1V5TA

Solution structure of the ubiquitin-like domain from mouse hypothetical 8430435i17rik protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
90
Chain Sequence
b'GSSGSSGLPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTRESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8430435I17Rik Protein
molecule tags Structural genomics, unknown function
source organism Mus musculus
publication title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein
rcsb
total genus 7
structure length 90
sequence length 90
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v5tA00
1L7YA 3NOBA 5KHQA 2RR9A 3H7PA 3HM3A 3QX1A 3WA0A 5E6PA 3NZSA 3ZUNA 2KANA 2W9NA 3LDZE 2KOXA 4EEWA 4FBJB 3L0WB 2LWPA 1GC7A 1WJ6A 2JRHA 2V1YA 3OLMD 5AZHA 3V60A 5C1ZA 2K6DB 2NVUI 4II2B 1F9JA 4RMAA 1Q0WB 2LI5A 2CHXA 3HM6X 2KX0A 3VHTC 1ZW7A 2LGDA 1WXSA 5CHVC 3AI5A 3DDCB 1Q5WB 1SIFA 1UBIA 4FJVB 3M95A 4II3B 2L00B 1RLFA 2JVCA 2LVPA 2RPQA 2BYVE 4BKGA 5JHBA 2BWFA 3ZNGC 1WF9A 4TUUA 2MBOA 2LUEA 2XBBC 4MGZE 4W9KA 3JSVA 1TGZB 3IBEA 4ANWA 2A5UA 1WE7A 3DBHI 2IBIB 2KX3A 4G11A 4NJ6A 4NAWA 2KFKB 4W9FA 4MM3A 5DPWA 2LJ5A 3V61A 1TZ1A 4PS3A 2V4LA 2NBVB 3PRZA 2JXXA 3ZRFA 3KUZA 3KW5B 4AOFA 4EZKA 2KTRA 4JGHB 1LFDA 2HD5B 3VAWA 4B95A 3ZVVA 1SE9A 1GJZA 3IG3A 4W9JA 2DENB 2ASQA 2VRRB 2MSED 3DPDA 3PLVA 5GMVA 4ZYNA 2KFJA 2L0FA 2RGFA 3PHXB 4KDIC 4ANXA 2C9WB 2KJ6A 4GIVA 4GDLA 2LRUA 4K1RB 4W9DA 2J0JA 1WJUA 2D11A 3CMMB 1BT0A 2KK8A 1UELA 3HIZA 4HPMB 4MEMA 2D07B 2KZRA 2JZ3B 4IM0A 3A1QA 3U7DA 2N1VA 4KV2A 4DDID 4RM8A 3OJ3A 2BGFA 4FA6A 3TCAA 4CHKA 1D3ZA 1YJ1A 1GNUA 2BKFA 2BPSA 2DZJA 2PE9A 1V6EA 3W1YA 1RFAA 4EUTA 3DBLI 2HJ8A 4N9F4 1WYWB 4LDTD 4AUQC 4EZJA 1I42A 2JY6A 1P3QU 2CR5A 1I35A 2NBUA 4AJWA 4ANVA 2KQ7A 1E7VA 2LASA 3HHMA 2BYFA 4DHZB 3A33B 3ZNHB 2K25A 4OVUA 4XZ4A 2LXCA 1J8CA 4B6WA 2G45B 5D2MB 4CO7A 2KVRA 2AYOB 3V6EB 2K6QA 3QQ8B 3QARA 3ML8A 3WAOA 2GBNA 5D94A 2LVOA 3CSFA 1WE6A 2LGYA 3OAWA 3DVGY 3QC8B 5CHFA 2KJRA 1EO6A 1V5TA 1V2YA 3H1UA 2K1FA 2OJRA 4FHKA 2KDIA 2DYOA 3ECIA 3VUWA 2J0MA 2O2VA 2GMIC 3PVLA 1GG3A 2WYQA 3VUXA 1V5OA 3WAMA 5LXIB 2NR2A 3PGEA 3V62A 3ZTDA 2IZVB 3KYCD 2K39A 2Z0EB 1WGGA 3PLUA 1OEYJ 4FULA 1WZ3A 3H7PB 4HPLB 1UZXB 5DPTA 3M3JA 2KQSA 1WXVA 2DAJA 2KLGA 1WJNA 2N1WA 1E5WA 3DCGA 3VH3B 2O2VB 2KJHB 2M4NA 4JQWC 4GOCA 1WX8A 2L76A 5JZEB 5JHAA 2OOBB 3WIMA 2NPTB 2DZMA 3W1SC 1WH3A 2EMSA 2O6VD 3PREA 2ZPYA 5J17A 1WR1A 3X0WA 4KIKA 2ZVNA 3PT2B 4GSWA 3QJZA 4KSLC 3ALBA 2KKCA 4IG7B 2RSUA 4HXDA 2IYDB 2NCNA 3A1QB 3MJWA 3GOEA 2KWVB 3ZRCA 2NS5A 4BOSC 5L95C 1WXAA 4W9LA 4IWOA 2FCQA 2K8HA 2ZEQA 2AEHA 4MDKE 4DHJD 5LXHA 4GN1A 1GUAB 2ZNVC 3H9DA 5E6NA 4X57B 2WDTB 5AZFA 1MG8A 2IY1B 2REXA 2N7EA 3ZDTA 3W1SA 3QIJA 2IO2B 2MBEA 1UH6A 1WY8A 3VQIA 3R3MA 2MBHA 3BINA 4BVUC 4HVBA 5E6OA 3BY4B 4GDKA 2MW5A 2GBMA 1A5RA 3QAQA 2R2QA 1KLVA 3Q3FA 2C7HA 1E8ZA 2Z59B 1WRDB 3RUIB 5DCNA 2MLBA 1SGHA 2ZCBA 2KWCA 1J19A 4I6NB 4JIOU 3OJ4B 4PYZA 1WI0A 3JVZX 4TQ0A 2XK5A 3IHPC 3APCA 1WGHA 5AZGA 4HDOA 2IO0B 3PSEB 4GDLB 4KSKC 2JWZA 1LXDA 3EHVA 3TIXA 3PS6A 2DAFA 4G3XB 3DBSA 3UIPB 2D3GA 2JF5A 3NZUA 3RULA 3QCAA 4BKSD 3UQAA 2Y5BB 1E8WA 4GU2A 4WJQA 4HCPB 4BFRA 2PPHA 3ZTCA 3AU5A 3L16A 3WANA 2M8SA 3QHTA 1HE8A 4NAWB 2FAZA 4DHZE 3DVNV 4HDQA 4ASWC 3WAPA 3KVFB 1WR6E 2RD0A 3L08A 4ZRKA 5IAAC 1FXTB 4FJYA 2CU1A 4EKUA 3ZNZB 5AEKB 3KUDB 2FIFA 4URKA 3UQBA 2KXJA 2O6VB 4TKNA 4G0NB 4JL9A 3ML9A 4KDLB 5TR5A 2DZIA 3NY5A 2WX1A 2L7RA 3A9JB 3C0RB 4WAAA 5BO4B 1S1QB 1TTNA 4NQLB 2ZNVB 4GMVA 4TQ1A 2LZ6A 2KMCA 3RYTA 3QWZB 4W9HA 2D10A 3VUYA 2L05A 2FCMA 5JH5C 5D7GA 2N9PC 3A4SC 4A3OA 2DYBA 4GB9A 3ZLZA 1Z5SB 3H7SA 4WQOB 4KVGB 2C5LC 2NPTA 4I6PA 2QHOA 3A4RA 4W9EA 4B9KA 1WX7A 3LJ3A 4LJPB 4NY0A 2YLMA 1VCBA 2C7NB 3TBLD 4K7SA 3DBRI 4MSQB 2M17A 1GC6A 3JYUA 4MJSA 4K7UA 2YVCA 3JW0X 2GOWA 1K8RB 4J6IA 1EF1A 3VTUA 2JUOA 3K9PB 2L8JA 3RD2A 3R7QA 3ZW3A 2L0TA 4ANUA 3L10B 3APDA 3SU8X 1YX6B 4F7ZA 3NHEB 3QA8A 3ZKJC 2FUHB 3DQVA 3S2AA 2KTRB 1WGDA 4KZ0A 4NJ7A 3X23A 4FADA 2JT4B 1P0RA 2L3ZA 4M0WB 2EKEC 4NNJB 3M63B 3UF8A 4HLEA 1E8XA 4AP4C 1T0YA 2N4FA 2KTFA 4IW0A 1YX5B 1WZ0A 1J0GA 1OGWA 2JZZA 3DVNU 3TJPA 4PS7A 1P9DU 1V49A 1RRBA 1WMHB 3VH4B 1KJTA 1LQBA 1V9JA 1WGYA 1WX9A 2DZKA 3EECA 3L54A 4G50A 3ZIMA 2G4SA 3MTNB 3T9LA 4BBNC 4BOZB 4WJOA 1IP9A 2CS4A 2BWES 5KHOA 3PPAA 3H6NA 4ICVA 5C23A 4FJZA 2GBJA 1V81A 2WX0A 4NQKE 4F1SA 3CSTA 2KMAA 2K8CA 3NS8A 5J2RA 2V3SA 3B1LX 4E3CA 3RZFA 3SD5A 2ZVOA 2Z0DB 4ZRJA 2KNBA 1V80A 3RZWC 1Z2MA 2M1MA 2LXAA 2MQJA 1WM3A 3CF6E 4AJYB 1XT9B 1NDDA 4HJKA 4DK5A 5LLIA 2NBWB 2HTHA 1S3SG 2IO3B 3DOWA 1VD2A 4ZRIA 2KD0A 2C60A 1UD7A 5G2NA 4XX5A 5CHWA 1WMHA 4EZLA 3AXCA 4DXAB 3VXWA 2C7MB 1YIWA 4OVVA 4FN2A 4GDKB 3O65B 4WWNA 3TMPB 1WM2A 4WWOA 2EMTA 2N9EB 3A9KA 4DDGD 1OQYA 1E8YA 2WWZA 3D32A 3IVFA 3N3KB 4IM3A 4JLCA 4LCDE 3VFKA 4F8CB 4MGKE 1KOTA 4ZDVA 1E7UA 2XEWA 1Q1OA 5EDSA 2IO1B 2MCNB 3Q3JA 2MA9B 3M62B 4EFOA 3EFUA 1LM8B 1TBEA 4ICUA 2KDBA 2MP2B 2N7DA 4PYUA 1CMXB 2J0KA 3APFA 1RAXA 2K8BA 4A3PA 4FHJA 2MRPA 2O6VA 2DX5B 2KO3A 3AULA 1EF5A 3A9KB 2KDFB 3HK0A 2G4DB 3JSVB 1L2NA 2DHZA 2KWUB 1R4NI 2FNJB 4PS8A 1WJ4A 3B08A 5FR6A 1R4MI 4KIKB 2XK5B 2JRIB 4M8MA 2KFKA 3IFWB 2GBRA 4DBGA 4EOYA 2DYMA 4RM9A 1AARA 3UGBB 1G6JA 3V6CB 3UIOB 4WJPA 2FIDA 4W9IA 2KDEB 1P98A 1XD3B 2BYEA 2KC1A 5CX3A 2AL6A 1WGRA 1YD8U 4LDTB 1ISNA 2PJHA 2I1KA 2LGXA 2FCNA 4FLHA 3KUCB 2GBKA 3ONSA 1P1AA 4HWIB 2UYZB 3PHWB 2JPHA 3R66C 1H4RA 4MGIE 4K81A 3ENEA 2KN5A 3QK0A 4IM2A 3A9JA 4W9GA 3SDLC 5CTRC 4M8NA 5DPSA 2ZCCA 2N9XA 2CHZA 3I3TB 4WWPA 2CHWA 2KHWB 2M0XA 4A20A 4AWJA 2IY0B 4LJOB 1H8CA 1EUVB 5D6JB 4GXBA 4XC2A 1C1YB 2FCSA 2I1JA 2MWSB 3EC8A 4BBNF 4W9CA 1E90A 2D2QA 4HCNB 2UWQA 3PTFC 3RCZA 4E74A 1X1MA 2BKRB 3KYDD 4K7WA 2AL3A 1M94A 1NI2A 2LD9A 3L17A 2KC2A 4DWFA 5DPRA 1OEYA 1KM7A 3PRMB 4I6LB 3N32A 1ZKHA 1OTRB 3TL5A 2AWTA 2J7QB 4NPNA 3GZNI 1ZGUB 3MHSD 4IWQA 3WALA 2HE7A 4KZCA 3PV1A 2CKHB 4MGYE 4MJSB 2ZJDA 5HKHA 3ZO5B 1V86A 4YL8A 3U30A 4WJNA 1WFYA 2LRWA 2PEAA 5J18A 4IWPA 1C3TA 5IA7A 3DVGX 4IC7B 5L83A 1PQSA 3SHQA 1Y8RC 3U8ZA 4E71A 1IYFA 3AU4A 3PZDA 4CYEA 2ZZPB 1IPGA 2ZPNA 2BF8B 2PE6B 5G55A 3P2BA 3ZDMC 2MX2A 1UBQA 4DHJB 2A4ZA 4MELA 2MP2A 2MBQA 1U4AA 2B3AA 4MH0E 3T8MA 3RT3B 1QZEA 4P7IA 3VTVA 3R7RA 1WIAA 2LVQA 4MSMB 2G3QB 2KLCA 2R2OA 3K9OB 3UINB 3N30A 4BKTA 3VDZA 3ZNID 4HK2A 1NBFC 1UGMA 3B0AA 3KH0A 4TV3A 3L13A 3VVWB 2MBBB 1JRUA 1XQQA 4IUMB 4BKSA 1YQBA 3VTWA 3PRPB 4GGQA 1WXMA
chains in the Genus database with same CATH superfamily
5KHQA 3H7PA 3QX1A 4P16A 4EEWA 1GC7A 3OLMD 3IT6B 2NVUI 1KFYB 2K5PA 2CHXA 3HM6X 1F1HA 1TS5A 2KX0A 3DDCB 1DGJA 1UBIA 2ON8A 4GLSC 4II3B 2L00B 2LVPA 2RPQA 2BYVE 2LUEA 5G5GA 1JW9D 4W9KA 4ANWA 1EWYC 5IP4D 1NI3A 4NAWA 2KFKB 1F52A 4MM3A 3TUOA 5DPWA 3V61A 1TZ1A 2WXNA 4PS3A 2HD5B 3TEWA 1TKYA 2VRRB 3DPDA 3PLVA 4ZYNA 1FPYA 2KFJA 2L0FA 4KDIC 2C9WB 3N1XC 2KJ6A 3AE8B 4GDLA 3ZJVA 2JZ3B 2N1VA 3BVZA 4KGTA 1GNUA 3W1YA 1RFAA 3DBLI 1FNUA 1YMHE 5IKCM 1UWXA 1D5MC 4YSYB 2Z8LA 2KDMA 2LASA 2GRIA 2BYFA 3A33B 3ZNHB 4OVUA 2G45B 2PIAA 2WP9B 1E7PB 2PVGC 2XNAC 3DBLB 3QC8B 1EO6A 1V2YA 2OJRA 3RMKC 4RGOS 4US9A 4WIPA 1GG3A 1V5OA 3ZTDA 2K39A 2Z0EB 2WGSA 5IOIA 1XLOA 3DCGA 3H8HA 4MT5A 2JYEA 5JHAA 2OOBB 3AE7B 2NPTB 1CK1A 3UI3A 3W1SC 2O6VD 2JQRB 1WR1A 3X0WA 4OZBA 3ZGZA 2RSUA 4HXDA 3MJWA 1N60A 2BS4B 2N0SB 2IDYA 3KQ4A 4S17A 1QOBA 2FBWB 3W1SA 3QIJA 2MBEA 4KGRA 4KGSA 2ACZB 4MM3B 1TY2A 5E6OA 4GDKA 4KKJA 1A5RA 2GBMA 2GI9A 1PGXA 2VH1A 2C7HA 1WRDB 3Q6BA 2V3NA 4JIOU 3BZDB 3OJ4B 4PYZA 5LNK1 3BYYB 1WI0A 3JVZX 2XK5A 3APCA 1WGHA 2V9HA 4CQNA 1EM7A 1T6BX 1FRRA 1FM0D 3UIPB 2D3GA 2J4XA 3RULA 2Y5BB 1E8WA 1F2RC 3ZTCA 4N59A 2FAZA 4ASWC 2CU1A 5AUKA 3R8BA 2WDVB 2FIFA 4URKA 2O6VB 4G0NB 3ML9A 5TR5A 1PYWD 4KX6B 1XXGA 1HZ5A 2D3CA 1S1QB 1TTNA 4NQLB 4TQ1A 4GMVA 4N58A 4ZOHC 2KMCA 1ZOYB 3DHIC 3VUYA 2FCMA 2DLBA 2WLBA 5D7GA 3ZLZA 4KVGB 3PO0A 1JROA 2QHOA 3A4RA 3Q8FA 1QOGA 1C4CA 3FILB 1VCBA 2C7NB 1AN8A 4REZA 3JYUA 4D2KA 1K8RB 3RD2A 3ZW3A 3SU8X 3APDA 2FUHB 3NVVA 3DQVA 1WGDA 1FNWA 1VLBA 3P4QB 3CWIA 3IT4B 4M01A 2EKEC 1R7SA 1E8XA 1T0YA 2KTFA 2PKOA 3MP9A 4IW0A 2JZZA 4PS7A 1UGJA 3B2GA 4LNNA 2BW2A 3RFZB 2LFIA 1WGYA 1WX9A 3ZIMA 4BOZB 4BBNC 4WJOA 3EGRA 2CS4A 2WXJA 3H6NA 2K0PA 2WX0A 3B1LX 1K51A 2Z0DB 4ZRJA 3CF6E 1NDDA 4HJGE 4HPPA 3RNAC 4LNKA 5CHWA 1WMHA 4EZLA 3AXCA 1D4BA 4OVVA 1T5XD 2KAJA 4GDKB 4NZLB 1BMLC 4K3BA 1OQYA 4JLCA 2GB1A 3HRDD 4IM3A 4F8CB 2GLSA 5H92C 4ZDVA 1Q1OA 2IO1B 3Q3JA 4EFOA 4IDIA 2E3TA 2KDBA 3APFA 3EUB2 2MRPA 1WRIA 3A9KB 3JSVB 3Q8BA 2GBRA 3AE2B 4RH6A 4DBGA 4ACFA 3UGBB 4RM9A 1AARA 3UIOB 5EE1A 2BYEA 3P42A 2K22A 3AEEB 4JPSA 2PJHA 1AW7A 3ZYYX 3NZ3A 1QQRA 2FCNA 4HWIB 5GXGB 5FK9C 1H4RA 4MGIE 3QK0A 1V1OA 4IM2A 3N20C 3SDLC 2BYTA 2Q5WD 4Q2JA 3HVZA 2ZCCA 4WWPA 2IY0B 4GXBA 4XC2A 1C1YB 3W5UB 4BZAA 2MWSB 4C4VA 4HCNB 5EE9A 4TMAB 4E74A 1JMLA 1X1MA 4AQ7A 3KYDD 3N9YC 3PRMB 1KM7A 1VZ8A 2AWTA 1QT9A 1XLNA 3RPFC 4MGYE 2LJIA 4MJSB 3ZO5B 1V86A 4LLGM 2PEAA 2LRWA 2WXIA 1YJIA 1C3TA 5IA7A 1WXQA 1SBBB 3VRAB 1Y8RC 2VZKB 4A8XC 3AU4A 2G1EA 2IGDA 2PE6B 5G55A 1LGRA 2MX2A 1B1ZA 1UBQA 4YWGG 2L1AA 4LK0M 4MELA 3ZJTA 2MBQA 2MP2A 1U4AA 3B2FA 3FAHA 3T8MA 1FEHA 2LVQA 4MSMB 2R2OA 1YJJA 3N30A 1E10A 3VDZA 3ZNID 1NBFC 5MPOA 2QIEB 1ZDVA 2JXTA 1TY0A 2W3SA 4HEA1 3HM3A 5E6PA 3AEBB 3W5VB 1OQRA 2KOXA 3L0WB 1V97A 2X38A 1F9JA 2H89B 2WNMA 4C80A 1Q5WB 4YSXB 4US8A 3M95A 1RLFA 2WXGA 1TJEA 2AQ2B 5JHBA 1WF9A 2MBOA 4MGZE 2WQYB 3DBHI 1WE7A 4P1BC 2IBIB 4NJ6A 2NBVB 4C7YA 2JXXA 5BYSA 2L83A 2KTRA 4B95A 1JRPA 1E6EB 2BS2B 2ASQA 2MSED 3BK2A 3PHXB 4ARIA 4ANXA 4GIVA 4K1RB 3W2DA 1C77A 2D11A 1D5XC 1BT0A 5BMHA 3U7DA 4MEMA 4IM0A 4DDID 5T8IA 2DWQA 4CHKA 2HJ1A 2L52A 2LUMA 1E0ZA 2BKFA 2PE9A 2DZJA 3SEBA 3ZXRA 4N9F4 4A6QA 2JY6A 1I35A 1Q10A 2NBUA 1ZDXA 4AJWA 4KKIA 4JX1C 1JWUD 4ANVA 2KQ7A 1E7VA 3HHMA 4XZ4A 4RF1A 5D2MB 1K53A 1SIJA 2K6QA 3BVGA 3LB8C 3WAOA 5D94A 2IGGA 2LVOA 1ZUD2 3DVGY 1VJKA 2KJRA 3H1UA 3P1MA 2WXQA 3LXFA 1PGAA 5BYQA 2MEKA 2J0MA 3AB5A 2GMIC 3PVLA 3WAMA 5LXIB 1YN5A 2IZVB 2Y5PA 3AE6B 1OEYJ 4FULA 1UZXB 5DPTA 2OHFA 2KQSA 1WXVA 2DAJA 3VH3B 2O2VB 5JZEB 2EMSA 5J17A 1SJED 4MACA 1FNVA 2L32A 4OHJA 1WYGA 2Y3AA 2NCNA 2FUG1 2KWVB 3ZRCA 4W9LA 4IWOA 2FCQA 4DHJD 1I4PA 2R61A 2IGHA 1FRDA 2WDTB 4J3OD 3Q3MC 4RNAA 4K3CA 2WXHA 5AUIA 3R3MA 3C8YA 1KTKA 2TSSA 1Y56A 2RDHA 1E9MA 2R2QA 2QEJC 2YEPF 3RUIB 5DCNA 2QDFA 3IHPC 5AZGA 4HDOA 1RM6C 2PW9A 3I5JC 1LXDA 3EHVA 4YT0B 2DAFA 3BYTB 2OEDA 4OW0A 2M19A 4GU2A 1CQVA 1C4PA 2J52A 3QHTA 4NAWB 2WU5B 2EKIA 1MPEA 3DVNV 2WDQB 4A55A 2RD0A 3L08A 4ZRKA 4FJYA 1FCCC 3ZNZB 3OG5A 4BAXA 1V1PA 2WX1A 4AS1A 3A9JB 2DBYA 3C0RB 1ZP0B 2KN4A 2ZNVB 2QJLA 3DWMA 1FD6A 1MHXA 4W9HA 2K3UA 1ZXHA 3A4SC 3HUIA 2PTLA 4GB9A 1C9FA 1Z5SB 3NG0A 1R4MB 2C5LC 4W9EA 1YQ4B 2YLMA 3Q8AA 1J7CA 4MSQB 2M17A 4K7UA 1EF1A 3VTUA 3K9PB 3R7QA 4ANUA 1YX6B 1IGCA 3NUHB 3ZKJC 1A70A 2KTRB 4L1BA 2W55A 1BUIC 4AP4C 1YX5B 4WH4A 1V49A 3RNFC 1LQBA 3AE1B 1V9JA 3EECA 3AEAB 2GBJA 1KLUD 3CSTA 2KMAA 1I4GA 2V3SA 4E3CA 3RZFA 3SD5A 4NAMA 2ZVOA 1V80A 3RZWC 1Z2MA 4XDCA 3AM9A 3SFEB 4DK5A 2D3AA 1D5ZC 2IO3B 3DOWA 4ZRIA 2C60A 4C4VB 4DXAB 2C7MB 3AMZA 3TMPB 4WWOA 3D32A 2WWZA 2UU7A 4MGKE 3NVWA 1IUEA 2N7JA 1LM8B 2JU6X 2MP2B 1CMXB 2KACA 5HI1A 2IJ0A 1L2NA 1WJ4A 4KIKB 2XK5B 2JRIB 2KFKA 2KMMA 1N5XA 2H88B 2KDEB 1XD3B 2OJWA 1R4NB 2AL6A 1WGRA 1SF0A 1L6VA 4RGNA 2I1KA 2CU3A 2JPHA 2LEKA 2HDEA 4K81A 3P4RB 3A9JA 5CTRC 4M8NA 1NENB 2NMQA 5DPSA 1TT5B 2CHZA 1XLPA 1RWSA 3AN1A 4YXDB 5D6JB 3SR6A 1JALA 3AH7A 4BBNF 3U4EG 3TEYA 4W9CA 1E90A 3RNBC 2UWQA 2MJ3A 4K7WA 2LD9A 3L17A 4I6LB 1ZKHA 1OTRB 4IWQA 4KZCA 1QILA 1M4VA 3PV1A 2XN9C 3MHZA 2AQ3B 4YL8A 1ZE3D 4WJNA 2E6XA 5J18A 3NJTA 4WAFA 5C2TB 4IC7B 3SHQA 3U8ZA 1ROEA 1IGDA 4CYEA 3PZ7A 1V8CA 4JE3B 4DQOC 1BXTA 1I4QA 3CIRB 5JXVA 1KLGD 3R7RA 4IOIE 3UINB 1K52A 4BKTA 1UGMA 1XQQA 4IUMB 5EE3A 1J7BA 2WXOA 5C3JB 3NZSA 2KANA 2W9NA 3LDZE 2YEPB 4FBJB 2LWPA 1WJ6A 2JRHA 1VRAB 3Q2AC 2K6DB 4USAA 2BTEA 3Q8EA 1Q0WB 2RPVA 1TS2A 1WXSA 2WHIA 3AI5A 5G5HA 1N63A 1XO3A 1XCQL 2ZW0A 4FJVB 4EE2A 1XF5L 2V4IB 2BWFA 5D3IB 3E9SA 1NYRA 4ARCA 3IBEA 2MHJA 4HRSA 2QSDA 4W9FA 2LJ5A 2V4LA 3ZRFA 1YQ3B 2DNFA 4EZKA 2PVOD 3MC0B 4JGHB 1LFDA 1JWAD 5BYRA 3VAWA 1SE9A 3IG3A 4W9JA 1I4RA 2DENB 5GMVA 3VRBB 1L6UA 1WJUA 3CMMB 1ZPSA 1UELA 2KK8A 2D07B 2KZRA 3A1QA 4RM8A 2BGFA 1ACCA 4DXGA 1N62A 1WYWB 4LDTD 4AUQC 4B0EA 2W3RA 4DHZB 1CJEA 2M0AA 1N5WA 2K25A 1JQ4A 1J8CA 1VZ6A 4RGTA 4CO7A 2KVRA 4DXFA 2GBNA 3CSFA 1WE6A 1VZ7A 1NYQA 5IO9A 5CHFA 1EU3A 1V5TA 3BIID 2K1FA 4A9AA 1MHHE 4FHKA 3VUWA 1QOAA 4P6VF 3VUXA 3AV8A 4M0WA 3KYCD 1KH0A 2Y5CA 4XE0A 3GB1A 1JWMD 3H7PB 4QAYA 2BQQA 3M3JA 2KLGA 1WJNA 1E5WA 3EFCA 2KJHB 5TSSA 4ZHOA 2DZMA 5EE0A 3PREA 2ZPYA 3PT2B 4KSLC 4WQMA 2IYDB 1HA5A 5L95C 1WXAA 2K8HA 1GUAB 3H9DA 5E6NA 4X57B 2REXA 2IO2B 1UH6A 1IBXB 3VQIA 3ETRA 1KLVA 3QAQA 1L0VB 4ZYSA 3Q3FA 3VR8B 2MLBA 1SGHA 1TS3A 1HQRD 1J19A 4O1NA 3URYA 4C56C 1FFUA 3RNCC 2JYTA 2AQ1B 2IO0B 4GDLB 2JWZA 1FXAA 5FKAC 5HG2A 1AYFA 1T0SC 3DBSA 3NZUA 3QCAA 4RFBA 4BKSD 3UQAA 1TS4A 1T0QC 4WJQA 4HCPB 1ET9A 3AE3B 3AU5A 2PLPA 3L16A 3WANA 1YN4A 2M8SA 4DHZE 4RGMA 1JWSD 4HDQA 5IAAC 1FXTB 1MG4A 3BVMA 5AEKB 1D6EC 3RNEC 1K50A 4KDLB 3NY5A 2L7RA 1DOXA 4WAAA 5BO4B 1XEEA 2LZ6A 3R2IA 3RYTA 3OWEB 2D10A 5HHDG 2N9PC 2QC8A 4A3OA 3EA6A 3AEFB 4I6PA 1TYGB 3P63A 4B9KA 4LJPB 4NY0A 5FR3A 3DBRI 3DBHB 1TIFA 4RCOA 1I7HA 4J6IA 2L8JA 2L0TA 4F7ZA 3NHEB 3QA8A 3S2AA 4M00A 4NJ7A 1F77A 1L5PA 1B9RA 2L3ZA 4WWMA 2X8XX 4NNJB 4M0WB 1C78A 3M63B 3UF8A 5E6JA 4HLEA 2INPE 2N4FA 1WZ0A 1OGWA 2I38A 1P9DU 1RRBA 1WMHB 1KJTA 2V3PA 3J9CA 1MFWA 4G50A 2G4SA 3MFGA 1IP9A 2BWES 5KHOA 1TKEA 1I4HA 4ICVA 5C23A 4FJZA 4NQKE 4F1SA 3I63C 2K8CA 3NS8A 1HTQA 2HTME 2ONQA 2KNBA 1SSNA 2WXMA 2MQJA 1WM3A 1L0XB 3AEGB 1XT9B 5LLIA 2NBWB 1S3SG 4LNIA 1VD2A 3KWVA 3Q3NC 2JSVX 2J53A 1UD7A 2BS3B 5G2NA 3VXWA 4YTPB 2BT6A 1WM2A 4DDGD 1FCLA 3IVFA 1E8YA 3N3KB 3WCQA 4YSZB 4PT5A 2XEWA 2MA9B 3M62B 3EFUA 1YOVB 2N7DA 2J0KA 3Q8CA 1MJDA 2O6VA 3ZQ4A 2DX5B 3DBRB 1EWCA 4M02A 2KDFB 2G4DB 3HK0A 1R4NI 3B08A 5FR6A 3IFWB 4EOYA 1L0YB 2DYMA 1DOYA 2QCZA 1PUTA 1G6JA 1OFFA 2MJEA 2FIDA 4WJPA 2WXLA 3Q69A 3U7ZA 1FIQA 1YD8U 1ISNA 2LGXA 1LO5D 1UNSA 3PHWB 5H8YE 3ENEA 5BMIA 3ZJUA 3TSSA 4JWUC 3I3TB 2D5GA 4A20A 1EUVB 1PFDA 2FCSA 1DYQA 2I1JA 4FXCA 2AX5A 3P4SB 2B76B 1JWBD 3PTFC 3RCZA 3U2SC 2KT7A 1QOFA 2BKRB 3AEDB 1M94A 1NI2A 2KC2A 5DPRA 3N32A 1C79A 1TZOA 2WXRA 2J7QB 1HXYD 4UDUC 2HE7A 2CKHB 2ZJDA 2WXPA 4OVZA 3U30A 2V0GA 1WFYA 1P7FA 3SFDB 3R2TA 3RN9C 5L83A 4E71A 5HFYA 1FXIA 3Q14C 3PZDA 2ZZPB 1IPGA 2ZPNA 3GZNB 2BF8B 1PGBA 1HEZE 3V3XA 4A90A 3V05A 4DHJB 1RYJA 2B3AA 2INCC 1QZEA 4ITKA 3VTVA 1WIAA 2LGSA 3I9V1 2G3QB 4L2YA 1T3QA 2INDC 3KH0A 3L13A 3VVWB 1SJHD 2MBBB 1JRUA 4BKSA 1YQBA 3PRPB 4GGQA 3MC8A 1FO4A 1WXMA 1L7YA 3NOBA 2RR9A 3IAM1 3WA0A 3ZUNA 4WURA 2JX5A 4JWSC 2V1YA 5AZHA 3V60A 1V1PB 5C1ZA 4II2B 2QILA 2KVZA 3FC4A 3MJ5A 4RMAA 1UF0A 2LI5A 3VHTC 1STEA 1ZW7A 2LGDA 2ZW1A 5CHVC 1FFVA 1SIFA 3TEZA 1QF6A 2JVCA 4BKGA 3ZNGC 4TSSA 4TUUA 1NVID 2LGIA 2XBBC 1ET6A 1TGZB 3JSVA 3NVYA 2A5UA 2NTTA 2KX3A 4G11A 1GPXA 4MH8A 3PRZA 3KUZA 3KW5B 4AOFA 3ZVVA 1GJZA 1EU4A 4XWTA 2WXKA 3TEXA 2RGFA 4W9DA 2LRUA 2J0JA 2K9XA 4HPMB 3HIZA 4KV2A 3FKYA 3OJ3A 4FA6A 1D3ZA 3TCAA 3MC9A 4XDDA 1VDVA 1YJ1A 2BPSA 4LNFA 1V6EA 2W54A 4XGAB 4ZHPA 4EUTA 2HJ8A 3NRZA 1C76A 2CJOA 1QKZA 3VR9B 4EZJA 1I42A 1F2RI 1P3QU 2CR5A 1L4DB 3PZ8A 1XLQA 2WXFA 4NJCA 3T3OA 2LXCA 4B6WA 1MVKA 2AYOB 3V6EB 3QARA 3QQ8B 4R3DA 3ML8A 3AE4B 2LGYA 3OAWA 1WSPA 2KDIA 2DYOA 3ECIA 1N61A 2O2VA 2WYQA 2NR2A 3PGEA 3V62A 1SE2A 1GOZA 1WGGA 3PLUA 1WZ3A 4HPLB 2N1WA 4LNOA 2M4NA 4JQWC 4GOCA 1WX8A 2L76A 3WIMA 1I4XA 1WH3A 1C4AA 4KIKA 2ZVNA 4GSWA 3QJZA 3ALBA 2KKCA 2LMCA 4IG7B 4OZCA 3N1ZC 3A1QB 2J42A 3GOEA 2NS5A 4BOSC 3NS1A 2ZEQA 2KWDA 2AEHA 4MDKE 5LXHA 1VR9A 4GN1A 2ZNVC 5AZFA 1MG8A 2IY1B 2VH2A 2N7EA 4B0MA 3ZDTA 2SAKA 1WY8A 1P7EA 1QLBB 2MBHA 3BINA 4BVUC 4HVBA 3T3NA 1N6ZA 1F0ZA 2N9LA 3BY4B 2MW5A 3KWLA 2I2YA 1E8ZA 2Z59B 3NVZA 1WWTA 2ZCBA 2KWCA 4I6NB 2PMVA 2KYWA 4TQ0A 3PSEB 4KSKC 2RDBC 3TIXA 3PS6A 3RI7C 4G3XB 3ZXVA 1L4ZB 2JF5A 4ZRPA 2QMTA 4ZRQA 4BFRA 2PPHA 3E56A 2NTSA 1HE8A 2JZPA 3AECB 3IAS1 1ZXIA 3WAPA 3KVFB 1WR6E 4P1CC 4C00A 4EKUA 3KUDB 3UQBA 2KXJA 4TKNA 4JL9A 2DZIA 3U52E 1FMAD 1NEKB 3GS2A 3Q3OC 3QWZB 2M56B 2L05A 5JH5C 2DYBA 4WQOB 3H7SA 2NPTA 1WX7A 3LJ3A 3TBLD 5D3DA 1DOIA 4K7SA 1GC6A 4MJSA 2EELA 2YVCA 2GOWA 3JW0X 2WU2B 2JUOA 3L10B 2W82A 1HZ6A 4KZ0A 2INNE 3X23A 4FADA 2JT4B 1SXTA 1P0RA 1JCKB 1SB3C 2G9HD 2WS3B 1SE4A 1AWDA 3C19A 1CZPA 2MJDA 1J0GA 3DVNU 3TJPA 1GAQB 3VH4B 2DZKA 2RMMA 3L54A 3MTNB 3T9LA 3N1YC 1RFKA 3PPAA 5I4DA 1V81A 4OZAA 4YTMB 1HTOA 5J2RA 2M1MA 3BWUD 2LXAA 4AJYB 4HJKA 2ICIA 3W9CB 2HTHA 4HKQA 2KD0A 1YNTE 4XX5A 1YN3A 4IKGA 1YIWA 2D3BA 4FN2A 3AE9B 3O65B 4WWNA 2EMTA 2N9EB 3A9KA 2BB5A 4LCDE 3VFKA 3IXSA 1KOTA 1PDXA 1IBXA 2LHDA 1E7UA 5EDSA 2MCNB 1TKGA 1SE3A 1TBEA 4ICUA 1ENFA 4PYUA 1RAXA 2K8BA 2JWUA 4A3PA 4FHJA 2IPKD 3GE8C 2KO3A 3AULA 1EF5A 3BK1A 2DHZA 2KWUB 4PS8A 2FNJB 1R4MI 4PK1A 4M8MA 1XCTL 3ABVB 4XWWA 3V6CB 3FILA 4W9IA 1SEBD 1P98A 2KC1A 5CX3A 2RDGA 2N9KA 1MI0A 4XYCA 5IN7A 4LDTB 3DWGC 3GE3C 4FLHA 3KUCB 2GBKA 3ONSA 1P1AA 4L23A 3LYYA 2BVCA 1ESFA 2UYZB 3R66C 2LHEA 2KN5A 4W9GA 2MH7A 2N9XA 2CHWA 2KHWB 2M0XA 4HROA 4AWJA 3AE5B 4H2AA 4LJOB 1H8CA 3DHGC 3O13A 3I57A 3EC8A 2D2QA 3HVDA 4HKZE 2AL3A 1J7AA 1UWMA 4N6EB 3RNGC 4DWFA 1OEYA 1GB1A 1KRHA 3TL5A 2BBCA 4NPNA 3GZNI 1ZGUB 3MHSD 3WALA 5HKHA 2WDRB 4LTUA 4IWPA 3DVGX 1WGKA 4RF0A 1PQSA 5BMGA 1IYFA 3L4PA 3P2BA 3ZDMC 3DHHC 3KLSX 1T0RC 4S0RA 2VZKD 4C7ZA 2A4ZA 4MH0E 1GB4A 4YTNB 3RT3B 4P7IA 3B9JA 3P4PB 1KF6B 2SEBD 2KLCA 1OQQA 3K9OB 4HK2A 4TV3A 3B0AA 3GP7A 1UUPA 2FE8A 2KQ4X 3VTWA 2CJNA 2BB6A
chains in the Genus database with same CATH topology
1L7YA 3NOBA 5KHQA 2RR9A 3H7PA 3HM3A 3QX1A 3WA0A 5E6PA 3NZSA 3ZUNA 2KANA 2W9NA 3LDZE 2KOXA 4EEWA 4FBJB 3L0WB 2LWPA 1GC7A 1WJ6A 2JRHA 2V1YA 3OLMD 5AZHA 3V60A 5C1ZA 2K6DB 2NVUI 4II2B 1F9JA 4RMAA 1Q0WB 2LI5A 2CHXA 3HM6X 2KX0A 3VHTC 1ZW7A 2LGDA 1WXSA 5CHVC 3AI5A 3DDCB 1Q5WB 1SIFA 1UBIA 4FJVB 3M95A 4II3B 2L00B 1RLFA 2JVCA 2LVPA 2RPQA 2BYVE 4BKGA 5JHBA 2BWFA 3ZNGC 1WF9A 4TUUA 2MBOA 2LUEA 2XBBC 4MGZE 4W9KA 3JSVA 1TGZB 3IBEA 4ANWA 2A5UA 1WE7A 3DBHI 2IBIB 2KX3A 4G11A 4NJ6A 4NAWA 2KFKB 4W9FA 4MM3A 5DPWA 2LJ5A 3V61A 1TZ1A 4PS3A 2V4LA 2NBVB 3PRZA 2JXXA 3ZRFA 3KUZA 3KW5B 4AOFA 4EZKA 2KTRA 4JGHB 1LFDA 2HD5B 3VAWA 4B95A 3ZVVA 1SE9A 1GJZA 3IG3A 4W9JA 2DENB 2ASQA 2VRRB 2MSED 3DPDA 3PLVA 5GMVA 4ZYNA 2KFJA 2L0FA 2RGFA 3PHXB 4KDIC 4ANXA 2C9WB 2KJ6A 4GIVA 4GDLA 2LRUA 4K1RB 4W9DA 2J0JA 1WJUA 2D11A 3CMMB 1BT0A 2KK8A 1UELA 3HIZA 4HPMB 4MEMA 2D07B 2KZRA 2JZ3B 4IM0A 3A1QA 3U7DA 2N1VA 4KV2A 4DDID 4RM8A 3OJ3A 2BGFA 4FA6A 3TCAA 4CHKA 1D3ZA 1YJ1A 1GNUA 2BKFA 2BPSA 2DZJA 2PE9A 1V6EA 3W1YA 1RFAA 4EUTA 3DBLI 2HJ8A 4N9F4 1WYWB 4LDTD 4AUQC 4EZJA 1I42A 2JY6A 1P3QU 2CR5A 1I35A 2NBUA 4AJWA 4ANVA 2KQ7A 1E7VA 2LASA 3HHMA 2BYFA 4DHZB 3A33B 3ZNHB 2K25A 4OVUA 4XZ4A 2LXCA 1J8CA 4B6WA 2G45B 5D2MB 4CO7A 2KVRA 2AYOB 3V6EB 2K6QA 3QQ8B 3QARA 3ML8A 3WAOA 2GBNA 5D94A 2LVOA 3CSFA 1WE6A 2LGYA 3OAWA 3DVGY 3QC8B 5CHFA 2KJRA 1EO6A 1V5TA 1V2YA 3H1UA 2K1FA 2OJRA 4FHKA 2KDIA 2DYOA 3ECIA 3VUWA 2J0MA 2O2VA 2GMIC 3PVLA 1GG3A 2WYQA 3VUXA 1V5OA 3WAMA 5LXIB 2NR2A 3PGEA 3V62A 3ZTDA 2IZVB 3KYCD 2K39A 2Z0EB 1WGGA 3PLUA 1OEYJ 4FULA 1WZ3A 3H7PB 4HPLB 1UZXB 5DPTA 3M3JA 2KQSA 1WXVA 2DAJA 2KLGA 1WJNA 2N1WA 1E5WA 3DCGA 3VH3B 2O2VB 2KJHB 2M4NA 4JQWC 4GOCA 1WX8A 2L76A 5JZEB 5JHAA 2OOBB 3WIMA 2NPTB 2DZMA 3W1SC 1WH3A 2EMSA 2O6VD 3PREA 2ZPYA 5J17A 1WR1A 3X0WA 4KIKA 2ZVNA 3PT2B 4GSWA 3QJZA 4KSLC 3ALBA 2KKCA 4IG7B 2RSUA 4HXDA 2IYDB 2NCNA 3A1QB 3MJWA 3GOEA 2KWVB 3ZRCA 2NS5A 4BOSC 5L95C 1WXAA 4W9LA 4IWOA 2FCQA 2K8HA 2ZEQA 2AEHA 4MDKE 4DHJD 5LXHA 4GN1A 1GUAB 2ZNVC 3H9DA 5E6NA 4X57B 2WDTB 5AZFA 1MG8A 2IY1B 2REXA 2N7EA 3ZDTA 3W1SA 3QIJA 2IO2B 2MBEA 1UH6A 1WY8A 3VQIA 3R3MA 2MBHA 3BINA 4BVUC 4HVBA 5E6OA 3BY4B 4GDKA 2MW5A 2GBMA 1A5RA 3QAQA 2R2QA 1KLVA 3Q3FA 2C7HA 1E8ZA 2Z59B 1WRDB 3RUIB 5DCNA 2MLBA 1SGHA 2ZCBA 2KWCA 1J19A 4I6NB 4JIOU 3OJ4B 4PYZA 1WI0A 3JVZX 4TQ0A 2XK5A 3IHPC 3APCA 1WGHA 5AZGA 4HDOA 2IO0B 3PSEB 4GDLB 4KSKC 2JWZA 1LXDA 3EHVA 3TIXA 3PS6A 2DAFA 4G3XB 3DBSA 3UIPB 2D3GA 2JF5A 3NZUA 3RULA 3QCAA 4BKSD 3UQAA 2Y5BB 1E8WA 4GU2A 4WJQA 4HCPB 4BFRA 2PPHA 3ZTCA 3AU5A 3L16A 3WANA 2M8SA 3QHTA 1HE8A 4NAWB 2FAZA 4DHZE 3DVNV 4HDQA 4ASWC 3WAPA 3KVFB 1WR6E 2RD0A 3L08A 4ZRKA 5IAAC 1FXTB 4FJYA 2CU1A 4EKUA 3ZNZB 5AEKB 3KUDB 2FIFA 4URKA 3UQBA 2KXJA 2O6VB 4TKNA 4G0NB 4JL9A 3ML9A 4KDLB 5TR5A 2DZIA 3NY5A 2WX1A 2L7RA 3A9JB 3C0RB 4WAAA 5BO4B 1S1QB 1TTNA 4NQLB 2ZNVB 4GMVA 4TQ1A 2LZ6A 2KMCA 3RYTA 3QWZB 4W9HA 2D10A 3VUYA 2L05A 2FCMA 5JH5C 5D7GA 2N9PC 3A4SC 4A3OA 2DYBA 4GB9A 3ZLZA 1Z5SB 3H7SA 4WQOB 4KVGB 2C5LC 2NPTA 4I6PA 2QHOA 3A4RA 4W9EA 4B9KA 1WX7A 3LJ3A 4LJPB 4NY0A 2YLMA 1VCBA 2C7NB 3TBLD 4K7SA 3DBRI 4MSQB 2M17A 1GC6A 3JYUA 4MJSA 4K7UA 2YVCA 3JW0X 2GOWA 1K8RB 4J6IA 1EF1A 3VTUA 2JUOA 3K9PB 2L8JA 3RD2A 3R7QA 3ZW3A 2L0TA 4ANUA 3L10B 3APDA 3SU8X 1YX6B 4F7ZA 3NHEB 3QA8A 3ZKJC 2FUHB 3DQVA 3S2AA 2KTRB 1WGDA 4KZ0A 4NJ7A 3X23A 4FADA 2JT4B 1P0RA 2L3ZA 4M0WB 2EKEC 4NNJB 3M63B 3UF8A 4HLEA 1E8XA 4AP4C 1T0YA 2N4FA 2KTFA 4IW0A 1YX5B 1WZ0A 1J0GA 1OGWA 2JZZA 3DVNU 3TJPA 4PS7A 1P9DU 1V49A 1RRBA 1WMHB 3VH4B 1KJTA 1LQBA 1V9JA 1WGYA 1WX9A 2DZKA 3EECA 3L54A 4G50A 3ZIMA 2G4SA 3MTNB 3T9LA 4BBNC 4BOZB 4WJOA 1IP9A 2CS4A 2BWES 5KHOA 3PPAA 3H6NA 4ICVA 5C23A 4FJZA 2GBJA 1V81A 2WX0A 4NQKE 4F1SA 3CSTA 2KMAA 2K8CA 3NS8A 5J2RA 2V3SA 3B1LX 4E3CA 3RZFA 3SD5A 2ZVOA 2Z0DB 4ZRJA 2KNBA 1V80A 3RZWC 1Z2MA 2M1MA 2LXAA 2MQJA 1WM3A 3CF6E 4AJYB 1XT9B 1NDDA 4HJKA 4DK5A 5LLIA 2NBWB 2HTHA 1S3SG 2IO3B 3DOWA 1VD2A 4ZRIA 2KD0A 2C60A 1UD7A 5G2NA 4XX5A 5CHWA 1WMHA 4EZLA 3AXCA 4DXAB 3VXWA 2C7MB 1YIWA 4OVVA 4FN2A 4GDKB 3O65B 4WWNA 3TMPB 1WM2A 4WWOA 2EMTA 2N9EB 3A9KA 4DDGD 1OQYA 1E8YA 2WWZA 3D32A 3IVFA 3N3KB 4IM3A 4JLCA 4LCDE 3VFKA 4F8CB 4MGKE 1KOTA 4ZDVA 1E7UA 2XEWA 1Q1OA 5EDSA 2IO1B 2MCNB 3Q3JA 2MA9B 3M62B 4EFOA 3EFUA 1LM8B 1TBEA 4ICUA 2KDBA 2MP2B 2N7DA 4PYUA 1CMXB 2J0KA 3APFA 1RAXA 2K8BA 4A3PA 4FHJA 2MRPA 2O6VA 2DX5B 2KO3A 3AULA 1EF5A 3A9KB 2KDFB 3HK0A 2G4DB 3JSVB 1L2NA 2DHZA 2KWUB 1R4NI 2FNJB 4PS8A 1WJ4A 3B08A 5FR6A 1R4MI 4KIKB 2XK5B 2JRIB 4M8MA 2KFKA 3IFWB 2GBRA 4DBGA 4EOYA 2DYMA 4RM9A 1AARA 3UGBB 1G6JA 3V6CB 3UIOB 4WJPA 2FIDA 4W9IA 2KDEB 1P98A 1XD3B 2BYEA 2KC1A 5CX3A 2AL6A 1WGRA 1YD8U 4LDTB 1ISNA 2PJHA 2I1KA 2LGXA 2FCNA 4FLHA 3KUCB 2GBKA 3ONSA 1P1AA 4HWIB 2UYZB 3PHWB 2JPHA 3R66C 1H4RA 4MGIE 4K81A 3ENEA 2KN5A 3QK0A 4IM2A 3A9JA 4W9GA 3SDLC 5CTRC 4M8NA 5DPSA 2ZCCA 2N9XA 2CHZA 3I3TB 4WWPA 2CHWA 2KHWB 2M0XA 4A20A 4AWJA 2IY0B 4LJOB 1H8CA 1EUVB 5D6JB 4GXBA 4XC2A 1C1YB 2FCSA 2I1JA 2MWSB 3EC8A 4BBNF 4W9CA 1E90A 2D2QA 4HCNB 2UWQA 3PTFC 3RCZA 4E74A 1X1MA 2BKRB 3KYDD 4K7WA 2AL3A 1M94A 1NI2A 2LD9A 3L17A 2KC2A 4DWFA 5DPRA 1OEYA 1KM7A 3PRMB 4I6LB 3N32A 1ZKHA 1OTRB 3TL5A 2AWTA 2J7QB 4NPNA 3GZNI 1ZGUB 3MHSD 4IWQA 3WALA 2HE7A 4KZCA 3PV1A 2CKHB 4MGYE 4MJSB 2ZJDA 5HKHA 3ZO5B 1V86A 4YL8A 3U30A 4WJNA 1WFYA 2LRWA 2PEAA 5J18A 4IWPA 1C3TA 5IA7A 3DVGX 4IC7B 5L83A 1PQSA 3SHQA 1Y8RC 3U8ZA 4E71A 1IYFA 3AU4A 3PZDA 4CYEA 2ZZPB 1IPGA 2ZPNA 2BF8B 2PE6B 5G55A 3P2BA 3ZDMC 2MX2A 1UBQA 4DHJB 2A4ZA 4MELA 2MP2A 2MBQA 1U4AA 2B3AA 4MH0E 3T8MA 3RT3B 1QZEA 4P7IA 3VTVA 3R7RA 1WIAA 2LVQA 4MSMB 2G3QB 2KLCA 2R2OA 3K9OB 3UINB 3N30A 4BKTA 3VDZA 3ZNID 4HK2A 1NBFC 1UGMA 3B0AA 3KH0A 4TV3A 3L13A 3VVWB 2MBBB 1JRUA 1XQQA 4IUMB 4BKSA 1YQBA 3VTWA 3PRPB 4GGQA 1WXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7Y A;  3NOB A;  5KHQ A;  2RR9 A;  3H7P A;  3HM3 A;  3QX1 A;  3WA0 A;  5E6P A;  3NZS A;  3ZUN A;  2KAN A;  2W9N A;  3LDZ E;  2KOX A;  4EEW A;  4FBJ B;  3L0W B;  2LWP A;  1GC7 A;  1WJ6 A;  2JRH A;  2V1Y A;  3OLM D;  5AZH A;  3V60 A;  5C1Z A;  2K6D B;  2NVU I;  4II2 B;  1F9J A;  4RMA A;  1Q0W B;  2LI5 A;  2CHX A;  3HM6 X;  2KX0 A;  3VHT C;  1ZW7 A;  2LGD A;  1WXS A;  5CHV C;  3AI5 A;  3DDC B;  1Q5W B;  1SIF A;  1UBI A;  4FJV B;  3M95 A;  4II3 B;  2L00 B;  1RLF A;  2JVC A;  2LVP A;  2RPQ A;  2BYV E;  4BKG A;  5JHB A;  2BWF A;  3ZNG C;  1WF9 A;  4TUU A;  2MBO A;  2LUE A;  2XBB C;  4MGZ E;  4W9K A;  3JSV A;  1TGZ B;  3IBE A;  4ANW A;  2A5U A;  1WE7 A;  3DBH I;  2IBI B;  2KX3 A;  4G11 A;  4NJ6 A;  4NAW A;  2KFK B;  4W9F A;  4MM3 A;  5DPW A;  2LJ5 A;  3V61 A;  1TZ1 A;  4PS3 A;  2V4L A;  2NBV B;  3PRZ A;  2JXX A;  3ZRF A;  3KUZ A;  3KW5 B;  4AOF A;  4EZK A;  2KTR A;  4JGH B;  1LFD A;  2HD5 B;  3VAW A;  4B95 A;  3ZVV A;  1SE9 A;  1GJZ A;  3IG3 A;  4W9J A;  2DEN B;  2ASQ A;  2VRR B;  2MSE D;  3DPD A;  3PLV A;  5GMV A;  4ZYN A;  2KFJ A;  2L0F A;  2RGF A;  3PHX B;  4KDI C;  4ANX A;  2C9W B;  2KJ6 A;  4GIV A;  4GDL A;  2LRU A;  4K1R B;  4W9D A;  2J0J A;  1WJU A;  2D11 A;  3CMM B;  1BT0 A;  2KK8 A;  1UEL A;  3HIZ A;  4HPM B;  4MEM A;  2D07 B;  2KZR A;  2JZ3 B;  4IM0 A;  3A1Q A;  3U7D A;  2N1V A;  4KV2 A;  4DDI D;  4RM8 A;  3OJ3 A;  2BGF A;  4FA6 A;  3TCA A;  4CHK A;  1D3Z A;  1YJ1 A;  1GNU A;  2BKF A;  2BPS A;  2DZJ A;  2PE9 A;  1V6E A;  3W1Y A;  1RFA A;  4EUT A;  3DBL I;  2HJ8 A;  4N9F 4;  1WYW B;  4LDT D;  4AUQ C;  4EZJ A;  1I42 A;  2JY6 A;  1P3Q U;  2CR5 A;  1I35 A;  2NBU A;  4AJW A;  4ANV A;  2KQ7 A;  1E7V A;  2LAS A;  3HHM A;  2BYF A;  4DHZ B;  3A33 B;  3ZNH B;  2K25 A;  4OVU A;  4XZ4 A;  2LXC A;  1J8C A;  4B6W A;  2G45 B;  5D2M B;  4CO7 A;  2KVR A;  2AYO B;  3V6E B;  2K6Q A;  3QQ8 B;  3QAR A;  3ML8 A;  3WAO A;  2GBN A;  5D94 A;  2LVO A;  3CSF A;  1WE6 A;  2LGY A;  3OAW A;  3DVG Y;  3QC8 B;  5CHF A;  2KJR A;  1EO6 A;  1V5T A;  1V2Y A;  3H1U A;  2K1F A;  2OJR A;  4FHK A;  2KDI A;  2DYO A;  3ECI A;  3VUW A;  2J0M A;  2O2V A;  2GMI C;  3PVL A;  1GG3 A;  2WYQ A;  3VUX A;  1V5O A;  3WAM A;  5LXI B;  2NR2 A;  3PGE A;  3V62 A;  3ZTD A;  2IZV B;  3KYC D;  2K39 A;  2Z0E B;  1WGG A;  3PLU A;  1OEY J;  4FUL A;  1WZ3 A;  3H7P B;  4HPL B;  1UZX B;  5DPT A;  3M3J A;  2KQS A;  1WXV A;  2DAJ A;  2KLG A;  1WJN A;  2N1W A;  1E5W A;  3DCG A;  3VH3 B;  2O2V B;  2KJH B;  2M4N A;  4JQW C;  4GOC A;  1WX8 A;  2L76 A;  5JZE B;  5JHA A;  2OOB B;  3WIM A;  2NPT B;  2DZM A;  3W1S C;  1WH3 A;  2EMS A;  2O6V D;  3PRE A;  2ZPY A;  5J17 A;  1WR1 A;  3X0W A;  4KIK A;  2ZVN A;  3PT2 B;  4GSW A;  3QJZ A;  4KSL C;  3ALB A;  2KKC A;  4IG7 B;  2RSU A;  4HXD A;  2IYD B;  2NCN A;  3A1Q B;  3MJW A;  3GOE A;  2KWV B;  3ZRC A;  2NS5 A;  4BOS C;  5L95 C;  1WXA A;  4W9L A;  4IWO A;  2FCQ A;  2K8H A;  2ZEQ A;  2AEH A;  4MDK E;  4DHJ D;  5LXH A;  4GN1 A;  1GUA B;  2ZNV C;  3H9D A;  5E6N A;  4X57 B;  2WDT B;  5AZF A;  1MG8 A;  2IY1 B;  2REX A;  2N7E A;  3ZDT A;  3W1S A;  3QIJ A;  2IO2 B;  2MBE A;  1UH6 A;  1WY8 A;  3VQI A;  3R3M A;  2MBH A;  3BIN A;  4BVU C;  4HVB A;  5E6O A;  3BY4 B;  4GDK A;  2MW5 A;  2GBM A;  1A5R A;  3QAQ A;  2R2Q A;  1KLV A;  3Q3F A;  2C7H A;  1E8Z A;  2Z59 B;  1WRD B;  3RUI B;  5DCN A;  2MLB A;  1SGH A;  2ZCB A;  2KWC A;  1J19 A;  4I6N B;  4JIO U;  3OJ4 B;  4PYZ A;  1WI0 A;  3JVZ X;  4TQ0 A;  2XK5 A;  3IHP C;  3APC A;  1WGH A;  5AZG A;  4HDO A;  2IO0 B;  3PSE B;  4GDL B;  4KSK C;  2JWZ A;  1LXD A;  3EHV A;  3TIX A;  3PS6 A;  2DAF A;  4G3X B;  3DBS A;  3UIP B;  2D3G A;  2JF5 A;  3NZU A;  3RUL A;  3QCA A;  4BKS D;  3UQA A;  2Y5B B;  1E8W A;  4GU2 A;  4WJQ A;  4HCP B;  4BFR A;  2PPH A;  3ZTC A;  3AU5 A;  3L16 A;  3WAN A;  2M8S A;  3QHT A;  1HE8 A;  4NAW B;  2FAZ A;  4DHZ E;  3DVN V;  4HDQ A;  4ASW C;  3WAP A;  3KVF B;  1WR6 E;  2RD0 A;  3L08 A;  4ZRK A;  5IAA C;  1FXT B;  4FJY A;  2CU1 A;  4EKU A;  3ZNZ B;  5AEK B;  3KUD B;  2FIF A;  4URK A;  3UQB A;  2KXJ A;  2O6V B;  4TKN A;  4G0N B;  4JL9 A;  3ML9 A;  4KDL B;  5TR5 A;  2DZI A;  3NY5 A;  2WX1 A;  2L7R A;  3A9J B;  3C0R B;  4WAA A;  5BO4 B;  1S1Q B;  1TTN A;  4NQL B;  2ZNV B;  4GMV A;  4TQ1 A;  2LZ6 A;  2KMC A;  3RYT A;  3QWZ B;  4W9H A;  2D10 A;  3VUY A;  2L05 A;  2FCM A;  5JH5 C;  5D7G A;  2N9P C;  3A4S C;  4A3O A;  2DYB A;  4GB9 A;  3ZLZ A;  1Z5S B;  3H7S A;  4WQO B;  4KVG B;  2C5L C;  2NPT A;  4I6P A;  2QHO A;  3A4R A;  4W9E A;  4B9K A;  1WX7 A;  3LJ3 A;  4LJP B;  4NY0 A;  2YLM A;  1VCB A;  2C7N B;  3TBL D;  4K7S A;  3DBR I;  4MSQ B;  2M17 A;  1GC6 A;  3JYU A;  4MJS A;  4K7U A;  2YVC A;  3JW0 X;  2GOW A;  1K8R B;  4J6I A;  1EF1 A;  3VTU A;  2JUO A;  3K9P B;  2L8J A;  3RD2 A;  3R7Q A;  3ZW3 A;  2L0T A;  4ANU A;  3L10 B;  3APD A;  3SU8 X;  1YX6 B;  4F7Z A;  3NHE B;  3QA8 A;  3ZKJ C;  2FUH B;  3DQV A;  3S2A A;  2KTR B;  1WGD A;  4KZ0 A;  4NJ7 A;  3X23 A;  4FAD A;  2JT4 B;  1P0R A;  2L3Z A;  4M0W B;  2EKE C;  4NNJ B;  3M63 B;  3UF8 A;  4HLE A;  1E8X A;  4AP4 C;  1T0Y A;  2N4F A;  2KTF A;  4IW0 A;  1YX5 B;  1WZ0 A;  1J0G A;  1OGW A;  2JZZ A;  3DVN U;  3TJP A;  4PS7 A;  1P9D U;  1V49 A;  1RRB A;  1WMH B;  3VH4 B;  1KJT A;  1LQB A;  1V9J A;  1WGY A;  1WX9 A;  2DZK A;  3EEC A;  3L54 A;  4G50 A;  3ZIM A;  2G4S A;  3MTN B;  3T9L A;  4BBN C;  4BOZ B;  4WJO A;  1IP9 A;  2CS4 A;  2BWE S;  5KHO A;  3PPA A;  3H6N A;  4ICV A;  5C23 A;  4FJZ A;  2GBJ A;  1V81 A;  2WX0 A;  4NQK E;  4F1S A;  3CST A;  2KMA A;  2K8C A;  3NS8 A;  5J2R A;  2V3S A;  3B1L X;  4E3C A;  3RZF A;  3SD5 A;  2ZVO A;  2Z0D B;  4ZRJ A;  2KNB A;  1V80 A;  3RZW C;  1Z2M A;  2M1M A;  2LXA A;  2MQJ A;  1WM3 A;  3CF6 E;  4AJY B;  1XT9 B;  1NDD A;  4HJK A;  4DK5 A;  5LLI A;  2NBW B;  2HTH A;  1S3S G;  2IO3 B;  3DOW A;  1VD2 A;  4ZRI A;  2KD0 A;  2C60 A;  1UD7 A;  5G2N A;  4XX5 A;  5CHW A;  1WMH A;  4EZL A;  3AXC A;  4DXA B;  3VXW A;  2C7M B;  1YIW A;  4OVV A;  4FN2 A;  4GDK B;  3O65 B;  4WWN A;  3TMP B;  1WM2 A;  4WWO A;  2EMT A;  2N9E B;  3A9K A;  4DDG D;  1OQY A;  1E8Y A;  2WWZ A;  3D32 A;  3IVF A;  3N3K B;  4IM3 A;  4JLC A;  4LCD E;  3VFK A;  4F8C B;  4MGK E;  1KOT A;  4ZDV A;  1E7U A;  2XEW A;  1Q1O A;  5EDS A;  2IO1 B;  2MCN B;  3Q3J A;  2MA9 B;  3M62 B;  4EFO A;  3EFU A;  1LM8 B;  1TBE A;  4ICU A;  2KDB A;  2MP2 B;  2N7D A;  4PYU A;  1CMX B;  2J0K A;  3APF A;  1RAX A;  2K8B A;  4A3P A;  4FHJ A;  2MRP A;  2O6V A;  2DX5 B;  2KO3 A;  3AUL A;  1EF5 A;  3A9K B;  2KDF B;  3HK0 A;  2G4D B;  3JSV B;  1L2N A;  2DHZ A;  2KWU B;  1R4N I;  2FNJ B;  4PS8 A;  1WJ4 A;  3B08 A;  5FR6 A;  1R4M I;  4KIK B;  2XK5 B;  2JRI B;  4M8M A;  2KFK A;  3IFW B;  2GBR A;  4DBG A;  4EOY A;  2DYM A;  4RM9 A;  1AAR A;  3UGB B;  1G6J A;  3V6C B;  3UIO B;  4WJP A;  2FID A;  4W9I A;  2KDE B;  1P98 A;  1XD3 B;  2BYE A;  2KC1 A;  5CX3 A;  2AL6 A;  1WGR A;  1YD8 U;  4LDT B;  1ISN A;  2PJH A;  2I1K A;  2LGX A;  2FCN A;  4FLH A;  3KUC B;  2GBK A;  3ONS A;  1P1A A;  4HWI B;  2UYZ B;  3PHW B;  2JPH A;  3R66 C;  1H4R A;  4MGI E;  4K81 A;  3ENE A;  2KN5 A;  3QK0 A;  4IM2 A;  3A9J A;  4W9G A;  3SDL C;  5CTR C;  4M8N A;  5DPS A;  2ZCC A;  2N9X A;  2CHZ A;  3I3T B;  4WWP A;  2CHW A;  2KHW B;  2M0X A;  4A20 A;  4AWJ A;  2IY0 B;  4LJO B;  1H8C A;  1EUV B;  5D6J B;  4GXB A;  4XC2 A;  1C1Y B;  2FCS A;  2I1J A;  2MWS B;  3EC8 A;  4BBN F;  4W9C A;  1E90 A;  2D2Q A;  4HCN B;  2UWQ A;  3PTF C;  3RCZ A;  4E74 A;  1X1M A;  2BKR B;  3KYD D;  4K7W A;  2AL3 A;  1M94 A;  1NI2 A;  2LD9 A;  3L17 A;  2KC2 A;  4DWF A;  5DPR A;  1OEY A;  1KM7 A;  3PRM B;  4I6L B;  3N32 A;  1ZKH A;  1OTR B;  3TL5 A;  2AWT A;  2J7Q B;  4NPN A;  3GZN I;  1ZGU B;  3MHS D;  4IWQ A;  3WAL A;  2HE7 A;  4KZC A;  3PV1 A;  2CKH B;  4MGY E;  4MJS B;  2ZJD A;  5HKH A;  3ZO5 B;  1V86 A;  4YL8 A;  3U30 A;  4WJN A;  1WFY A;  2LRW A;  2PEA A;  5J18 A;  4IWP A;  1C3T A;  5IA7 A;  3DVG X;  4IC7 B;  5L83 A;  1PQS A;  3SHQ A;  1Y8R C;  3U8Z A;  4E71 A;  1IYF A;  3AU4 A;  3PZD A;  4CYE A;  2ZZP B;  1IPG A;  2ZPN A;  2BF8 B;  2PE6 B;  5G55 A;  3P2B A;  3ZDM C;  2MX2 A;  1UBQ A;  4DHJ B;  2A4Z A;  4MEL A;  2MP2 A;  2MBQ A;  1U4A A;  2B3A A;  4MH0 E;  3T8M A;  3RT3 B;  1QZE A;  4P7I A;  3VTV A;  3R7R A;  1WIA A;  2LVQ A;  4MSM B;  2G3Q B;  2KLC A;  2R2O A;  3K9O B;  3UIN B;  3N30 A;  4BKT A;  3VDZ A;  3ZNI D;  4HK2 A;  1NBF C;  1UGM A;  3B0A A;  3KH0 A;  4TV3 A;  3L13 A;  3VVW B;  2MBB B;  1JRU A;  1XQQ A;  4IUM B;  4BKS A;  1YQB A;  3VTW A;  3PRP B;  4GGQ A;  1WXM A; 
#chains in the Genus database with same CATH topology
 5KHQ A;  3H7P A;  3QX1 A;  4P16 A;  4EEW A;  1GC7 A;  3OLM D;  3IT6 B;  2NVU I;  1KFY B;  2K5P A;  2CHX A;  3HM6 X;  1F1H A;  1TS5 A;  2KX0 A;  3DDC B;  1DGJ A;  1UBI A;  2ON8 A;  4GLS C;  4II3 B;  2L00 B;  2LVP A;  2RPQ A;  2BYV E;  2LUE A;  5G5G A;  1JW9 D;  4W9K A;  4ANW A;  1EWY C;  5IP4 D;  1NI3 A;  4NAW A;  2KFK B;  1F52 A;  4MM3 A;  3TUO A;  5DPW A;  3V61 A;  1TZ1 A;  2WXN A;  4PS3 A;  2HD5 B;  3TEW A;  1TKY A;  2VRR B;  3DPD A;  3PLV A;  4ZYN A;  1FPY A;  2KFJ A;  2L0F A;  4KDI C;  2C9W B;  3N1X C;  2KJ6 A;  3AE8 B;  4GDL A;  3ZJV A;  2JZ3 B;  2N1V A;  3BVZ A;  4KGT A;  1GNU A;  3W1Y A;  1RFA A;  3DBL I;  1FNU A;  1YMH E;  5IKC M;  1UWX A;  1D5M C;  4YSY B;  2Z8L A;  2KDM A;  2LAS A;  2GRI A;  2BYF A;  3A33 B;  3ZNH B;  4OVU A;  2G45 B;  2PIA A;  2WP9 B;  1E7P B;  2PVG C;  2XNA C;  3DBL B;  3QC8 B;  1EO6 A;  1V2Y A;  2OJR A;  3RMK C;  4RGO S;  4US9 A;  4WIP A;  1GG3 A;  1V5O A;  3ZTD A;  2K39 A;  2Z0E B;  2WGS A;  5IOI A;  1XLO A;  3DCG A;  3H8H A;  4MT5 A;  2JYE A;  5JHA A;  2OOB B;  3AE7 B;  2NPT B;  1CK1 A;  3UI3 A;  3W1S C;  2O6V D;  2JQR B;  1WR1 A;  3X0W A;  4OZB A;  3ZGZ A;  2RSU A;  4HXD A;  3MJW A;  1N60 A;  2BS4 B;  2N0S B;  2IDY A;  3KQ4 A;  4S17 A;  1QOB A;  2FBW B;  3W1S A;  3QIJ A;  2MBE A;  4KGR A;  4KGS A;  2ACZ B;  4MM3 B;  1TY2 A;  5E6O A;  4GDK A;  4KKJ A;  1A5R A;  2GBM A;  2GI9 A;  1PGX A;  2VH1 A;  2C7H A;  1WRD B;  3Q6B A;  2V3N A;  4JIO U;  3BZD B;  3OJ4 B;  4PYZ A;  5LNK 1;  3BYY B;  1WI0 A;  3JVZ X;  2XK5 A;  3APC A;  1WGH A;  2V9H A;  4CQN A;  1EM7 A;  1T6B X;  1FRR A;  1FM0 D;  3UIP B;  2D3G A;  2J4X A;  3RUL A;  2Y5B B;  1E8W A;  1F2R C;  3ZTC A;  4N59 A;  2FAZ A;  4ASW C;  2CU1 A;  5AUK A;  3R8B A;  2WDV B;  2FIF A;  4URK A;  2O6V B;  4G0N B;  3ML9 A;  5TR5 A;  1PYW D;  4KX6 B;  1XXG A;  1HZ5 A;  2D3C A;  1S1Q B;  1TTN A;  4NQL B;  4TQ1 A;  4GMV A;  4N58 A;  4ZOH C;  2KMC A;  1ZOY B;  3DHI C;  3VUY A;  2FCM A;  2DLB A;  2WLB A;  5D7G A;  3ZLZ A;  4KVG B;  3PO0 A;  1JRO A;  2QHO A;  3A4R A;  3Q8F A;  1QOG A;  1C4C A;  3FIL B;  1VCB A;  2C7N B;  1AN8 A;  4REZ A;  3JYU A;  4D2K A;  1K8R B;  3RD2 A;  3ZW3 A;  3SU8 X;  3APD A;  2FUH B;  3NVV A;  3DQV A;  1WGD A;  1FNW A;  1VLB A;  3P4Q B;  3CWI A;  3IT4 B;  4M01 A;  2EKE C;  1R7S A;  1E8X A;  1T0Y A;  2KTF A;  2PKO A;  3MP9 A;  4IW0 A;  2JZZ A;  4PS7 A;  1UGJ A;  3B2G A;  4LNN A;  2BW2 A;  3RFZ B;  2LFI A;  1WGY A;  1WX9 A;  3ZIM A;  4BOZ B;  4BBN C;  4WJO A;  3EGR A;  2CS4 A;  2WXJ A;  3H6N A;  2K0P A;  2WX0 A;  3B1L X;  1K51 A;  2Z0D B;  4ZRJ A;  3CF6 E;  1NDD A;  4HJG E;  4HPP A;  3RNA C;  4LNK A;  5CHW A;  1WMH A;  4EZL A;  3AXC A;  1D4B A;  4OVV A;  1T5X D;  2KAJ A;  4GDK B;  4NZL B;  1BML C;  4K3B A;  1OQY A;  4JLC A;  2GB1 A;  3HRD D;  4IM3 A;  4F8C B;  2GLS A;  5H92 C;  4ZDV A;  1Q1O A;  2IO1 B;  3Q3J A;  4EFO A;  4IDI A;  2E3T A;  2KDB A;  3APF A;  3EUB 2;  2MRP A;  1WRI A;  3A9K B;  3JSV B;  3Q8B A;  2GBR A;  3AE2 B;  4RH6 A;  4DBG A;  4ACF A;  3UGB B;  4RM9 A;  1AAR A;  3UIO B;  5EE1 A;  2BYE A;  3P42 A;  2K22 A;  3AEE B;  4JPS A;  2PJH A;  1AW7 A;  3ZYY X;  3NZ3 A;  1QQR A;  2FCN A;  4HWI B;  5GXG B;  5FK9 C;  1H4R A;  4MGI E;  3QK0 A;  1V1O A;  4IM2 A;  3N20 C;  3SDL C;  2BYT A;  2Q5W D;  4Q2J A;  3HVZ A;  2ZCC A;  4WWP A;  2IY0 B;  4GXB A;  4XC2 A;  1C1Y B;  3W5U B;  4BZA A;  2MWS B;  4C4V A;  4HCN B;  5EE9 A;  4TMA B;  4E74 A;  1JML A;  1X1M A;  4AQ7 A;  3KYD D;  3N9Y C;  3PRM B;  1KM7 A;  1VZ8 A;  2AWT A;  1QT9 A;  1XLN A;  3RPF C;  4MGY E;  2LJI A;  4MJS B;  3ZO5 B;  1V86 A;  4LLG M;  2PEA A;  2LRW A;  2WXI A;  1YJI A;  1C3T A;  5IA7 A;  1WXQ A;  1SBB B;  3VRA B;  1Y8R C;  2VZK B;  4A8X C;  3AU4 A;  2G1E A;  2IGD A;  2PE6 B;  5G55 A;  1LGR A;  2MX2 A;  1B1Z A;  1UBQ A;  4YWG G;  2L1A A;  4LK0 M;  4MEL A;  3ZJT A;  2MBQ A;  2MP2 A;  1U4A A;  3B2F A;  3FAH A;  3T8M A;  1FEH A;  2LVQ A;  4MSM B;  2R2O A;  1YJJ A;  3N30 A;  1E10 A;  3VDZ A;  3ZNI D;  1NBF C;  5MPO A;  2QIE B;  1ZDV A;  2JXT A;  1TY0 A;  2W3S A;  4HEA 1;  3HM3 A;  5E6P A;  3AEB B;  3W5V B;  1OQR A;  2KOX A;  3L0W B;  1V97 A;  2X38 A;  1F9J A;  2H89 B;  2WNM A;  4C80 A;  1Q5W B;  4YSX B;  4US8 A;  3M95 A;  1RLF A;  2WXG A;  1TJE A;  2AQ2 B;  5JHB A;  1WF9 A;  2MBO A;  4MGZ E;  2WQY B;  3DBH I;  1WE7 A;  4P1B C;  2IBI B;  4NJ6 A;  2NBV B;  4C7Y A;  2JXX A;  5BYS A;  2L83 A;  2KTR A;  4B95 A;  1JRP A;  1E6E B;  2BS2 B;  2ASQ A;  2MSE D;  3BK2 A;  3PHX B;  4ARI A;  4ANX A;  4GIV A;  4K1R B;  3W2D A;  1C77 A;  2D11 A;  1D5X C;  1BT0 A;  5BMH A;  3U7D A;  4MEM A;  4IM0 A;  4DDI D;  5T8I A;  2DWQ A;  4CHK A;  2HJ1 A;  2L52 A;  2LUM A;  1E0Z A;  2BKF A;  2PE9 A;  2DZJ A;  3SEB A;  3ZXR A;  4N9F 4;  4A6Q A;  2JY6 A;  1I35 A;  1Q10 A;  2NBU A;  1ZDX A;  4AJW A;  4KKI A;  4JX1 C;  1JWU D;  4ANV A;  2KQ7 A;  1E7V A;  3HHM A;  4XZ4 A;  4RF1 A;  5D2M B;  1K53 A;  1SIJ A;  2K6Q A;  3BVG A;  3LB8 C;  3WAO A;  5D94 A;  2IGG A;  2LVO A;  1ZUD 2;  3DVG Y;  1VJK A;  2KJR A;  3H1U A;  3P1M A;  2WXQ A;  3LXF A;  1PGA A;  5BYQ A;  2MEK A;  2J0M A;  3AB5 A;  2GMI C;  3PVL A;  3WAM A;  5LXI B;  1YN5 A;  2IZV B;  2Y5P A;  3AE6 B;  1OEY J;  4FUL A;  1UZX B;  5DPT A;  2OHF A;  2KQS A;  1WXV A;  2DAJ A;  3VH3 B;  2O2V B;  5JZE B;  2EMS A;  5J17 A;  1SJE D;  4MAC A;  1FNV A;  2L32 A;  4OHJ A;  1WYG A;  2Y3A A;  2NCN A;  2FUG 1;  2KWV B;  3ZRC A;  4W9L A;  4IWO A;  2FCQ A;  4DHJ D;  1I4P A;  2R61 A;  2IGH A;  1FRD A;  2WDT B;  4J3O D;  3Q3M C;  4RNA A;  4K3C A;  2WXH A;  5AUI A;  3R3M A;  3C8Y A;  1KTK A;  2TSS A;  1Y56 A;  2RDH A;  1E9M A;  2R2Q A;  2QEJ C;  2YEP F;  3RUI B;  5DCN A;  2QDF A;  3IHP C;  5AZG A;  4HDO A;  1RM6 C;  2PW9 A;  3I5J C;  1LXD A;  3EHV A;  4YT0 B;  2DAF A;  3BYT B;  2OED A;  4OW0 A;  2M19 A;  4GU2 A;  1CQV A;  1C4P A;  2J52 A;  3QHT A;  4NAW B;  2WU5 B;  2EKI A;  1MPE A;  3DVN V;  2WDQ B;  4A55 A;  2RD0 A;  3L08 A;  4ZRK A;  4FJY A;  1FCC C;  3ZNZ B;  3OG5 A;  4BAX A;  1V1P A;  2WX1 A;  4AS1 A;  3A9J B;  2DBY A;  3C0R B;  1ZP0 B;  2KN4 A;  2ZNV B;  2QJL A;  3DWM A;  1FD6 A;  1MHX A;  4W9H A;  2K3U A;  1ZXH A;  3A4S C;  3HUI A;  2PTL A;  4GB9 A;  1C9F A;  1Z5S B;  3NG0 A;  1R4M B;  2C5L C;  4W9E A;  1YQ4 B;  2YLM A;  3Q8A A;  1J7C A;  4MSQ B;  2M17 A;  4K7U A;  1EF1 A;  3VTU A;  3K9P B;  3R7Q A;  4ANU A;  1YX6 B;  1IGC A;  3NUH B;  3ZKJ C;  1A70 A;  2KTR B;  4L1B A;  2W55 A;  1BUI C;  4AP4 C;  1YX5 B;  4WH4 A;  1V49 A;  3RNF C;  1LQB A;  3AE1 B;  1V9J A;  3EEC A;  3AEA B;  2GBJ A;  1KLU D;  3CST A;  2KMA A;  1I4G A;  2V3S A;  4E3C A;  3RZF A;  3SD5 A;  4NAM A;  2ZVO A;  1V80 A;  3RZW C;  1Z2M A;  4XDC A;  3AM9 A;  3SFE B;  4DK5 A;  2D3A A;  1D5Z C;  2IO3 B;  3DOW A;  4ZRI A;  2C60 A;  4C4V B;  4DXA B;  2C7M B;  3AMZ A;  3TMP B;  4WWO A;  3D32 A;  2WWZ A;  2UU7 A;  4MGK E;  3NVW A;  1IUE A;  2N7J A;  1LM8 B;  2JU6 X;  2MP2 B;  1CMX B;  2KAC A;  5HI1 A;  2IJ0 A;  1L2N A;  1WJ4 A;  4KIK B;  2XK5 B;  2JRI B;  2KFK A;  2KMM A;  1N5X A;  2H88 B;  2KDE B;  1XD3 B;  2OJW A;  1R4N B;  2AL6 A;  1WGR A;  1SF0 A;  1L6V A;  4RGN A;  2I1K A;  2CU3 A;  2JPH A;  2LEK A;  2HDE A;  4K81 A;  3P4R B;  3A9J A;  5CTR C;  4M8N A;  1NEN B;  2NMQ A;  5DPS A;  1TT5 B;  2CHZ A;  1XLP A;  1RWS A;  3AN1 A;  4YXD B;  5D6J B;  3SR6 A;  1JAL A;  3AH7 A;  4BBN F;  3U4E G;  3TEY A;  4W9C A;  1E90 A;  3RNB C;  2UWQ A;  2MJ3 A;  4K7W A;  2LD9 A;  3L17 A;  4I6L B;  1ZKH A;  1OTR B;  4IWQ A;  4KZC A;  1QIL A;  1M4V A;  3PV1 A;  2XN9 C;  3MHZ A;  2AQ3 B;  4YL8 A;  1ZE3 D;  4WJN A;  2E6X A;  5J18 A;  3NJT A;  4WAF A;  5C2T B;  4IC7 B;  3SHQ A;  3U8Z A;  1ROE A;  1IGD A;  4CYE A;  3PZ7 A;  1V8C A;  4JE3 B;  4DQO C;  1BXT A;  1I4Q A;  3CIR B;  5JXV A;  1KLG D;  3R7R A;  4IOI E;  3UIN B;  1K52 A;  4BKT A;  1UGM A;  1XQQ A;  4IUM B;  5EE3 A;  1J7B A;  2WXO A;  5C3J B;  3NZS A;  2KAN A;  2W9N A;  3LDZ E;  2YEP B;  4FBJ B;  2LWP A;  1WJ6 A;  2JRH A;  1VRA B;  3Q2A C;  2K6D B;  4USA A;  2BTE A;  3Q8E A;  1Q0W B;  2RPV A;  1TS2 A;  1WXS A;  2WHI A;  3AI5 A;  5G5H A;  1N63 A;  1XO3 A;  1XCQ L;  2ZW0 A;  4FJV B;  4EE2 A;  1XF5 L;  2V4I B;  2BWF A;  5D3I B;  3E9S A;  1NYR A;  4ARC A;  3IBE A;  2MHJ A;  4HRS A;  2QSD A;  4W9F A;  2LJ5 A;  2V4L A;  3ZRF A;  1YQ3 B;  2DNF A;  4EZK A;  2PVO D;  3MC0 B;  4JGH B;  1LFD A;  1JWA D;  5BYR A;  3VAW A;  1SE9 A;  3IG3 A;  4W9J A;  1I4R A;  2DEN B;  5GMV A;  3VRB B;  1L6U A;  1WJU A;  3CMM B;  1ZPS A;  1UEL A;  2KK8 A;  2D07 B;  2KZR A;  3A1Q A;  4RM8 A;  2BGF A;  1ACC A;  4DXG A;  1N62 A;  1WYW B;  4LDT D;  4AUQ C;  4B0E A;  2W3R A;  4DHZ B;  1CJE A;  2M0A A;  1N5W A;  2K25 A;  1JQ4 A;  1J8C A;  1VZ6 A;  4RGT A;  4CO7 A;  2KVR A;  4DXF A;  2GBN A;  3CSF A;  1WE6 A;  1VZ7 A;  1NYQ A;  5IO9 A;  5CHF A;  1EU3 A;  1V5T A;  3BII D;  2K1F A;  4A9A A;  1MHH E;  4FHK A;  3VUW A;  1QOA A;  4P6V F;  3VUX A;  3AV8 A;  4M0W A;  3KYC D;  1KH0 A;  2Y5C A;  4XE0 A;  3GB1 A;  1JWM D;  3H7P B;  4QAY A;  2BQQ A;  3M3J A;  2KLG A;  1WJN A;  1E5W A;  3EFC A;  2KJH B;  5TSS A;  4ZHO A;  2DZM A;  5EE0 A;  3PRE A;  2ZPY A;  3PT2 B;  4KSL C;  4WQM A;  2IYD B;  1HA5 A;  5L95 C;  1WXA A;  2K8H A;  1GUA B;  3H9D A;  5E6N A;  4X57 B;  2REX A;  2IO2 B;  1UH6 A;  1IBX B;  3VQI A;  3ETR A;  1KLV A;  3QAQ A;  1L0V B;  4ZYS A;  3Q3F A;  3VR8 B;  2MLB A;  1SGH A;  1TS3 A;  1HQR D;  1J19 A;  4O1N A;  3URY A;  4C56 C;  1FFU A;  3RNC C;  2JYT A;  2AQ1 B;  2IO0 B;  4GDL B;  2JWZ A;  1FXA A;  5FKA C;  5HG2 A;  1AYF A;  1T0S C;  3DBS A;  3NZU A;  3QCA A;  4RFB A;  4BKS D;  3UQA A;  1TS4 A;  1T0Q C;  4WJQ A;  4HCP B;  1ET9 A;  3AE3 B;  3AU5 A;  2PLP A;  3L16 A;  3WAN A;  1YN4 A;  2M8S A;  4DHZ E;  4RGM A;  1JWS D;  4HDQ A;  5IAA C;  1FXT B;  1MG4 A;  3BVM A;  5AEK B;  1D6E C;  3RNE C;  1K50 A;  4KDL B;  3NY5 A;  2L7R A;  1DOX A;  4WAA A;  5BO4 B;  1XEE A;  2LZ6 A;  3R2I A;  3RYT A;  3OWE B;  2D10 A;  5HHD G;  2N9P C;  2QC8 A;  4A3O A;  3EA6 A;  3AEF B;  4I6P A;  1TYG B;  3P63 A;  4B9K A;  4LJP B;  4NY0 A;  5FR3 A;  3DBR I;  3DBH B;  1TIF A;  4RCO A;  1I7H A;  4J6I A;  2L8J A;  2L0T A;  4F7Z A;  3NHE B;  3QA8 A;  3S2A A;  4M00 A;  4NJ7 A;  1F77 A;  1L5P A;  1B9R A;  2L3Z A;  4WWM A;  2X8X X;  4NNJ B;  4M0W B;  1C78 A;  3M63 B;  3UF8 A;  5E6J A;  4HLE A;  2INP E;  2N4F A;  1WZ0 A;  1OGW A;  2I38 A;  1P9D U;  1RRB A;  1WMH B;  1KJT A;  2V3P A;  3J9C A;  1MFW A;  4G50 A;  2G4S A;  3MFG A;  1IP9 A;  2BWE S;  5KHO A;  1TKE A;  1I4H A;  4ICV A;  5C23 A;  4FJZ A;  4NQK E;  4F1S A;  3I63 C;  2K8C A;  3NS8 A;  1HTQ A;  2HTM E;  2ONQ A;  2KNB A;  1SSN A;  2WXM A;  2MQJ A;  1WM3 A;  1L0X B;  3AEG B;  1XT9 B;  5LLI A;  2NBW B;  1S3S G;  4LNI A;  1VD2 A;  3KWV A;  3Q3N C;  2JSV X;  2J53 A;  1UD7 A;  2BS3 B;  5G2N A;  3VXW A;  4YTP B;  2BT6 A;  1WM2 A;  4DDG D;  1FCL A;  3IVF A;  1E8Y A;  3N3K B;  3WCQ A;  4YSZ B;  4PT5 A;  2XEW A;  2MA9 B;  3M62 B;  3EFU A;  1YOV B;  2N7D A;  2J0K A;  3Q8C A;  1MJD A;  2O6V A;  3ZQ4 A;  2DX5 B;  3DBR B;  1EWC A;  4M02 A;  2KDF B;  2G4D B;  3HK0 A;  1R4N I;  3B08 A;  5FR6 A;  3IFW B;  4EOY A;  1L0Y B;  2DYM A;  1DOY A;  2QCZ A;  1PUT A;  1G6J A;  1OFF A;  2MJE A;  2FID A;  4WJP A;  2WXL A;  3Q69 A;  3U7Z A;  1FIQ A;  1YD8 U;  1ISN A;  2LGX A;  1LO5 D;  1UNS A;  3PHW B;  5H8Y E;  3ENE A;  5BMI A;  3ZJU A;  3TSS A;  4JWU C;  3I3T B;  2D5G A;  4A20 A;  1EUV B;  1PFD A;  2FCS A;  1DYQ A;  2I1J A;  4FXC A;  2AX5 A;  3P4S B;  2B76 B;  1JWB D;  3PTF C;  3RCZ A;  3U2S C;  2KT7 A;  1QOF A;  2BKR B;  3AED B;  1M94 A;  1NI2 A;  2KC2 A;  5DPR A;  3N32 A;  1C79 A;  1TZO A;  2WXR A;  2J7Q B;  1HXY D;  4UDU C;  2HE7 A;  2CKH B;  2ZJD A;  2WXP A;  4OVZ A;  3U30 A;  2V0G A;  1WFY A;  1P7F A;  3SFD B;  3R2T A;  3RN9 C;  5L83 A;  4E71 A;  5HFY A;  1FXI A;  3Q14 C;  3PZD A;  2ZZP B;  1IPG A;  2ZPN A;  3GZN B;  2BF8 B;  1PGB A;  1HEZ E;  3V3X A;  4A90 A;  3V05 A;  4DHJ B;  1RYJ A;  2B3A A;  2INC C;  1QZE A;  4ITK A;  3VTV A;  1WIA A;  2LGS A;  3I9V 1;  2G3Q B;  4L2Y A;  1T3Q A;  2IND C;  3KH0 A;  3L13 A;  3VVW B;  1SJH D;  2MBB B;  1JRU A;  4BKS A;  1YQB A;  3PRP B;  4GGQ A;  3MC8 A;  1FO4 A;  1WXM A;  1L7Y A;  3NOB A;  2RR9 A;  3IAM 1;  3WA0 A;  3ZUN A;  4WUR A;  2JX5 A;  4JWS C;  2V1Y A;  5AZH A;  3V60 A;  1V1P B;  5C1Z A;  4II2 B;  2QIL A;  2KVZ A;  3FC4 A;  3MJ5 A;  4RMA A;  1UF0 A;  2LI5 A;  3VHT C;  1STE A;  1ZW7 A;  2LGD A;  2ZW1 A;  5CHV C;  1FFV A;  1SIF A;  3TEZ A;  1QF6 A;  2JVC A;  4BKG A;  3ZNG C;  4TSS A;  4TUU A;  1NVI D;  2LGI A;  2XBB C;  1ET6 A;  1TGZ B;  3JSV A;  3NVY A;  2A5U A;  2NTT A;  2KX3 A;  4G11 A;  1GPX A;  4MH8 A;  3PRZ A;  3KUZ A;  3KW5 B;  4AOF A;  3ZVV A;  1GJZ A;  1EU4 A;  4XWT A;  2WXK A;  3TEX A;  2RGF A;  4W9D A;  2LRU A;  2J0J A;  2K9X A;  4HPM B;  3HIZ A;  4KV2 A;  3FKY A;  3OJ3 A;  4FA6 A;  1D3Z A;  3TCA A;  3MC9 A;  4XDD A;  1VDV A;  1YJ1 A;  2BPS A;  4LNF A;  1V6E A;  2W54 A;  4XGA B;  4ZHP A;  4EUT A;  2HJ8 A;  3NRZ A;  1C76 A;  2CJO A;  1QKZ A;  3VR9 B;  4EZJ A;  1I42 A;  1F2R I;  1P3Q U;  2CR5 A;  1L4D B;  3PZ8 A;  1XLQ A;  2WXF A;  4NJC A;  3T3O A;  2LXC A;  4B6W A;  1MVK A;  2AYO B;  3V6E B;  3QAR A;  3QQ8 B;  4R3D A;  3ML8 A;  3AE4 B;  2LGY A;  3OAW A;  1WSP A;  2KDI A;  2DYO A;  3ECI A;  1N61 A;  2O2V A;  2WYQ A;  2NR2 A;  3PGE A;  3V62 A;  1SE2 A;  1GOZ A;  1WGG A;  3PLU A;  1WZ3 A;  4HPL B;  2N1W A;  4LNO A;  2M4N A;  4JQW C;  4GOC A;  1WX8 A;  2L76 A;  3WIM A;  1I4X A;  1WH3 A;  1C4A A;  4KIK A;  2ZVN A;  4GSW A;  3QJZ A;  3ALB A;  2KKC A;  2LMC A;  4IG7 B;  4OZC A;  3N1Z C;  3A1Q B;  2J42 A;  3GOE A;  2NS5 A;  4BOS C;  3NS1 A;  2ZEQ A;  2KWD A;  2AEH A;  4MDK E;  5LXH A;  1VR9 A;  4GN1 A;  2ZNV C;  5AZF A;  1MG8 A;  2IY1 B;  2VH2 A;  2N7E A;  4B0M A;  3ZDT A;  2SAK A;  1WY8 A;  1P7E A;  1QLB B;  2MBH A;  3BIN A;  4BVU C;  4HVB A;  3T3N A;  1N6Z A;  1F0Z A;  2N9L A;  3BY4 B;  2MW5 A;  3KWL A;  2I2Y A;  1E8Z A;  2Z59 B;  3NVZ A;  1WWT A;  2ZCB A;  2KWC A;  4I6N B;  2PMV A;  2KYW A;  4TQ0 A;  3PSE B;  4KSK C;  2RDB C;  3TIX A;  3PS6 A;  3RI7 C;  4G3X B;  3ZXV A;  1L4Z B;  2JF5 A;  4ZRP A;  2QMT A;  4ZRQ A;  4BFR A;  2PPH A;  3E56 A;  2NTS A;  1HE8 A;  2JZP A;  3AEC B;  3IAS 1;  1ZXI A;  3WAP A;  3KVF B;  1WR6 E;  4P1C C;  4C00 A;  4EKU A;  3KUD B;  3UQB A;  2KXJ A;  4TKN A;  4JL9 A;  2DZI A;  3U52 E;  1FMA D;  1NEK B;  3GS2 A;  3Q3O C;  3QWZ B;  2M56 B;  2L05 A;  5JH5 C;  2DYB A;  4WQO B;  3H7S A;  2NPT A;  1WX7 A;  3LJ3 A;  3TBL D;  5D3D A;  1DOI A;  4K7S A;  1GC6 A;  4MJS A;  2EEL A;  2YVC A;  2GOW A;  3JW0 X;  2WU2 B;  2JUO A;  3L10 B;  2W82 A;  1HZ6 A;  4KZ0 A;  2INN E;  3X23 A;  4FAD A;  2JT4 B;  1SXT A;  1P0R A;  1JCK B;  1SB3 C;  2G9H D;  2WS3 B;  1SE4 A;  1AWD A;  3C19 A;  1CZP A;  2MJD A;  1J0G A;  3DVN U;  3TJP A;  1GAQ B;  3VH4 B;  2DZK A;  2RMM A;  3L54 A;  3MTN B;  3T9L A;  3N1Y C;  1RFK A;  3PPA A;  5I4D A;  1V81 A;  4OZA A;  4YTM B;  1HTO A;  5J2R A;  2M1M A;  3BWU D;  2LXA A;  4AJY B;  4HJK A;  2ICI A;  3W9C B;  2HTH A;  4HKQ A;  2KD0 A;  1YNT E;  4XX5 A;  1YN3 A;  4IKG A;  1YIW A;  2D3B A;  4FN2 A;  3AE9 B;  3O65 B;  4WWN A;  2EMT A;  2N9E B;  3A9K A;  2BB5 A;  4LCD E;  3VFK A;  3IXS A;  1KOT A;  1PDX A;  1IBX A;  2LHD A;  1E7U A;  5EDS A;  2MCN B;  1TKG A;  1SE3 A;  1TBE A;  4ICU A;  1ENF A;  4PYU A;  1RAX A;  2K8B A;  2JWU A;  4A3P A;  4FHJ A;  2IPK D;  3GE8 C;  2KO3 A;  3AUL A;  1EF5 A;  3BK1 A;  2DHZ A;  2KWU B;  4PS8 A;  2FNJ B;  1R4M I;  4PK1 A;  4M8M A;  1XCT L;  3ABV B;  4XWW A;  3V6C B;  3FIL A;  4W9I A;  1SEB D;  1P98 A;  2KC1 A;  5CX3 A;  2RDG A;  2N9K A;  1MI0 A;  4XYC A;  5IN7 A;  4LDT B;  3DWG C;  3GE3 C;  4FLH A;  3KUC B;  2GBK A;  3ONS A;  1P1A A;  4L23 A;  3LYY A;  2BVC A;  1ESF A;  2UYZ B;  3R66 C;  2LHE A;  2KN5 A;  4W9G A;  2MH7 A;  2N9X A;  2CHW A;  2KHW B;  2M0X A;  4HRO A;  4AWJ A;  3AE5 B;  4H2A A;  4LJO B;  1H8C A;  3DHG C;  3O13 A;  3I57 A;  3EC8 A;  2D2Q A;  3HVD A;  4HKZ E;  2AL3 A;  1J7A A;  1UWM A;  4N6E B;  3RNG C;  4DWF A;  1OEY A;  1GB1 A;  1KRH A;  3TL5 A;  2BBC A;  4NPN A;  3GZN I;  1ZGU B;  3MHS D;  3WAL A;  5HKH A;  2WDR B;  4LTU A;  4IWP A;  3DVG X;  1WGK A;  4RF0 A;  1PQS A;  5BMG A;  1IYF A;  3L4P A;  3P2B A;  3ZDM C;  3DHH C;  3KLS X;  1T0R C;  4S0R A;  2VZK D;  4C7Z A;  2A4Z A;  4MH0 E;  1GB4 A;  4YTN B;  3RT3 B;  4P7I A;  3B9J A;  3P4P B;  1KF6 B;  2SEB D;  2KLC A;  1OQQ A;  3K9O B;  4HK2 A;  4TV3 A;  3B0A A;  3GP7 A;  1UUP A;  2FE8 A;  2KQ4 X;  3VTW A;  2CJN A;  2BB6 A; 
#chains in the Genus database with same CATH homology
 1L7Y A;  3NOB A;  5KHQ A;  2RR9 A;  3H7P A;  3HM3 A;  3QX1 A;  3WA0 A;  5E6P A;  3NZS A;  3ZUN A;  2KAN A;  2W9N A;  3LDZ E;  2KOX A;  4EEW A;  4FBJ B;  3L0W B;  2LWP A;  1GC7 A;  1WJ6 A;  2JRH A;  2V1Y A;  3OLM D;  5AZH A;  3V60 A;  5C1Z A;  2K6D B;  2NVU I;  4II2 B;  1F9J A;  4RMA A;  1Q0W B;  2LI5 A;  2CHX A;  3HM6 X;  2KX0 A;  3VHT C;  1ZW7 A;  2LGD A;  1WXS A;  5CHV C;  3AI5 A;  3DDC B;  1Q5W B;  1SIF A;  1UBI A;  4FJV B;  3M95 A;  4II3 B;  2L00 B;  1RLF A;  2JVC A;  2LVP A;  2RPQ A;  2BYV E;  4BKG A;  5JHB A;  2BWF A;  3ZNG C;  1WF9 A;  4TUU A;  2MBO A;  2LUE A;  2XBB C;  4MGZ E;  4W9K A;  3JSV A;  1TGZ B;  3IBE A;  4ANW A;  2A5U A;  1WE7 A;  3DBH I;  2IBI B;  2KX3 A;  4G11 A;  4NJ6 A;  4NAW A;  2KFK B;  4W9F A;  4MM3 A;  5DPW A;  2LJ5 A;  3V61 A;  1TZ1 A;  4PS3 A;  2V4L A;  2NBV B;  3PRZ A;  2JXX A;  3ZRF A;  3KUZ A;  3KW5 B;  4AOF A;  4EZK A;  2KTR A;  4JGH B;  1LFD A;  2HD5 B;  3VAW A;  4B95 A;  3ZVV A;  1SE9 A;  1GJZ A;  3IG3 A;  4W9J A;  2DEN B;  2ASQ A;  2VRR B;  2MSE D;  3DPD A;  3PLV A;  5GMV A;  4ZYN A;  2KFJ A;  2L0F A;  2RGF A;  3PHX B;  4KDI C;  4ANX A;  2C9W B;  2KJ6 A;  4GIV A;  4GDL A;  2LRU A;  4K1R B;  4W9D A;  2J0J A;  1WJU A;  2D11 A;  3CMM B;  1BT0 A;  2KK8 A;  1UEL A;  3HIZ A;  4HPM B;  4MEM A;  2D07 B;  2KZR A;  2JZ3 B;  4IM0 A;  3A1Q A;  3U7D A;  2N1V A;  4KV2 A;  4DDI D;  4RM8 A;  3OJ3 A;  2BGF A;  4FA6 A;  3TCA A;  4CHK A;  1D3Z A;  1YJ1 A;  1GNU A;  2BKF A;  2BPS A;  2DZJ A;  2PE9 A;  1V6E A;  3W1Y A;  1RFA A;  4EUT A;  3DBL I;  2HJ8 A;  4N9F 4;  1WYW B;  4LDT D;  4AUQ C;  4EZJ A;  1I42 A;  2JY6 A;  1P3Q U;  2CR5 A;  1I35 A;  2NBU A;  4AJW A;  4ANV A;  2KQ7 A;  1E7V A;  2LAS A;  3HHM A;  2BYF A;  4DHZ B;  3A33 B;  3ZNH B;  2K25 A;  4OVU A;  4XZ4 A;  2LXC A;  1J8C A;  4B6W A;  2G45 B;  5D2M B;  4CO7 A;  2KVR A;  2AYO B;  3V6E B;  2K6Q A;  3QQ8 B;  3QAR A;  3ML8 A;  3WAO A;  2GBN A;  5D94 A;  2LVO A;  3CSF A;  1WE6 A;  2LGY A;  3OAW A;  3DVG Y;  3QC8 B;  5CHF A;  2KJR A;  1EO6 A;  1V5T A;  1V2Y A;  3H1U A;  2K1F A;  2OJR A;  4FHK A;  2KDI A;  2DYO A;  3ECI A;  3VUW A;  2J0M A;  2O2V A;  2GMI C;  3PVL A;  1GG3 A;  2WYQ A;  3VUX A;  1V5O A;  3WAM A;  5LXI B;  2NR2 A;  3PGE A;  3V62 A;  3ZTD A;  2IZV B;  3KYC D;  2K39 A;  2Z0E B;  1WGG A;  3PLU A;  1OEY J;  4FUL A;  1WZ3 A;  3H7P B;  4HPL B;  1UZX B;  5DPT A;  3M3J A;  2KQS A;  1WXV A;  2DAJ A;  2KLG A;  1WJN A;  2N1W A;  1E5W A;  3DCG A;  3VH3 B;  2O2V B;  2KJH B;  2M4N A;  4JQW C;  4GOC A;  1WX8 A;  2L76 A;  5JZE B;  5JHA A;  2OOB B;  3WIM A;  2NPT B;  2DZM A;  3W1S C;  1WH3 A;  2EMS A;  2O6V D;  3PRE A;  2ZPY A;  5J17 A;  1WR1 A;  3X0W A;  4KIK A;  2ZVN A;  3PT2 B;  4GSW A;  3QJZ A;  4KSL C;  3ALB A;  2KKC A;  4IG7 B;  2RSU A;  4HXD A;  2IYD B;  2NCN A;  3A1Q B;  3MJW A;  3GOE A;  2KWV B;  3ZRC A;  2NS5 A;  4BOS C;  5L95 C;  1WXA A;  4W9L A;  4IWO A;  2FCQ A;  2K8H A;  2ZEQ A;  2AEH A;  4MDK E;  4DHJ D;  5LXH A;  4GN1 A;  1GUA B;  2ZNV C;  3H9D A;  5E6N A;  4X57 B;  2WDT B;  5AZF A;  1MG8 A;  2IY1 B;  2REX A;  2N7E A;  3ZDT A;  3W1S A;  3QIJ A;  2IO2 B;  2MBE A;  1UH6 A;  1WY8 A;  3VQI A;  3R3M A;  2MBH A;  3BIN A;  4BVU C;  4HVB A;  5E6O A;  3BY4 B;  4GDK A;  2MW5 A;  2GBM A;  1A5R A;  3QAQ A;  2R2Q A;  1KLV A;  3Q3F A;  2C7H A;  1E8Z A;  2Z59 B;  1WRD B;  3RUI B;  5DCN A;  2MLB A;  1SGH A;  2ZCB A;  2KWC A;  1J19 A;  4I6N B;  4JIO U;  3OJ4 B;  4PYZ A;  1WI0 A;  3JVZ X;  4TQ0 A;  2XK5 A;  3IHP C;  3APC A;  1WGH A;  5AZG A;  4HDO A;  2IO0 B;  3PSE B;  4GDL B;  4KSK C;  2JWZ A;  1LXD A;  3EHV A;  3TIX A;  3PS6 A;  2DAF A;  4G3X B;  3DBS A;  3UIP B;  2D3G A;  2JF5 A;  3NZU A;  3RUL A;  3QCA A;  4BKS D;  3UQA A;  2Y5B B;  1E8W A;  4GU2 A;  4WJQ A;  4HCP B;  4BFR A;  2PPH A;  3ZTC A;  3AU5 A;  3L16 A;  3WAN A;  2M8S A;  3QHT A;  1HE8 A;  4NAW B;  2FAZ A;  4DHZ E;  3DVN V;  4HDQ A;  4ASW C;  3WAP A;  3KVF B;  1WR6 E;  2RD0 A;  3L08 A;  4ZRK A;  5IAA C;  1FXT B;  4FJY A;  2CU1 A;  4EKU A;  3ZNZ B;  5AEK B;  3KUD B;  2FIF A;  4URK A;  3UQB A;  2KXJ A;  2O6V B;  4TKN A;  4G0N B;  4JL9 A;  3ML9 A;  4KDL B;  5TR5 A;  2DZI A;  3NY5 A;  2WX1 A;  2L7R A;  3A9J B;  3C0R B;  4WAA A;  5BO4 B;  1S1Q B;  1TTN A;  4NQL B;  2ZNV B;  4GMV A;  4TQ1 A;  2LZ6 A;  2KMC A;  3RYT A;  3QWZ B;  4W9H A;  2D10 A;  3VUY A;  2L05 A;  2FCM A;  5JH5 C;  5D7G A;  2N9P C;  3A4S C;  4A3O A;  2DYB A;  4GB9 A;  3ZLZ A;  1Z5S B;  3H7S A;  4WQO B;  4KVG B;  2C5L C;  2NPT A;  4I6P A;  2QHO A;  3A4R A;  4W9E A;  4B9K A;  1WX7 A;  3LJ3 A;  4LJP B;  4NY0 A;  2YLM A;  1VCB A;  2C7N B;  3TBL D;  4K7S A;  3DBR I;  4MSQ B;  2M17 A;  1GC6 A;  3JYU A;  4MJS A;  4K7U A;  2YVC A;  3JW0 X;  2GOW A;  1K8R B;  4J6I A;  1EF1 A;  3VTU A;  2JUO A;  3K9P B;  2L8J A;  3RD2 A;  3R7Q A;  3ZW3 A;  2L0T A;  4ANU A;  3L10 B;  3APD A;  3SU8 X;  1YX6 B;  4F7Z A;  3NHE B;  3QA8 A;  3ZKJ C;  2FUH B;  3DQV A;  3S2A A;  2KTR B;  1WGD A;  4KZ0 A;  4NJ7 A;  3X23 A;  4FAD A;  2JT4 B;  1P0R A;  2L3Z A;  4M0W B;  2EKE C;  4NNJ B;  3M63 B;  3UF8 A;  4HLE A;  1E8X A;  4AP4 C;  1T0Y A;  2N4F A;  2KTF A;  4IW0 A;  1YX5 B;  1WZ0 A;  1J0G A;  1OGW A;  2JZZ A;  3DVN U;  3TJP A;  4PS7 A;  1P9D U;  1V49 A;  1RRB A;  1WMH B;  3VH4 B;  1KJT A;  1LQB A;  1V9J A;  1WGY A;  1WX9 A;  2DZK A;  3EEC A;  3L54 A;  4G50 A;  3ZIM A;  2G4S A;  3MTN B;  3T9L A;  4BBN C;  4BOZ B;  4WJO A;  1IP9 A;  2CS4 A;  2BWE S;  5KHO A;  3PPA A;  3H6N A;  4ICV A;  5C23 A;  4FJZ A;  2GBJ A;  1V81 A;  2WX0 A;  4NQK E;  4F1S A;  3CST A;  2KMA A;  2K8C A;  3NS8 A;  5J2R A;  2V3S A;  3B1L X;  4E3C A;  3RZF A;  3SD5 A;  2ZVO A;  2Z0D B;  4ZRJ A;  2KNB A;  1V80 A;  3RZW C;  1Z2M A;  2M1M A;  2LXA A;  2MQJ A;  1WM3 A;  3CF6 E;  4AJY B;  1XT9 B;  1NDD A;  4HJK A;  4DK5 A;  5LLI A;  2NBW B;  2HTH A;  1S3S G;  2IO3 B;  3DOW A;  1VD2 A;  4ZRI A;  2KD0 A;  2C60 A;  1UD7 A;  5G2N A;  4XX5 A;  5CHW A;  1WMH A;  4EZL A;  3AXC A;  4DXA B;  3VXW A;  2C7M B;  1YIW A;  4OVV A;  4FN2 A;  4GDK B;  3O65 B;  4WWN A;  3TMP B;  1WM2 A;  4WWO A;  2EMT A;  2N9E B;  3A9K A;  4DDG D;  1OQY A;  1E8Y A;  2WWZ A;  3D32 A;  3IVF A;  3N3K B;  4IM3 A;  4JLC A;  4LCD E;  3VFK A;  4F8C B;  4MGK E;  1KOT A;  4ZDV A;  1E7U A;  2XEW A;  1Q1O A;  5EDS A;  2IO1 B;  2MCN B;  3Q3J A;  2MA9 B;  3M62 B;  4EFO A;  3EFU A;  1LM8 B;  1TBE A;  4ICU A;  2KDB A;  2MP2 B;  2N7D A;  4PYU A;  1CMX B;  2J0K A;  3APF A;  1RAX A;  2K8B A;  4A3P A;  4FHJ A;  2MRP A;  2O6V A;  2DX5 B;  2KO3 A;  3AUL A;  1EF5 A;  3A9K B;  2KDF B;  3HK0 A;  2G4D B;  3JSV B;  1L2N A;  2DHZ A;  2KWU B;  1R4N I;  2FNJ B;  4PS8 A;  1WJ4 A;  3B08 A;  5FR6 A;  1R4M I;  4KIK B;  2XK5 B;  2JRI B;  4M8M A;  2KFK A;  3IFW B;  2GBR A;  4DBG A;  4EOY A;  2DYM A;  4RM9 A;  1AAR A;  3UGB B;  1G6J A;  3V6C B;  3UIO B;  4WJP A;  2FID A;  4W9I A;  2KDE B;  1P98 A;  1XD3 B;  2BYE A;  2KC1 A;  5CX3 A;  2AL6 A;  1WGR A;  1YD8 U;  4LDT B;  1ISN A;  2PJH A;  2I1K A;  2LGX A;  2FCN A;  4FLH A;  3KUC B;  2GBK A;  3ONS A;  1P1A A;  4HWI B;  2UYZ B;  3PHW B;  2JPH A;  3R66 C;  1H4R A;  4MGI E;  4K81 A;  3ENE A;  2KN5 A;  3QK0 A;  4IM2 A;  3A9J A;  4W9G A;  3SDL C;  5CTR C;  4M8N A;  5DPS A;  2ZCC A;  2N9X A;  2CHZ A;  3I3T B;  4WWP A;  2CHW A;  2KHW B;  2M0X A;  4A20 A;  4AWJ A;  2IY0 B;  4LJO B;  1H8C A;  1EUV B;  5D6J B;  4GXB A;  4XC2 A;  1C1Y B;  2FCS A;  2I1J A;  2MWS B;  3EC8 A;  4BBN F;  4W9C A;  1E90 A;  2D2Q A;  4HCN B;  2UWQ A;  3PTF C;  3RCZ A;  4E74 A;  1X1M A;  2BKR B;  3KYD D;  4K7W A;  2AL3 A;  1M94 A;  1NI2 A;  2LD9 A;  3L17 A;  2KC2 A;  4DWF A;  5DPR A;  1OEY A;  1KM7 A;  3PRM B;  4I6L B;  3N32 A;  1ZKH A;  1OTR B;  3TL5 A;  2AWT A;  2J7Q B;  4NPN A;  3GZN I;  1ZGU B;  3MHS D;  4IWQ A;  3WAL A;  2HE7 A;  4KZC A;  3PV1 A;  2CKH B;  4MGY E;  4MJS B;  2ZJD A;  5HKH A;  3ZO5 B;  1V86 A;  4YL8 A;  3U30 A;  4WJN A;  1WFY A;  2LRW A;  2PEA A;  5J18 A;  4IWP A;  1C3T A;  5IA7 A;  3DVG X;  4IC7 B;  5L83 A;  1PQS A;  3SHQ A;  1Y8R C;  3U8Z A;  4E71 A;  1IYF A;  3AU4 A;  3PZD A;  4CYE A;  2ZZP B;  1IPG A;  2ZPN A;  2BF8 B;  2PE6 B;  5G55 A;  3P2B A;  3ZDM C;  2MX2 A;  1UBQ A;  4DHJ B;  2A4Z A;  4MEL A;  2MP2 A;  2MBQ A;  1U4A A;  2B3A A;  4MH0 E;  3T8M A;  3RT3 B;  1QZE A;  4P7I A;  3VTV A;  3R7R A;  1WIA A;  2LVQ A;  4MSM B;  2G3Q B;  2KLC A;  2R2O A;  3K9O B;  3UIN B;  3N30 A;  4BKT A;  3VDZ A;  3ZNI D;  4HK2 A;  1NBF C;  1UGM A;  3B0A A;  3KH0 A;  4TV3 A;  3L13 A;  3VVW B;  2MBB B;  1JRU A;  1XQQ A;  4IUM B;  4BKS A;  1YQB A;  3VTW A;  3PRP B;  4GGQ A;  1WXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...