X;  2DX5 B;  3A33 B;  4I6N B;  3CST A;  2MWS B;  2HJ8 A;  1SGH A;  2C5L C;  3O65 B;  3Q3F A;  2LAS A;  2D07 B;  2PE9 A;  1M94 A;  2REX A;  3R7R A;  4TUU A;  3UQA A;  3A9J B;  2KK8 A;  4PS7 A;  3PRM B;  4YL8 A;  2NBU A;  1RLF A;  4FBJ B;  2KX0 A;  2MCN B;  5TR5 A;  4KIK B;  1J8C A;  2RR9 A;  4GSW A;  2LVO A;  2J0K A;  3RZW C;  3KVF B;  2FIF A;  1WXS A;  4X57 B;  2A5U A;  4LDT D;  5CHV C;  1YX5 B;  5D2M B;  3Q3J A;  1TTN A;  3P2B A;  4FN2 A;  2MP2 B;  4FJZ A;  3DBH I;  2NBV B;  3CF6 E;  3PV1 A;  4GXB A;  2L8J A;  4HCN B;  5IAA C;  1OTR B;  2CKH B;  5G55 A;  1CMX B;  2GBM A;  5GMV A;  4W9I A;  3H7S A;  4KVG B;  2ZNV C;  4GDK B;  4KDL B;  4W9D A;  2K25 A;  4E3C A;  3U7D A;  5KHQ A;  2KC1 A;  1WF9 A;  1E8X A;  3ZNG C;  1P0R A;  3RUI B;  4HPL B;  2JRH A;  4LCD E;  2CS4 A;  1SIF A;  2DZK A;  3IHP C;  4I6P A;  3ZNZ B;  2XK5 A;  2R2O A;  2N9E B;  4MM3 A;  2OOB B;  3A1Q B;  4M0W B;  2HE7 A;  3BIN A;  5E6N A;  3RYT A;  1SE9 A;  2FNJ B;  4GOC A;  2D2Q A;  4G50 A;  2L0F A;  4A3O A;  5JHA A;  3PLU A;  5G2N A;  3WAP A;  3EC8 A;  4NJ7 A;  1WGY A;  1E8W A;  1RRB A;  4KZC A;  3TBL D;  4JIO U;  4W9F A;  3L0W B;  1V86 A;  3B1L X;  1HE8 A;  3QAR A;  4K1R B;  3WAN A;  4F7Z A;  5L95 C;  2ZCC A;  5DPW A;  2KTF A;  2NS5 A;  5DPS A;  3D32 A;  1VCB A;  2MBQ A;  4WAA A;  2M8S A;  4XC2 A;  1E7U A;  2BKF A;  1P1A A;  3PRE A;  5J18 A;  3H7P A;  1PQS A;  2AYO B;  4GDL A;  1E8Z A;  2FID A;  2PPH A;  4NAW A;  4DDI D;  1WXV A;  4CO7 A;  1WGR A;  4GN1 A;  3DBL I;  2NVU I;  3VAW A;  4W9G A;  3H6N A;  2KAN A;  4G0N B;  1WGD A;  3ZW3 A;  2G4S A;  1LFD A;  2N7E A;  3HIZ A;  3ZKJ C;  4JLC A;  3M62 B;  4MDK E;  2BYF A;  4EZL A;  1QZE A;  4A3P A;  2IO1 B;  5AZF A;  3QK0 A;  3HM3 A;  1TZ1 A;  2MLB A;  5CTR C;  3VVW B;  1FXT B;  1I42 A;  3KYC D;  1LM8 B;  4BKG A;  1IPG A;  2M1M A;  4ZYN A;  1J19 A;  2J7Q B;  2KDF B;  3UGB B;  5LLI A;  5JH5 C;  1KM7 A;  3ZUN A;  3PSE B;  5IA7 A;  2D11 A;  4II2 B;  3DVN V;  1EO6 A;  3VTV A;  5JZE B;  3L17 A;  4RM8 A;  2KQ7 A;  3DDC B;  4BVU C;  2DZM A;  1LQB A;  4WJN A;  2KJH B;  3KYD D;  2G3Q B;  3W1S C;  2NPT B;  2L00 B;  2RGF A;  3ZTC A;  1EF1 A;  4F8C B;  3PGE A;  3V62 A;  5DCN A;  5J2R A;  1G6J A;  3ONS A;  3TL5 A;  2N7D A;  2LXA A;  3PRP B;  4FAD A;  1KOT A;  2FCQ A;  3TCA A;  4CYE A;  2FCN A;  4DHJ D;  1WJ4 A;  3RD2 A;  2LXC A;  2KFK B;  4HVB A;  3ZVV A;  2BWE S;  2KJR A;  4NJ6 A;  2KN5 A;  2KWV B;  4HCP B;  3ALB A;  1TGZ B;  4URK A;  1WM3 A;  4BFR A;  3APC A;  4WWP A;  2ZEQ A;  3KUZ A;  2ZJD A;  4OVU A;  2YLM A;  2PE6 B;  2FUH B;  5C23 A;  1R4N I;  2KTR B;  3A9K B;  4TV3 A;  3QWZ B;  3R66 C;  1YJ1 A;  2NR2 A;  1S1Q B;  3WIM A;  3DPD A;  4N9F 4;  4NY0 A;  5FR6 A;  4ANW A;  4XZ4 A;  3APD A;  1WX9 A;  3QIJ A;  1IP9 A;  1D3Z A;  3IVF A;  2CR5 A;  1WRD B;  2KWC A;  2WYQ A;  1V81 A;  2RD0 A;  3V6C B;  5JHB A;  1WXM A;  3MTN B;  2BYE A;  4W9H A;  2G45 B;  3JVZ X;  3VHT C;  1OEY A;  4ANV A;  3PVL A;  2C60 A;  4A20 A;  4MEM A;  4KV2 A;  2ZPN A;  3AI5 A;  2DYO A;  1OQY A;  3EHV A;  2GOW A;  3C0R B;  1UGM A;  2JPH A;  2PJH A;  4HWI B;  2NCN A;  1XQQ A;  2AWT A;  3EEC A;  3VH3 B;  3X23 A;  4B95 A;  1OEY J;  2ZVN A;  2WX1 A;  3TIX A;  4HXD A;  2A4Z A;  2K1F A;  4M8N A;  2LJ5 A;  2KHW B;  3U8Z A;  5AEK B;  3KW5 B;  2UWQ A;  3HHM A;  4JGH B;  2N9X A;  5EDS A;  4GDL B;  2K6D B;  4ANX A;  2DAJ A;  4FJY A;  2EMT A;  3GZN I;  4LDT B;  2ZVO A;  4NQL B;  2I1K A;  2MSE D;  3AU4 A;  2ZCB A;  2KXJ A;  2GMI C;  2KLC A;  4BKS A;  2KC2 A;  2NPT A;  3SU8 X;  5LXI B;  2N1V A;  1V2Y A;  3AUL A;  4MSM B;  3M3J A;  3ZDM C;  4K7U A;  1L7Y A;  1H8C A;  1LXD A;  4II3 B;  3S2A A;  2I1J A;  2LVQ A;  2ASQ A;  3PHW B;  4WJP A;  4CHK A;  1UEL A;  2LUE A;  2M0X A;  3ZIM A;  2BWF A;  3L13 A;  1E5W A;  5HKH A;  3CSF A;  3IBE A;  2Y5B B;  1GJZ A;  3PZD A;  2IY1 B;  2D10 A;  2DZJ A;  4FHJ A;  3A1Q A;  4AP4 C;  2DEN B;  3DBR I;  2VRR B;  2KFJ A;  4XX5 A;  2MBH A;  2KOX A;  3PS6 A;  1WIA A;  1C3T A;  2BPS A;  3A4R A;  2JF5 A;  3W1S A;  1I35 A;  4MGK E;  5AZG A;  2JRI B;  2PEA A;  2JXX A;  4LJP B;  2IO0 B;  4DHZ E;  2JVC A;  3SDL C;  1Z5S B;  3BY4 B;  5LXH A;  4IM2 A;  3H7P B;  4FHK A;  5D7G A;  4FJV B;  4GDK A;  1Q0W B;  1YQB A;  2MQJ A;  3DOW A;  2K39 A;  2CHW A;  1ZGU B;  3ENE A;  4KSK C;  2L7R A;  3N32 A;  4IW0 A;  4PYZ A;  5CX3 A;  3DCG A;  2KDB A;  3QJZ A;  3T8M A;  3ZLZ A;  1WJN A;  1KJT A;  3ECI A;  3N3K B;  3W1Y A;  3JSV B;  4AJY B;  2GBK A;  2O6V B;  2LGX A;  3DVN U;  2EKE C;  2N4F A;  2M4N A;  2N1W A;  4GMV A;  2HTH A;  4GGQ A;  2MX2 A;  4BOS C;  1GNU A;  1E7V A;  1WY8 A;  4ZRJ A;  4BBN C;  5KHO A;  2IY0 B;  4IWQ A;  2WWZ A;  4MEL A;  1WMH A;  1WFY A;  3VUY A;  1WE7 A;  1X1M A;  2BKR B;  3R3M A;  3QHT A;  2DYM A;  2KDE B;  4HDQ A;  4W9K A;  2XK5 B;  1YD8 U;  3ZRF A;  3QQ8 B;  3SD5 A;  4K81 A;  3UIP B;  3X0W A;  2LGD A;  3L54 A;  3VTU A;  1ISN A;  2LZ6 A;  4G3X B;  3AU5 A;  1UBQ A;  4AOF A;  3IG3 A;  2KO3 A;  4EUT A;  4IC7 B;  1MG8 A;  3KUC B;  3JW0 X;  4MGZ E;  4NQK E;  2L76 A;  4HPM B;  1IYF A;  2KD0 A;  2KVR A;  2K8C A;  4K7S A;  5CHF A;  3WAM A;  1P98 A;  2ZPY A;  3OJ3 A;  4BKS D;  4MH0 E;  4PYU A;  4RMA A;  2MP2 A;  2KLG A;  4IG7 B;  3M63 B;  3DVG X;  2Z0E B;  4I6L B;  4E71 A;  4EZK A;  1GC7 A;  2B3A A;  4MGY E;  3K9P B;  5BO4 B;  2CHX A;  3OAW A;  4IM3 A;  4W9C A;  4DHZ B;  1RFA A;  2CU1 A;  3VH4 B;  4DXA B;  4MJS B;  4NNJ B;  3VTW A;  4HK2 A;  4DDG D;  1UH6 A;  2J0M A;  2CHZ A;  2KNB A;  4AUQ C;  4RM9 A;  1JRU A;  1VD2 A;  4TQ0 A;  2JT4 B;  2KX3 A;  3A9J A;  4GIV A;  4E74 A;  1UZX B;  2IO3 B;  2KKC A;  2KTR A;  1AAR A;  1WXA A;  1T0Y A;  2W9N A;  1WR6 E;  3V60 A;  3ZDT A;  1V5T A;  4IUM B;  2O2V B;  3H9D A;  4KSL C;  1V80 A;  3L08 A;  2K6Q A;  4EOY A;  1GUA B;  2JUO A;  2MA9 B;  3OJ4 B;  5AZH A;  4BOZ B;  2KFK A;  4BKT A;  4NPN A;  3JSV A;  3I3T B;  4GB9 A;  4M8M A;  3DVG Y;  1Y8R C;  3NS8 A;  3KUD B;  2NBW B;  1WJU A;  2R2Q A;  1YIW A;  2DAF A;  2LI5 A;  2YVC A;  2JY6 A;  2D3G A;  2RPQ A;  2LRU A;  4DHJ B;  2EMS A;  2AEH A;  4LJO B;  3ML9 A;  2OJR A;  2QHO A;  4AJW A;  3JYU A;  3VFK A;  3T9L A;  1GG3 A;  1RAX A;  2L0T A;  3UF8 A;  4FLH A;  4IWP A;  3L16 A;  4TQ1 A;  3VUW A;  4DBG A;  2C7H A;  4KDI C;  2IYD B;  4HDO A;  2WDT B;  4K7W A;  3PLV A;  3H1U A;  3NOB A;  2IO2 B;  4HJK A;  3CMM B;  4BBN F;  2K8H A;  4HLE A;  2O6V A;  4ASW C;  2Z0D B;  5CHW A;  2DYB A;  2FAZ A;  4AWJ A;  3APF A;  4DWF A;  2G4D B;  4W9L A;  4WJQ A;  3RUL A;  1R4M I;  2M17 A;  1YX6 B;  4GU2 A;  1K8R B;  4J6I A;  1WI0 A;  3PPA A;  2GBR A;  2JWZ A;  4P7I A;  4PS3 A;  3K9O B;  4W9E A;  1E90 A;  4JL9 A;  4EFO A;  3M95 A;  2L05 A;  4JQW C;  4NAW B;  1WGG A;  2BGF A;  1GC6 A;  1V6E A;  3B08 A;  3QAQ A;  4F1S A;  1ZW7 A;  4KIK A;  3RZF A;  4ZDV A;  3TJP A;  2UYZ B;  2LRW A;  1WYW B;  2KWU B;  3OLM D;  3GOE A;  1V9J A;  3QA8 A;  1Z2M A;  3PT2 B;  1Q1O A;  3VQI A;  4DK5 A;  4IM0 A;  1NBF C;  3VUX A;  3ZNH B;  2AL3 A;  2BYV E;  3ZRC A;  1U4A A;  2GBJ A;  2KQS A;  2Z59 B;  5DPT A;  5D6J B;  4FA6 A;  2J0J A;  3A4S C;  1NI2 A;  1L2N A;  4ZRK A;  2DZI A;  3QCA A;  3ZNI D;  1WX8 A;  2XEW A;  3N30 A;  1UBI A;  1A5R A;  1C1Y B;  2RSU A;  5J17 A;  1WZ0 A;  2LD9 A;  2MBE A;  3PHX B;  3UIO B;  3AXC A;  4MSQ B;  3NHE B;  3MHS D;  3V6E B;  3IFW B;  1WGH A;  2JZZ A;  1XD3 B;  2HD5 B;  3QX1 A;  1F9J A;  1WMH B;  5D94 A;  3MJW A;  3UIN B;  1ZKH A;  2FCM A;  2LVP A;  2V1Y A;  3NZU A;  3TMP B;  5E6O A;  2AL6 A;  3V61 A;  3WAO A;  2V3S A;  3L10 B;  1WM2 A;  2MRP A;  3DQV A;  3WA0 A;  3ZTD A;  4PS8 A;  4MGI E;  2C9W B;  1BT0 A;  2KMC A;  4ICU A;  1S3S G;  3LDZ E;  1WX7 A;  1XT9 B;  3RT3 B;  3B0A A;  3WAL A;  1NDD A;  4B9K A;  2FCS A;  2DHZ A;  1WH3 A;  3PTF C;  1P9D U;  5E6P A;  4WWO A;  2LWP A;  1TBE A;  2C7N B;  3DBS A;  3U30 A;  2O6V D;  4B6W A;  2KMA A;  4ANU A;  1P3Q U;  3NY5 A;  2K8B A;  1EF5 A;  2IBI B;  3UQB A;  4WJO A;  1Q5W B;  2JZ3 B;  3ML8 A;  3VXW A;  4IWO A;  1KLV A;  2C7M B;  1V5O A;  2V4L A;  4MJS A;  1WE6 A;  3KH0 A;  4OVV A;  1J0G A;  3R7Q A;  2L3Z A;  2N9P C;  3LJ3 A;  2BF8 B;  1WZ3 A;  3NZS A;  1WR1 A;  4TKN A;  4WWN A;  5DPR A;  1OGW A;  3QC8 B;  2ZNV B;  2XBB C;  4ICV A;  2MBB B;  2KJ6 A;  3EFU A;  4G11 A;  2MW5 A;  3RCZ A;  3SHQ A;  5L83 A;  1EUV B;  2KDI A;  3HK0 A;  4KZ0 A;  3PRZ A;  4WQO B;  1WJ6 A;  4EZJ A;  2ZZP B;  3A9K A;  2GBN A;  4EKU A; 
#chains in the Genus database with same CATH topology
 1JWM D;  2KZR A;  2LEK A;  2WX0 A;  4I6N B;  3ZXR A;  3Q3F A;  1WXQ A;  2D07 B;  1M94 A;  2KK8 A;  1I4P A;  3PRM B;  1XEE A;  1RM6 C;  1YN3 A;  2KX0 A;  2WXJ A;  5TR5 A;  3MC8 A;  1J8C A;  4K3C A;  3KVF B;  2FIF A;  1WXS A;  4LDT D;  1E6E B;  1J7C A;  5D2M B;  1QLB B;  1TTN A;  3P2B A;  2QCZ A;  2NBV B;  4HCN B;  2OED A;  5G55 A;  3L4P A;  1ESF A;  1I4G A;  4W9I A;  4KVG B;  4E3C A;  2K25 A;  5MPO A;  2QEJ C;  2DZK A;  3ZNZ B;  3A1Q B;  4JE3 B;  5FKA C;  5TSS A;  5E6N A;  1I4X A;  1EU4 A;  3EC8 A;  4P1B C;  4NJ7 A;  1WGY A;  4KZC A;  3N20 C;  1XLN A;  4K1R B;  4RF1 A;  3BII D;  5DPS A;  3D32 A;  2MBQ A;  2M8S A;  2K22 A;  4ZOH C;  4YTM B;  3H7P A;  4GDL A;  1E8Z A;  2FID A;  4DDI D;  4CO7 A;  2ZW1 A;  3AE8 B;  1IBX A;  2KAN A;  4NZL B;  2ICI A;  2N7E A;  1MVK A;  3HIZ A;  1DGJ A;  4JLC A;  2Z8L A;  5AZF A;  3HM3 A;  4DQO C;  2MLB A;  1QKZ A;  1FXT B;  3RFZ B;  4YT0 B;  1I42 A;  1IPG A;  1N63 A;  3UGB B;  3DWM A;  1JW9 D;  4J3O D;  2D11 A;  4M02 A;  2WXH A;  3DDC B;  1HQR D;  2DZM A;  1QOG A;  1JML A;  2KJH B;  2G3Q B;  3PGE A;  2N7D A;  2LXA A;  2MJD A;  4OHJ A;  1J7A A;  4CYE A;  2FCN A;  3RD2 A;  2KFK B;  3TEY A;  2XNA C;  2KWV B;  3ALB A;  2ZJD A;  3FAH A;  4OVU A;  5EE0 A;  2PE6 B;  4C4V A;  4IKG A;  2M19 A;  2KTR B;  3A9K B;  3NVZ A;  3AED B;  3R66 C;  1YJ1 A;  1S1Q B;  3DPD A;  2PTL A;  1JWB D;  3APD A;  3QIJ A;  1D3Z A;  3IVF A;  1FEH A;  2CR5 A;  2WXQ A;  2WYQ A;  3ABV B;  2RD0 A;  1WXM A;  3JVZ X;  3VHT C;  4ANV A;  3HVD A;  1GB1 A;  2IDY A;  4BAX A;  4MEM A;  2OJW A;  2NTT A;  3AI5 A;  1UGM A;  4GLS C;  1MJD A;  4HWI B;  2WX1 A;  3TIX A;  3KWL A;  2K1F A;  1R4N B;  5AEK B;  5EDS A;  2UWQ A;  2K6D B;  2EMT A;  2KXJ A;  2KLC A;  3IXS A;  4L2Y A;  4BKS A;  2WU5 B;  4MSM B;  1C4A A;  1LXD A;  2I1J A;  3PZ8 A;  2LVQ A;  3ZIM A;  1HEZ E;  2DNF A;  1TYG B;  3IBE A;  1KF6 B;  1SXT A;  3C8Y A;  3PZD A;  3FIL A;  3A1Q A;  1VRA B;  2DEN B;  3ZGZ A;  2N0S B;  3AMZ A;  2KOX A;  3W1S A;  1I35 A;  1IBX B;  1VZ8 A;  2G9H D;  4XDC A;  2JU6 X;  4DXG A;  4C7Z A;  5LXH A;  4M01 A;  1T5X D;  1YQB A;  2NMQ A;  4H2A A;  1ZGU B;  5CX3 A;  1SEB D;  1FRR A;  2KAJ A;  3T8M A;  2WP9 B;  1ET9 A;  1SSN A;  3W1Y A;  2GBK A;  2O6V B;  1DOI A;  1V1P A;  1N60 A;  2LGX A;  2N4F A;  2HTH A;  4GGQ A;  2MX2 A;  1WY8 A;  1YN4 A;  1WE7 A;  2DYM A;  3DHH C;  2V4I B;  2XK5 B;  3QQ8 B;  5BYS A;  2MJE A;  3X0W A;  5HHD G;  2KAC A;  2BB6 A;  3I9V 1;  3AU5 A;  4ZRP A;  3TSS A;  4AOF A;  3IG3 A;  2KO3 A;  4MGZ E;  5LNK 1;  1QIL A;  3EGR A;  3AEB B;  4CQN A;  4K7S A;  1P98 A;  2ZPY A;  4BKS D;  1HTQ A;  3P4Q B;  3DVG X;  2Z0E B;  1JWS D;  1GC7 A;  2B3A A;  5BO4 B;  2G1E A;  3FKY A;  3GE3 C;  3IAM 1;  4NNJ B;  3RNF C;  1FM0 D;  5H8Y E;  4AUQ C;  4RM9 A;  2KX3 A;  3IAS 1;  2KKC A;  1PGX A;  4ARC A;  3V60 A;  1TKG A;  4DXF A;  4JX1 C;  3H9D A;  4KSL C;  3L08 A;  5JXV A;  1YJI A;  4LTU A;  3NZ3 A;  3GZN B;  3KQ4 A;  1KLG D;  1YIW A;  2D3B A;  3AEA B;  1AYF A;  2YVC A;  1TS2 A;  3ML9 A;  1RAX A;  2L0T A;  3L16 A;  4S17 A;  2IYD B;  1VLB A;  2WDT B;  4HJK A;  1N5W A;  4HLE A;  2O6V A;  2FAZ A;  3HRD D;  3APF A;  4DWF A;  4W9L A;  2M17 A;  4J6I A;  1WI0 A;  3PPA A;  4ITK A;  4PS3 A;  2ZW0 A;  2OHF A;  3K9O B;  2L05 A;  1V6E A;  4F1S A;  1ZW7 A;  4KIK A;  3RZF A;  1WYW B;  3GOE A;  4N58 A;  1QOA A;  1Q1O A;  1SIJ A;  3FIL B;  3VUX A;  3ZNH B;  2AL3 A;  2BYV E;  3E9S A;  1SB3 C;  3RNG C;  4ZRK A;  2XEW A;  5J17 A;  1CK1 A;  3PHX B;  2WS3 B;  5HG2 A;  1XD3 B;  2HD5 B;  1J7B A;  1WMH B;  5D94 A;  3MJW A;  3U2S C;  2TSS A;  3UIN B;  2V1Y A;  1EM7 A;  2WGS A;  5BYR A;  1DOX A;  1VJK A;  1WX7 A;  1FCL A;  2X38 A;  1P9D U;  2M56 B;  3Q6B A;  2RMM A;  4M0W A;  1TBE A;  1P3Q U;  4WJO A;  4IWO A;  1WE6 A;  3KH0 A;  4A9A A;  4ARI A;  1Q10 A;  3QC8 B;  2MW5 A;  3RCZ A;  1QOB A;  2V9H A;  3UI3 A;  4EZJ A;  3A9K A;  2INC C;  1PDX A;  4HKZ E;  1E8Y A;  5I4D A;  4EEW A;  1K50 A;  5C1Z A;  4W9J A;  3VDZ A;  5AUI A;  1ZP0 B;  4RGN A;  1C76 A;  4FUL A;  3HM6 X;  3A33 B;  3RI7 C;  2GRI A;  3UQA A;  1STE A;  3NS1 A;  4PS7 A;  1PUT A;  3IT6 B;  4FBJ B;  2BS2 B;  2Y3A A;  3NVY A;  3I57 A;  3VR9 B;  3Q8E A;  4FJZ A;  4PK1 A;  2L8J A;  1D5X C;  2GBM A;  2MEK A;  3H7S A;  2ZNV C;  4GDK B;  3NRZ A;  3ZJV A;  2QIL A;  2KC1 A;  1WF9 A;  2W82 A;  1FNU A;  2JRH A;  3P63 A;  1JRP A;  4LCD E;  3IHP C;  2IGG A;  2XK5 A;  1JAL A;  4GOC A;  2D2Q A;  4G50 A;  2L0F A;  4A3O A;  5JHA A;  3PLU A;  3WAP A;  3RN9 C;  5IN7 A;  1ACC A;  2LGI A;  1E8W A;  3TBL D;  4JIO U;  1V86 A;  5DPW A;  2J42 A;  2ZCC A;  2KTF A;  2NS5 A;  1E7U A;  1FMA D;  2BKF A;  1I4R A;  3B2F A;  3PRE A;  4K3B A;  1PQS A;  2LFI A;  4NAW A;  5H92 C;  1MPE A;  4GN1 A;  3ZW3 A;  1LFD A;  2DLB A;  4QAY A;  2IND C;  2IO1 B;  5CTR C;  3LYY A;  3AM9 A;  3ZJT A;  4BKG A;  5JZE B;  3L17 A;  5C3J B;  1NYQ A;  1C79 A;  3KYD D;  3W1S C;  2NPT B;  2L00 B;  2RGF A;  3C19 A;  4ACF A;  1ZDV A;  3AH7 A;  1FNV A;  4L23 A;  1KOT A;  1SF0 A;  2AQ3 B;  4DHJ D;  1WJ4 A;  2LXC A;  2AX5 A;  3ZVV A;  4Q2J A;  2WXN A;  1N6Z A;  2WXI A;  2BBC A;  3KUZ A;  2YLM A;  4BZA A;  2NTS A;  4XWW A;  1UWX A;  1K52 A;  2NR2 A;  4B0E A;  3GS2 A;  3V05 A;  2IGD A;  4XGA B;  2PMV A;  4ANW A;  1YOV B;  5HI1 A;  2QIE B;  1TJE A;  5JHB A;  2WDQ B;  1L5P A;  1V1O A;  2BYE A;  3MHZ A;  2J52 A;  3PVL A;  4KV2 A;  2QC8 A;  2ZPN A;  2GOW A;  3C0R B;  2W55 A;  3OWE B;  1HZ6 A;  2NCN A;  1XQQ A;  3VH3 B;  3X23 A;  1FXA A;  5E6J A;  3Q8C A;  4M8N A;  4P1C C;  1EWC A;  5EE9 A;  1K53 A;  5BMI A;  4JGH B;  2GB1 A;  4FJY A;  2ZVO A;  4NQL B;  3LXF A;  2KC2 A;  3SU8 X;  5LXI B;  3AUL A;  3M3J A;  1L7Y A;  3MFG A;  3TEW A;  4II3 B;  3S2A A;  4WJP A;  4XYC A;  2LUE A;  1FCC C;  3L13 A;  4LNN A;  3AE1 B;  4AP4 C;  2Y5P A;  3Q8F A;  1NVI D;  2VRR B;  1C3T A;  3SEB A;  1L0Y B;  3BY4 B;  5D7G A;  3H7P B;  4FJV B;  1F2R I;  1Q0W B;  4REZ A;  4KGS A;  2K39 A;  2WXR A;  4KSK C;  3N32 A;  4PYZ A;  3ZLZ A;  1WJN A;  3ECI A;  3N3K B;  3W5V B;  4ZYS A;  1WSP A;  2MJ3 A;  2FE8 A;  2JSV X;  3DVN U;  2D5G A;  2M4N A;  2PLP A;  1OQR A;  2IY0 B;  4IWQ A;  2WWZ A;  1WMH A;  1SJH D;  3VUY A;  1GB4 A;  2JYE A;  2BKR B;  3QHT A;  3MC9 A;  2SEB D;  2N9L A;  2E3T A;  1YD8 U;  4YSY B;  3UIP B;  1ISN A;  4EUT A;  4IC7 B;  3JW0 X;  2CU3 A;  2KD0 A;  1XLQ A;  1VZ6 A;  3Q8B A;  2K8C A;  2YEP F;  2Y5C A;  2WXG A;  5CHF A;  4MH0 E;  4PYU A;  4IG7 B;  3RNC C;  3TUO A;  4WIP A;  3KWV A;  1F52 A;  1ZXI A;  4MGY E;  4WUR A;  2CHX A;  3OAW A;  4IM3 A;  4M00 A;  3AEC B;  4OZC A;  4W9C A;  2CU1 A;  2H89 B;  4HK2 A;  1GAQ B;  1UGJ A;  1JQ4 A;  1JRU A;  3P1M A;  4JWU C;  2RDH A;  4E74 A;  2PVG C;  1P7F A;  1VZ7 A;  2AQ2 B;  3ZDT A;  1E7P B;  1V5T A;  4LLG M;  2O2V B;  4N6E B;  3AE9 B;  3PZ7 A;  2WU2 B;  1HZ5 A;  4RGT A;  3OJ4 B;  4BOZ B;  4NPN A;  2NBW B;  2JY6 A;  2LRU A;  2EMS A;  2AEH A;  4WH4 A;  2LHE A;  1QOF A;  2OJR A;  3Q2A C;  2QHO A;  3JYU A;  1EWY C;  3T9L A;  1GG3 A;  4FLH A;  3ETR A;  4IWP A;  1F0Z A;  4HDO A;  4K7W A;  3H1U A;  2IO2 B;  4BBN F;  2K8H A;  4ASW C;  2Z0D B;  5CHW A;  2DYB A;  2G4D B;  1YX6 B;  4GU2 A;  1YQ3 B;  2GBR A;  4RH6 A;  3N1Y C;  2BT6 A;  2JX5 A;  4JL9 A;  1YJJ A;  4JQW C;  4NAW B;  1WGG A;  2BGF A;  3Q14 C;  4C80 A;  3AB5 A;  3RNA C;  2INN E;  1TS3 A;  1Z2M A;  3VQI A;  3BK1 A;  3ZRC A;  2GBJ A;  2KQS A;  5DPT A;  2K3U A;  5D6J B;  3W2D A;  3A4S C;  1NI2 A;  4B0M A;  1KRH A;  2KN4 A;  3ZJU A;  1WZ0 A;  2MBE A;  3UIO B;  3AXC A;  4MSQ B;  3URY A;  2WDV B;  2W54 A;  1WGH A;  2JZZ A;  2L52 A;  1F9J A;  2FUG 1;  2FCM A;  2LVP A;  3U52 E;  5E6O A;  2V3S A;  4O1N A;  1TT5 B;  4C00 A;  2C9W B;  1S3S G;  3RT3 B;  1XT9 B;  3T3N A;  1NDD A;  4B9K A;  2DHZ A;  1WH3 A;  4WWO A;  1BML C;  1VR9 A;  3P4S B;  4MAC A;  2LWP A;  2C7N B;  2QJL A;  2O6V D;  1KLU D;  4B6W A;  3NY5 A;  3RPF C;  1EF5 A;  1PFD A;  3VXW A;  4USA A;  1V5O A;  4KKJ A;  5AUK A;  2V4L A;  4ZHO A;  1J0G A;  3LJ3 A;  1MG4 A;  2BF8 B;  3NZS A;  4WWN A;  2WXF A;  1OGW A;  1L6V A;  1Y56 A;  3SHQ A;  2KDI A;  4KZ0 A;  3O13 A;  3PRZ A;  3VR8 B;  1NYR A;  1UD7 A;  1H4R A;  3EA6 A;  2LGY A;  2IZV B;  1TS5 A;  1KH0 A;  3CST A;  2MWS B;  2QDF A;  1SGH A;  3OG5 A;  3A9J B;  4YL8 A;  3Q3M C;  1UF0 A;  3RNE C;  2VZK D;  2MCN B;  4KIK B;  2RR9 A;  4YTP B;  2J0K A;  3RZW C;  4X57 B;  3J9C A;  1NEK B;  3P4P B;  5IO9 A;  2MP2 B;  3PV1 A;  1VDV A;  1OTR B;  2CKH B;  4XWT A;  1CMX B;  4FXC A;  3W9C B;  4S0R A;  4KDL B;  4W9D A;  3U7D A;  5KHQ A;  1E8X A;  2V3N A;  1P0R A;  3RUI B;  4HPL B;  1UNS A;  1I4Q A;  2MH7 A;  1YN5 A;  1SIF A;  2CS4 A;  4I6P A;  4TSS A;  2N9E B;  4M0W B;  3BIN A;  1SE9 A;  2FNJ B;  5G2N A;  1RRB A;  2L83 A;  4W9F A;  3L0W B;  1SJE D;  1XLO A;  2M0A A;  3U4E G;  1T0R C;  4XC2 A;  2IPK D;  2AYO B;  1ET6 A;  1WGR A;  1SE3 A;  3DBL I;  5FK9 C;  4RGM A;  3ZKJ C;  1T3Q A;  2BYF A;  1QZE A;  4A3P A;  2PW9 A;  3VVW B;  3KYC D;  1LM8 B;  4ZYN A;  3AE3 B;  2J7Q B;  5JH5 C;  1KM7 A;  3ZUN A;  1I7H A;  4II2 B;  3DVN V;  1EO6 A;  4RM8 A;  4BVU C;  1HA5 A;  4TMA B;  1EF1 A;  4F8C B;  4A6Q A;  3V62 A;  5DCN A;  1G6J A;  3ONS A;  4A90 A;  1GOZ A;  4FAD A;  2JYT A;  4YSX B;  3TCA A;  2AQ1 B;  3AE2 B;  2B76 B;  4HVB A;  2LMC A;  2KJR A;  1A70 A;  4HCP B;  4URK A;  3LB8 C;  1N62 A;  3APC A;  4WWP A;  3BVM A;  2ZEQ A;  3PO0 A;  1OQQ A;  1TZO A;  2RDB C;  4TV3 A;  4D2K A;  3QWZ B;  3DWG C;  1FPY A;  1R7S A;  4N9F 4;  4KGR A;  4NY0 A;  2D3C A;  2KWD A;  2ON8 A;  2KMM A;  4WQM A;  5T8I A;  1IGC A;  1IP9 A;  4NAM A;  4LNK A;  1WRD B;  3AEF B;  1B9R A;  1V81 A;  3V6C B;  1TY0 A;  2ONQ A;  1MHH E;  1OEY A;  4OZA A;  2C60 A;  4A20 A;  2EEL A;  3B2G A;  3EEC A;  2AWT A;  1OEY J;  4HXD A;  2A4Z A;  2CJN A;  4OVZ A;  2LJ5 A;  1D5Z C;  2KHW B;  3U8Z A;  1LO5 D;  2BW2 A;  3HHM A;  3KW5 B;  3P42 A;  4ANX A;  3GZN I;  4LDT B;  3BYY B;  2I1K A;  2MSE D;  2ZCB A;  2GMI C;  3GP7 A;  2N1V A;  1V2Y A;  2CJO A;  1CQV A;  3ZDM C;  4K7U A;  4CHK A;  3PHW B;  3N1X C;  2M0X A;  3CSF A;  2Y5B B;  2GI9 A;  2IY1 B;  2I2Y A;  1CJE A;  2YEP B;  1FFV A;  2V0G A;  3MJ5 A;  4XX5 A;  2MHJ A;  3A4R A;  1XCQ L;  4MT5 A;  2JWU A;  3DBL B;  3ZXV A;  1FO4 A;  3EFC A;  3AV8 A;  4MGK E;  5AZG A;  2JRI B;  2PEA A;  3DHG C;  2JXX A;  4LJP B;  2IO0 B;  4DHZ E;  1Z5S B;  1FFU A;  1XO3 A;  4IM2 A;  4FHK A;  3N9Y C;  2LGS A;  2CHW A;  3ENE A;  4IW0 A;  3SFE B;  3RMK C;  3QJZ A;  2GLS A;  4HRS A;  4C4V B;  1TKY A;  3WCQ A;  4BOS C;  1E7V A;  3NUH B;  4BBN C;  1IGD A;  2LJI A;  1X1M A;  3R3M A;  2PVO D;  4W9K A;  3KLS X;  3ZRF A;  1F1H A;  3SD5 A;  4YWG G;  2LGD A;  3VTU A;  2LZ6 A;  4G3X B;  1UBQ A;  1TKE A;  2L76 A;  1ZDX A;  4HPM B;  1IYF A;  2MP2 A;  2KLG A;  2L32 A;  3M63 B;  5HFY A;  4I6L B;  4E71 A;  4R3D A;  2BS4 B;  4DHZ B;  3VH4 B;  4DXA B;  3VTW A;  4XDD A;  4DDG D;  1UH6 A;  1V97 A;  1MI0 A;  2J0M A;  4RCO A;  2KNB A;  4TQ0 A;  2JT4 B;  3AE4 B;  4GIV A;  1UZX B;  2KTR A;  3T3O A;  2W9N A;  1T0Y A;  4PT5 A;  2K5P A;  4IUM B;  4N59 A;  4KX6 B;  1N5X A;  4LNO A;  4EOY A;  2K6Q A;  1GUA B;  2JUO A;  2MA9 B;  1AWD A;  1V1P B;  2KFK A;  3JSV A;  1JRO A;  3Q3O C;  3DVG Y;  1Y8R C;  3NS8 A;  1PGA A;  3KUD B;  1WJU A;  4WAF A;  2LI5 A;  1D5M C;  1HXY D;  4LJO B;  4AJW A;  3VFK A;  4TQ1 A;  3GB1 A;  3VUW A;  4LNI A;  4DBG A;  2C7H A;  5GXG B;  1C77 A;  1FD6 A;  3NOB A;  2QSD A;  1PYW D;  2DWQ A;  1XLP A;  1I4H A;  3DBH B;  2Q5W D;  2JXT A;  4WJQ A;  1R4M I;  3RUL A;  1F2R C;  1L6U A;  4LK0 M;  1E90 A;  4EFO A;  3M95 A;  2L1A A;  1GC6 A;  3QAQ A;  3BVZ A;  4ZHP A;  4ZDV A;  2LRW A;  3VRA B;  1ZUD 2;  1V9J A;  3PT2 B;  4IM0 A;  1NBF C;  3P4R B;  2Z59 B;  3BYT B;  5D3D A;  4HPP A;  4FA6 A;  3QCA A;  3ZNI D;  1WX8 A;  1A5R A;  1C1Y B;  4KGT A;  2LD9 A;  3CIR B;  3NHE B;  2IJ0 A;  3E56 A;  3R8B A;  1ZKH A;  1DOY A;  4HKQ A;  1TS4 A;  3NZU A;  3TMP B;  2AL6 A;  2WXO A;  3GE8 C;  3L10 B;  3DQV A;  2MRP A;  3ZTD A;  4PS8 A;  4MGI E;  1BT0 A;  1ENF A;  2KMC A;  4ICU A;  3AEE B;  3W5U B;  3WAL A;  1WWT A;  5G5G A;  1GPX A;  1RFK A;  3DBS A;  4US9 A;  2KMA A;  1RWS A;  4P6V F;  2LUM A;  2KYW A;  1JWA D;  1ZPS A;  2JZ3 B;  2WLB A;  1BUI C;  1ZOY B;  4OVV A;  1C4P A;  2L3Z A;  1D6E C;  4TKN A;  1WZ3 A;  5DPR A;  4ICV A;  2MBB B;  2KJ6 A;  3EFU A;  4G11 A;  5L83 A;  5J2R A;  4WQO B;  1WJ6 A;  1MHX A;  4EKU A;  3NVW A;  1V49 A;  3ZO5 B;  4ZRI A;  2JQR B;  2MBO A;  2O2V A;  2DX5 B;  1K51 A;  2HJ8 A;  2C5L C;  3O65 B;  2LAS A;  4NJC A;  2PE9 A;  2REX A;  2H88 B;  3R7R A;  4TUU A;  1WRI A;  1C4C A;  1JWU D;  3H8H A;  4JWS C;  1SBB B;  2NBU A;  1RLF A;  3BZD B;  4GSW A;  2LVO A;  3ZYY X;  1JCK B;  2A5U A;  1FRD A;  5CHV C;  1YX5 B;  3Q3J A;  4P16 A;  1F77 A;  4FN2 A;  3DBH I;  2K9X A;  3CF6 E;  3SR6 A;  4GXB A;  4RNA A;  5IAA C;  2PKO A;  3AN1 A;  5GMV A;  1T0S C;  3N1Z C;  1T0Q C;  2J4X A;  5BMG A;  1B1Z A;  5BYQ A;  3ZNG C;  2D3A A;  4MM3 B;  4A55 A;  2WHI A;  2R2O A;  4MM3 A;  2OOB B;  2HE7 A;  3RYT A;  4HEA 1;  3EUB 2;  1QT9 A;  2BVC A;  2FBW B;  2WXK A;  3B1L X;  1HE8 A;  3QAR A;  4RFB A;  3WAN A;  5L95 C;  4F7Z A;  1VCB A;  4WAA A;  4WWM A;  3AEG B;  1LGR A;  1NEN B;  1P1A A;  5G5H A;  5J18 A;  3SFD B;  3AE5 B;  2PPH A;  1WXV A;  1PGB A;  2NVU I;  3VAW A;  4W9G A;  3H6N A;  4G0N B;  1WGD A;  2G4S A;  2VH2 A;  4MDK E;  3M62 B;  4EZL A;  1UUP A;  4EE2 A;  3QK0 A;  1ROE A;  1TZ1 A;  1XF5 L;  2M1M A;  4C7Y A;  1J19 A;  2KDF B;  5LLI A;  2PIA A;  2HJ1 A;  3PSE B;  5IA7 A;  3VTV A;  1AN8 A;  2KQ7 A;  1LQB A;  3MC0 B;  4WJN A;  5FR3 A;  3ZTC A;  3TL5 A;  2I38 A;  3PRP B;  2FCQ A;  1L4Z B;  4IOI E;  1YQ4 B;  5BMH A;  4UDU C;  2BWE S;  2E6X A;  4NJ6 A;  2KN5 A;  5C2T B;  1TGZ B;  1WM3 A;  4BFR A;  3U7Z A;  2SAK A;  2FUH B;  5C23 A;  1R4N I;  1YMH E;  2BS3 B;  3WIM A;  5FR6 A;  1QQR A;  1EU3 A;  4XZ4 A;  1WX9 A;  2BQQ A;  2KWC A;  3I5J C;  2WNM A;  1KTK A;  3MTN B;  4W9H A;  2G45 B;  2DBY A;  2IGH A;  4RF0 A;  2X8X X;  3BVG A;  3TEX A;  1L4D B;  3R2I A;  1FIQ A;  1UWM A;  2DYO A;  1OQY A;  3EHV A;  3Q8A A;  2JPH A;  2PJH A;  2WQY B;  2HDE A;  2BYT A;  1KFY B;  4HJG E;  4B95 A;  2ZVN A;  1BXT A;  1ZXH A;  2N7J A;  2LHD A;  1M4V A;  4L1B A;  3RNB C;  2N9X A;  4GDL B;  2DAJ A;  2KT7 A;  3AU4 A;  2NPT A;  3HVZ A;  4HRO A;  2J53 A;  1H8C A;  1TIF A;  2ASQ A;  4MH8 A;  3NJT A;  4IDI A;  1UEL A;  3V3X A;  2BWF A;  1E5W A;  4YTN B;  5HKH A;  3AE7 B;  4LNF A;  2WDR B;  1GJZ A;  2D10 A;  4OZB A;  2DZJ A;  4FHJ A;  1WYG A;  5IOI A;  3Q3N C;  3DBR I;  1AW7 A;  2KFJ A;  2MBH A;  3PS6 A;  1WIA A;  2BPS A;  2JF5 A;  4YSZ B;  1D4B A;  2HTM E;  2JVC A;  3SDL C;  4GDK A;  3DOW A;  2MQJ A;  4YXD B;  3DHI C;  1OFF A;  2L7R A;  5EE3 A;  1E9M A;  1XXG A;  1FNW A;  3DCG A;  2KDB A;  1KJT A;  3JSV B;  4AJY B;  1L0X B;  4GMV A;  4JPS A;  2EKE C;  2N1W A;  1GNU A;  4ZRJ A;  2BTE A;  1TY2 A;  5KHO A;  4MEL A;  1WFY A;  2KDE B;  4HDQ A;  1DYQ A;  4C56 C;  4K81 A;  3L54 A;  5IKC M;  3BK2 A;  2VZK B;  1MG8 A;  3KUC B;  3NG0 A;  3HUI A;  3AE6 B;  3NVV A;  4NQK E;  2KVR A;  3WAM A;  3OJ3 A;  1WGK A;  3VRB B;  2ACZ B;  4RMA A;  2RPV A;  4EZK A;  1NI3 A;  1V8C A;  1C9F A;  3K9P B;  1N61 A;  1RFA A;  4A8X C;  4MJS B;  2W3R A;  2WXL A;  5D3I B;  2CHZ A;  1VD2 A;  3A9J A;  2IO3 B;  4ZRQ A;  1AAR A;  1WXA A;  1WR6 E;  1V80 A;  1RYJ A;  5AZH A;  4BKT A;  2XN9 C;  3I3T B;  4GB9 A;  4M8M A;  1QF6 A;  2R2Q A;  2DAF A;  4AQ7 A;  2D3G A;  2RPQ A;  2R61 A;  4DHJ B;  2UU7 A;  1T6B X;  1L0V B;  1XCT L;  3IT4 B;  1SE2 A;  1FXI A;  2KDM A;  3UF8 A;  4KDI C;  3PLV A;  3CMM B;  3Q69 A;  2RDG A;  3I63 C;  4AWJ A;  1IUE A;  3DBR B;  5IP4 D;  1K8R B;  2QMT A;  3B9J A;  2JWZ A;  4P7I A;  4W9E A;  3B08 A;  3TJP A;  2UYZ B;  1ZE3 D;  2KWU B;  3OLM D;  1SE4 A;  3QA8 A;  4DK5 A;  1P7E A;  1U4A A;  2WXP A;  2JZP A;  2W3S A;  4XE0 A;  3MP9 A;  2J0J A;  4RGO S;  1L2N A;  2DZI A;  3N30 A;  1UBI A;  2RSU A;  2VH1 A;  4KKI A;  4US8 A;  3MHS D;  1R4M B;  2N9K A;  3V6E B;  3IFW B;  3QX1 A;  1YNT E;  2V3P A;  3BWU D;  2EKI A;  3V61 A;  3WAO A;  3ZQ4 A;  1WM2 A;  3WA0 A;  3LDZ E;  3B0A A;  4AS1 A;  2FCS A;  2WXM A;  3CWI A;  3PTF C;  5E6P A;  3R2T A;  1C78 A;  3U30 A;  1MFW A;  1E0Z A;  4ANU A;  1CZP A;  2K8B A;  1HTO A;  2INP E;  2IBI B;  3UQB A;  1Q5W B;  3ML8 A;  2KQ4 X;  1KLV A;  2C7M B;  4OW0 A;  4MJS A;  3R7Q A;  2BB5 A;  3TEZ A;  3FC4 A;  2N9P C;  5EE1 A;  1WR1 A;  2ZNV B;  2XBB C;  2K0P A;  1EUV B;  3HK0 A;  1E10 A;  2ZZP B;  2GBN A;  2KVZ A; 
#chains in the Genus database with same CATH homology
 1V49 A;  1UD7 A;  1E8Y A;  3ZO5 B;  2KZR A;  4EEW A;  5C1Z A;  1H4R A;  4W9J A;  3VDZ A;  2WX0 A;  4ZRI A;  2LGY A;  2IZV B;  2MBO A;  2O2V A;  4FUL A;  3HM6 X;  2DX5 B;  3A33 B;  4I6N B;  3CST A;  2MWS B;  2HJ8 A;  1SGH A;  2C5L C;  3O65 B;  3Q3F A;  2LAS A;  2D07 B;  2PE9 A;  1M94 A;  2REX A;  3R7R A;  4TUU A;  3UQA A;  3A9J B;  2KK8 A;  4PS7 A;  3PRM B;  4YL8 A;  2NBU A;  1RLF A;  4FBJ B;  2KX0 A;  2MCN B;  5TR5 A;  4KIK B;  1J8C A;  2RR9 A;  4GSW A;  2LVO A;  2J0K A;  3RZW C;  3KVF B;  2FIF A;  1WXS A;  4X57 B;  2A5U A;  4LDT D;  5CHV C;  1YX5 B;  5D2M B;  3Q3J A;  1TTN A;  3P2B A;  4FN2 A;  2MP2 B;  4FJZ A;  3DBH I;  2NBV B;  3CF6 E;  3PV1 A;  4GXB A;  2L8J A;  4HCN B;  5IAA C;  1OTR B;  2CKH B;  5G55 A;  1CMX B;  2GBM A;  5GMV A;  4W9I A;  3H7S A;  4KVG B;  2ZNV C;  4GDK B;  4KDL B;  4W9D A;  2K25 A;  4E3C A;  3U7D A;  5KHQ A;  2KC1 A;  1WF9 A;  1E8X A;  3ZNG C;  1P0R A;  3RUI B;  4HPL B;  2JRH A;  4LCD E;  2CS4 A;  1SIF A;  2DZK A;  3IHP C;  4I6P A;  3ZNZ B;  2XK5 A;  2R2O A;  2N9E B;  4MM3 A;  2OOB B;  3A1Q B;  4M0W B;  2HE7 A;  3BIN A;  5E6N A;  3RYT A;  1SE9 A;  2FNJ B;  4GOC A;  2D2Q A;  4G50 A;  2L0F A;  4A3O A;  5JHA A;  3PLU A;  5G2N A;  3WAP A;  3EC8 A;  4NJ7 A;  1WGY A;  1E8W A;  1RRB A;  4KZC A;  3TBL D;  4JIO U;  4W9F A;  3L0W B;  1V86 A;  3B1L X;  1HE8 A;  3QAR A;  4K1R B;  3WAN A;  4F7Z A;  5L95 C;  2ZCC A;  5DPW A;  2KTF A;  2NS5 A;  5DPS A;  3D32 A;  1VCB A;  2MBQ A;  4WAA A;  2M8S A;  4XC2 A;  1E7U A;  2BKF A;  1P1A A;  3PRE A;  5J18 A;  3H7P A;  1PQS A;  2AYO B;  4GDL A;  1E8Z A;  2FID A;  2PPH A;  4NAW A;  4DDI D;  1WXV A;  4CO7 A;  1WGR A;  4GN1 A;  3DBL I;  2NVU I;  3VAW A;  4W9G A;  3H6N A;  2KAN A;  4G0N B;  1WGD A;  3ZW3 A;  2G4S A;  1LFD A;  2N7E A;  3HIZ A;  3ZKJ C;  4JLC A;  3M62 B;  4MDK E;  2BYF A;  4EZL A;  1QZE A;  4A3P A;  2IO1 B;  5AZF A;  3QK0 A;  3HM3 A;  1TZ1 A;  2MLB A;  5CTR C;  3VVW B;  1FXT B;  1I42 A;  3KYC D;  1LM8 B;  4BKG A;  1IPG A;  2M1M A;  4ZYN A;  1J19 A;  2J7Q B;  2KDF B;  3UGB B;  5LLI A;  5JH5 C;  1KM7 A;  3ZUN A;  3PSE B;  5IA7 A;  2D11 A;  4II2 B;  3DVN V;  1EO6 A;  3VTV A;  5JZE B;  3L17 A;  4RM8 A;  2KQ7 A;  3DDC B;  4BVU C;  2DZM A;  1LQB A;  4WJN A;  2KJH B;  3KYD D;  2G3Q B;  3W1S C;  2NPT B;  2L00 B;  2RGF A;  3ZTC A;  1EF1 A;  4F8C B;  3PGE A;  3V62 A;  5DCN A;  5J2R A;  1G6J A;  3ONS A;  3TL5 A;  2N7D A;  2LXA A;  3PRP B;  4FAD A;  1KOT A;  2FCQ A;  3TCA A;  4CYE A;  2FCN A;  4DHJ D;  1WJ4 A;  3RD2 A;  2LXC A;  2KFK B;  4HVB A;  3ZVV A;  2BWE S;  2KJR A;  4NJ6 A;  2KN5 A;  2KWV B;  4HCP B;  3ALB A;  1TGZ B;  4URK A;  1WM3 A;  4BFR A;  3APC A;  4WWP A;  2ZEQ A;  3KUZ A;  2ZJD A;  4OVU A;  2YLM A;  2PE6 B;  2FUH B;  5C23 A;  1R4N I;  2KTR B;  3A9K B;  4TV3 A;  3QWZ B;  3R66 C;  1YJ1 A;  2NR2 A;  1S1Q B;  3WIM A;  3DPD A;  4N9F 4;  4NY0 A;  5FR6 A;  4ANW A;  4XZ4 A;  3APD A;  1WX9 A;  3QIJ A;  1IP9 A;  1D3Z A;  3IVF A;  2CR5 A;  1WRD B;  2KWC A;  2WYQ A;  1V81 A;  2RD0 A;  3V6C B;  5JHB A;  1WXM A;  3MTN B;  2BYE A;  4W9H A;  2G45 B;  3JVZ X;  3VHT C;  1OEY A;  4ANV A;  3PVL A;  2C60 A;  4A20 A;  4MEM A;  4KV2 A;  2ZPN A;  3AI5 A;  2DYO A;  1OQY A;  3EHV A;  2GOW A;  3C0R B;  1UGM A;  2JPH A;  2PJH A;  4HWI B;  2NCN A;  1XQQ A;  2AWT A;  3EEC A;  3VH3 B;  3X23 A;  4B95 A;  1OEY J;  2ZVN A;  2WX1 A;  3TIX A;  4HXD A;  2A4Z A;  2K1F A;  4M8N A;  2LJ5 A;  2KHW B;  3U8Z A;  5AEK B;  3KW5 B;  2UWQ A;  3HHM A;  4JGH B;  2N9X A;  5EDS A;  4GDL B;  2K6D B;  4ANX A;  2DAJ A;  4FJY A;  2EMT A;  3GZN I;  4LDT B;  2ZVO A;  4NQL B;  2I1K A;  2MSE D;  3AU4 A;  2ZCB A;  2KXJ A;  2GMI C;  2KLC A;  4BKS A;  2KC2 A;  2NPT A;  3SU8 X;  5LXI B;  2N1V A;  1V2Y A;  3AUL A;  4MSM B;  3M3J A;  3ZDM C;  4K7U A;  1L7Y A;  1H8C A;  1LXD A;  4II3 B;  3S2A A;  2I1J A;  2LVQ A;  2ASQ A;  3PHW B;  4WJP A;  4CHK A;  1UEL A;  2LUE A;  2M0X A;  3ZIM A;  2BWF A;  3L13 A;  1E5W A;  5HKH A;  3CSF A;  3IBE A;  2Y5B B;  1GJZ A;  3PZD A;  2IY1 B;  2D10 A;  2DZJ A;  4FHJ A;  3A1Q A;  4AP4 C;  2DEN B;  3DBR I;  2VRR B;  2KFJ A;  4XX5 A;  2MBH A;  2KOX A;  3PS6 A;  1WIA A;  1C3T A;  2BPS A;  3A4R A;  2JF5 A;  3W1S A;  1I35 A;  4MGK E;  5AZG A;  2JRI B;  2PEA A;  2JXX A;  4LJP B;  2IO0 B;  4DHZ E;  2JVC A;  3SDL C;  1Z5S B;  3BY4 B;  5LXH A;  4IM2 A;  3H7P B;  4FHK A;  5D7G A;  4FJV B;  4GDK A;  1Q0W B;  1YQB A;  2MQJ A;  3DOW A;  2K39 A;  2CHW A;  1ZGU B;  3ENE A;  4KSK C;  2L7R A;  3N32 A;  4IW0 A;  4PYZ A;  5CX3 A;  3DCG A;  2KDB A;  3QJZ A;  3T8M A;  3ZLZ A;  1WJN A;  1KJT A;  3ECI A;  3N3K B;  3W1Y A;  3JSV B;  4AJY B;  2GBK A;  2O6V B;  2LGX A;  3DVN U;  2EKE C;  2N4F A;  2M4N A;  2N1W A;  4GMV A;  2HTH A;  4GGQ A;  2MX2 A;  4BOS C;  1GNU A;  1E7V A;  1WY8 A;  4ZRJ A;  4BBN C;  5KHO A;  2IY0 B;  4IWQ A;  2WWZ A;  4MEL A;  1WMH A;  1WFY A;  3VUY A;  1WE7 A;  1X1M A;  2BKR B;  3R3M A;  3QHT A;  2DYM A;  2KDE B;  4HDQ A;  4W9K A;  2XK5 B;  1YD8 U;  3ZRF A;  3QQ8 B;  3SD5 A;  4K81 A;  3UIP B;  3X0W A;  2LGD A;  3L54 A;  3VTU A;  1ISN A;  2LZ6 A;  4G3X B;  3AU5 A;  1UBQ A;  4AOF A;  3IG3 A;  2KO3 A;  4EUT A;  4IC7 B;  1MG8 A;  3KUC B;  3JW0 X;  4MGZ E;  4NQK E;  2L76 A;  4HPM B;  1IYF A;  2KD0 A;  2KVR A;  2K8C A;  4K7S A;  5CHF A;  3WAM A;  1P98 A;  2ZPY A;  3OJ3 A;  4BKS D;  4MH0 E;  4PYU A;  4RMA A;  2MP2 A;  2KLG A;  4IG7 B;  3M63 B;  3DVG X;  2Z0E B;  4I6L B;  4E71 A;  4EZK A;  1GC7 A;  2B3A A;  4MGY E;  3K9P B;  5BO4 B;  2CHX A;  3OAW A;  4IM3 A;  4W9C A;  4DHZ B;  1RFA A;  2CU1 A;  3VH4 B;  4DXA B;  4MJS B;  4NNJ B;  3VTW A;  4HK2 A;  4DDG D;  1UH6 A;  2J0M A;  2CHZ A;  2KNB A;  4AUQ C;  4RM9 A;  1JRU A;  1VD2 A;  4TQ0 A;  2JT4 B;  2KX3 A;  3A9J A;  4GIV A;  4E74 A;  1UZX B;  2IO3 B;  2KKC A;  2KTR A;  1AAR A;  1WXA A;  1T0Y A;  2W9N A;  1WR6 E;  3V60 A;  3ZDT A;  1V5T A;  4IUM B;  2O2V B;  3H9D A;  4KSL C;  1V80 A;  3L08 A;  2K6Q A;  4EOY A;  1GUA B;  2JUO A;  2MA9 B;  3OJ4 B;  5AZH A;  4BOZ B;  2KFK A;  4BKT A;  4NPN A;  3JSV A;  3I3T B;  4GB9 A;  4M8M A;  3DVG Y;  1Y8R C;  3NS8 A;  3KUD B;  2NBW B;  1WJU A;  2R2Q A;  1YIW A;  2DAF A;  2LI5 A;  2YVC A;  2JY6 A;  2D3G A;  2RPQ A;  2LRU A;  4DHJ B;  2EMS A;  2AEH A;  4LJO B;  3ML9 A;  2OJR A;  2QHO A;  4AJW A;  3JYU A;  3VFK A;  3T9L A;  1GG3 A;  1RAX A;  2L0T A;  3UF8 A;  4FLH A;  4IWP A;  3L16 A;  4TQ1 A;  3VUW A;  4DBG A;  2C7H A;  4KDI C;  2IYD B;  4HDO A;  2WDT B;  4K7W A;  3PLV A;  3H1U A;  3NOB A;  2IO2 B;  4HJK A;  3CMM B;  4BBN F;  2K8H A;  4HLE A;  2O6V A;  4ASW C;  2Z0D B;  5CHW A;  2DYB A;  2FAZ A;  4AWJ A;  3APF A;  4DWF A;  2G4D B;  4W9L A;  4WJQ A;  3RUL A;  1R4M I;  2M17 A;  1YX6 B;  4GU2 A;  1K8R B;  4J6I A;  1WI0 A;  3PPA A;  2GBR A;  2JWZ A;  4P7I A;  4PS3 A;  3K9O B;  4W9E A;  1E90 A;  4JL9 A;  4EFO A;  3M95 A;  2L05 A;  4JQW C;  4NAW B;  1WGG A;  2BGF A;  1GC6 A;  1V6E A;  3B08 A;  3QAQ A;  4F1S A;  1ZW7 A;  4KIK A;  3RZF A;  4ZDV A;  3TJP A;  2UYZ B;  2LRW A;  1WYW B;  2KWU B;  3OLM D;  3GOE A;  1V9J A;  3QA8 A;  1Z2M A;  3PT2 B;  1Q1O A;  3VQI A;  4DK5 A;  4IM0 A;  1NBF C;  3VUX A;  3ZNH B;  2AL3 A;  2BYV E;  3ZRC A;  1U4A A;  2GBJ A;  2KQS A;  2Z59 B;  5DPT A;  5D6J B;  4FA6 A;  2J0J A;  3A4S C;  1NI2 A;  1L2N A;  4ZRK A;  2DZI A;  3QCA A;  3ZNI D;  1WX8 A;  2XEW A;  3N30 A;  1UBI A;  1A5R A;  1C1Y B;  2RSU A;  5J17 A;  1WZ0 A;  2LD9 A;  2MBE A;  3PHX B;  3UIO B;  3AXC A;  4MSQ B;  3NHE B;  3MHS D;  3V6E B;  3IFW B;  1WGH A;  2JZZ A;  1XD3 B;  2HD5 B;  3QX1 A;  1F9J A;  1WMH B;  5D94 A;  3MJW A;  3UIN B;  1ZKH A;  2FCM A;  2LVP A;  2V1Y A;  3NZU A;  3TMP B;  5E6O A;  2AL6 A;  3V61 A;  3WAO A;  2V3S A;  3L10 B;  1WM2 A;  2MRP A;  3DQV A;  3WA0 A;  3ZTD A;  4PS8 A;  4MGI E;  2C9W B;  1BT0 A;  2KMC A;  4ICU A;  1S3S G;  3LDZ E;  1WX7 A;  1XT9 B;  3RT3 B;  3B0A A;  3WAL A;  1NDD A;  4B9K A;  2FCS A;  2DHZ A;  1WH3 A;  3PTF C;  1P9D U;  5E6P A;  4WWO A;  2LWP A;  1TBE A;  2C7N B;  3DBS A;  3U30 A;  2O6V D;  4B6W A;  2KMA A;  4ANU A;  1P3Q U;  3NY5 A;  2K8B A;  1EF5 A;  2IBI B;  3UQB A;  4WJO A;  1Q5W B;  2JZ3 B;  3ML8 A;  3VXW A;  4IWO A;  1KLV A;  2C7M B;  1V5O A;  2V4L A;  4MJS A;  1WE6 A;  3KH0 A;  4OVV A;  1J0G A;  3R7Q A;  2L3Z A;  2N9P C;  3LJ3 A;  2BF8 B;  1WZ3 A;  3NZS A;  1WR1 A;  4TKN A;  4WWN A;  5DPR A;  1OGW A;  3QC8 B;  2ZNV B;  2XBB C;  4ICV A;  2MBB B;  2KJ6 A;  3EFU A;  4G11 A;  2MW5 A;  3RCZ A;  3SHQ A;  5L83 A;  1EUV B;  2KDI A;  3HK0 A;  4KZ0 A;  3PRZ A;  4WQO B;  1WJ6 A;  4EZJ A;  2ZZP B;  3A9K A;  2GBN A;  4EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...