1V5TA

Solution structure of the ubiquitin-like domain from mouse hypothetical 8430435i17rik protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
90
structure length
90
Chain Sequence
GSSGSSGLPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTRESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Ubiquitin-like Domain from Mouse Hypothetical 8430435I17Rik Protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords 8430435I17Rik Protein
total genus 7
structure length 90
sequence length 90
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2003-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v5tA00
1EF1A 2LRWA 3ZNZB 3A4SC 2K39A 3N3KB 3NOBA 2DYOA 1RAXA 3ZVVA 1OGWA 3ZTDA 5IAAC 3QJZA 4PS3A 3ZO5B 5JHAA 3BINA 3TJPA 4WJQA 2MX2A 2CKHB 2XK5A 2DZIA 3VFKA 2NCNA 2NBUA 1SIFA 2WX1A 2IBIB 4OVUA 4E74A 2KTRB 2NBVB 1YQBA 4DHJD 4ICUA 4KVGB 3RD2A 3R3MA 3CMMB 3B0AA 1EF5A 2JT4B 4LDTB 2L0FA 1KM7A 2N7DA 2ZNVC 2KVRA 3V62A 3ZTCA 4DHZB 2C9WB 5CHWA 4DDGD 4ANWA 3ECIA 2C7NB 3DVNU 1H8CA 4MSMB 4HK2A 2AYOB 4B6WA 3HK0A 4WJNA 4HCPB 5CX3A 1E8WA 2M17A 2MCNB 4BBNF 1C3TA 5E6NA 4HXDA 4IC7B 4NAWB 5D2MB 4AJYB 2KJHB 1TZ1A 2D11A 2DYMA 2N7EA 2ZCCA 4GSWA 3ZNHB 1GUAB 1QZEA 3A9JA 2FIDA 4HCNB 3VHTC 3ENEA 1PQSA 2N9XA 3ZNID 2UWQA 5CHVC 5J17A 2CU1A 1L2NA 1Z2MA 2Z59B 3RCZA 1V5TA 2A4ZA 3M62B 4BKTA 3JVZX 3PHXB 3APFA 4TV3A 4GOCA 2KFKA 4MH0E 2XEWA 2BYVE 2WWZA 3H9DA 3UINB 2PE6B 2JRHA 2NR2A 2RR9A 4ANXA 2N1VA 1WFYA 3QCAA 1J0GA 3K9PB 4W9IA 2KC2A 1V9JA 2NPTA 1YD8U 2N1WA 4KIKA 3V6EB 1WR1A 2KMCA 2KFJA 1WGDA 3A9JB 2LVQA 3T8MA 2V3SA 3L54A 1J19A 2L3ZA 4GDKB 3R66C 3WAMA 4GU2A 2BPSA 2N4FA 3NZSA 2R2QA 1E8ZA 3KW5B 2O2VA 4P7IA 3IVFA 2KWVB 1G6JA 2IO2B 1IPGA 3OLMD 3QX1A 1TBEA 1YX6B 3L10B 2FAZA 3PRMB 2KLCA 2DX5B 4M8NA 3PVLA 2W9NA 4E71A 1Y8RC 3RULA 4W9GA 2LASA 3MJWA 3P2BA 3R7RA 2Z0EB 1ZKHA 1EUVB 4W9EA 3L13A 1KJTA 2J0KA 4XZ4A 1V2YA 2FCMA 4W9LA 3V60A 2L8JA 4K1RB 4K81A 4WWPA 3AU5A 2KOXA 3M95A 2YLMA 3H7PA 1C1YB 3PGEA 2GBJA 4PS7A 1WI0A 2DZKA 2M8SA 2MBEA 3OJ3A 3CSFA 3NY5A 4HPLB 4NQLB 3RZFA 1M94A 2KK8A 2REXA 4IG7B 1KLVA 3SHQA 2C60A 2NS5A 3EFUA 4GB9A 5JZEB 4W9DA 3VTWA 1ZGUB 3LJ3A 1GC6A 4IUMB 3IBEA 1P3QU 1S1QB 2IY1B 2V1YA 2KNBA 2DZJA 2LGXA 3JYUA 5DPTA 1GNUA 1T0YA 1WXVA 2KTFA 4LDTD 1V86A 4NQKE 3RZWC 3ZDTA 1TGZB 2O2VB 4GDLA 3KVFB 4E3CA 5AZHA 4FBJB 4URKA 2MP2B 2QHOA 2WX0A 3ZNGC 3VDZA 4HDQA 2KC1A 1X1MA 2KX3A 2LXAA 2O6VA 4CHKA 4MELA 3KH0A 2JPHA 1WJNA 2MSED 4WJOA 1I35A 3PTFC 3KUZA 2J0MA 2GBRA 5DPWA 2WDTB 4II2B 2K1FA 1UBIA 2KHWB 3AI5A 1R4NI 2ZVOA 2K6QA 4JL9A 2LZ6A 3QK0A 2KFKB 1GJZA 2AWTA 3VQIA 4HLEA 1V80A 2LVOA 5J18A 5G55A 2PE9A 4MJSB 4HWIB 1JRUA 1UD7A 2GMIC 1WZ0A 2K6DB 3Q3JA 3DVGY 4GIVA 1WIAA 1WGHA 3VVWB 4NY0A 1E7UA 1WXAA 1WGGA 1XQQA 2LRUA 2KJ6A 3QQ8B 3VTUA 4J6IA 3QHTA 4IM3A 1E5WA 1SE9A 3HM3A 4KSLC 4JLCA 4NAWA 3ZRFA 2NVUI 2RSUA 4MSQB 2MLBA 2JF5A 5JH5C 3BY4B 5C1ZA 3AXCA 2KANA 4RM9A 1Q5WB 2GOWA 4BFRA 4A3PA 2L05A 1WY8A 2EMSA 2IY0B 3L17A 3PRZA 5BO4B 2JXXA 2ASQA 5AZGA 3DOWA 2GBMA 1BT0A 1UZXB 3V61A 3ZIMA 3DBLI 3OAWA 1WF9A 2IO0B 2AL6A 2FNJB 3QWZB 3ZW3A 4K7WA 3DVNV 4FJZA 4BBNC 3H1UA 1A5RA 2L0TA 3SU8X 4MGYE 2FIFA 5LXIB 4HPMB 5D94A 3UQBA 2KXJA 2ZEQA 1WJ6A 2KMAA 1OEYA 4CO7A 3A9KA 2HJ8A 4JIOU 4KDIC 4KSKC 4MJSA 3ML9A 3B08A 2CHZA 3ONSA 3U8ZA 3VTVA 4ANVA 2XK5B 5J2RA 2KTRA 4DHJB 4MEMA 2KWUB 1YJ1A 2BYFA 1WGRA 2ZPYA 4W9KA 2BGFA 1XT9B 1WJUA 5L95C 1E7VA 2MWSB 3X23A 3DDCB 4ZDVA 3GOEA 3K9OB 2KQ7A 1D3ZA 2JUOA 3LDZE 3VAWA 3VUWA 4BKGA 2PEAA 4GDLB 2KD0A 3VH3B 4OVVA 4ZRJA 3PRPB 3B1LX 1LFDA 4PS8A 3R7QA 4CYEA 4RMAA 4W9FA 3A33B 4GGQA 2DZMA 3U30A 1S3SG 4B9KA 2KDEB 4FA6A 3KUCB 2PPHA 4DHZE 1LXDA 1HE8A 4F1SA 2PJHA 5EDSA 2ZNVB 1WX8A 3UIOB 4FLHA 4BKSA 5E6OA 2G4SA 3WALA 1UBQA 1NI2A 1LM8B 3WA0A 1I42A 1FXTB 3L16A 1RLFA 3W1SC 1Q1OA 5D7GA 2FCSA 2L76A 3CF6E 4AOFA 3EC8A 3PLUA 3HIZA 5FR6A 1VCBA 2K8HA 1VD2A 4MGKE 5G2NA 3T9LA 3TCAA 2LJ5A 4LJOB 2A5UA 1ZW7A 3MHSD 2HD5B 4ICVA 2LGYA 3GZNI 3HM6X 4IWPA 4MDKE 3WAPA 2B3AA 4MGZE 4EOYA 1UH6A 4KV2A 3H7SA 3PT2B 2YVCA 4G0NB 4I6NB 4IW0A 3ZLZA 1P0RA 1Q0WB 4F8CB 2LUEA 2KQSA 2IO3B 3QIJA 5TR5A 2LD9A 4FJYA 3DBSA 1WRDB 3APDA 5DPRA 1L7YA 1AARA 2KX0A 5CHFA 3VXWA 4ZYNA 3V6CB 2O6VD 2KN5A 2ZZPB 4ZRKA 4IM0A 2JZZA 1IP9A 3QA8A 4NNJB 1LQBA 2KDBA 2MQJA 4A20A 4BOSC 1WZ3A 2NBWB 4HVBA 1J8CA 3UQAA 1TTNA 3PPAA 3PS6A 1OQYA 1WMHB 2L7RA 3DQVA 3TL5A 2LI5A 2Z0DB 4HJKA 3DBHI 1R4MI 1WH3A 2G45B 3L0WB 4WWNA 3EHVA 2ZCBA 5JHBA 2KO3A 4GXBA 2VRRB 2I1KA 3AULA 2EKEC 3TIXA 3PREA 2K8BA 3Q3FA 1H4RA 2DAFA 4G50A 3APCA 4FN2A 4XC2A 5C23A 5DCNA 4EEWA 1WYWB 2KKCA 4W9HA 2CS4A 1WXSA 3HHMA 1P98A 4ZRIA 2J7QB 3ZKJC 2OJRA 2BF8B 5AZFA 4EUTA 2KLGA 1WX7A 3TMPB 2FCQA 2KDFB 3ZRCA 2Y5BB 4DBGA 1XD3B 5IA7A 1V81A 2FCNA 3C0RB 2N9EB 2JY6A 2BKRB 2GBKA 1SGHA 1GC7A 4EKUA 3DPDA 3O65B 1RFAA 2AEHA 4YL8A 5L83A 3EECA 1WMHA 4W9CA 3MTNB 2BYEA 4FHJA 2MBOA 1UELA 1P1AA 3S2AA 3TBLD 1U4AA 5LLIA 3DVGX 2IZVB 4M0WB 2JWZA 2CHWA 5KHQA 2KDIA 5CTRC 4TUUA 1KOTA 2LXCA 2JRIB 2LVPA 5D6JB 3M3JA 4FJVB 2MW5A 1GG3A 1P9DU 2D07B 4WWOA 3X0WA 2WYQA 4B95A 3SD5A 1V49A 4JQWC 2BWFA 3QC8B 4PYUA 2DYBA 3AU4A 4II3B 4MM3A 3A1QA 2JVCA 1K8RB 3VH4B 4N9F4 2KWCA 2ZJDA 3N32A 4FHKA 2GBNA 5E6PA 2DAJA 3ML8A 2BWES 3RYTA 4K7UA 4AUQC 2D2QA 1CMXB 3L08A 3N30A 2UYZB 3QAQA 3WIMA 4NJ6A 5LXHA 4HDOA 4RM8A 2M1MA 2MBHA 1RRBA 2M0XA 1F9JA 3A9KB 3DCGA 3ALBA 3OJ4B 4XX5A 1IYFA 3U7DA 1Z5SB 2KZRA 1V5OA 3DBRI 4M8MA 5KHOA 4KZCA 1WM3A 3RT3B 1NDDA 1WR6E 3I3TB 2MBQA 2OOBB 3IG3A 2RPQA 4NJ7A 4AP4C 3A1QB 3PV1A 4BVUC 3PSEB 4TQ0A 2HE7A 3IHPC 2G3QB 3VUYA 4ANUA 3NZUA 2NPTB 3W1SA 2L00B 3ZUNA 3PLVA 3SDLC 3A4RA 2D10A 4F7ZA 4AWJA 1WXMA 2I1JA 2K25A 4MGIE 4BOZB 3UIPB 2ZPNA 2K8CA 2LWPA 4AJWA 5AEKB 3H6NA 4A3OA 1OTRB 2XBBC 1WE6A 4G3XB 3PHWB 2IYDB 2D3GA 4GN1A 1WX9A 3JSVB 4DXAB 4GDKA 4X57B 4WJPA 2N9PC 4IWOA 4WAAA 3UF8A 5HKHA 1YIWA 1WJ4A 2MRPA 4DWFA 3NHEB 4PYZA 4TQ1A 2V4LA 4K7SA 2BKFA 4DDID 2DHZA 5GMVA 2EMTA 4ASWC 3VUXA 3RUIB 4EZJA 4LJPB 1MG8A 3WAOA 4G11A 2RD0A 3KYCD 4LCDE 1UGMA 3CSTA 1ISNA 3IFWB 4KIKB 3W1YA 4I6LB 3UGBB 2IO1B 2MBBB 1WGYA 4JGHB 1NBFC 2JZ3B 4WQOB 1YX5B 4FADA 3NS8A 2ZVNA 5DPSA 1WM2A 4EZKA 3D32A 3KUDB 2C7HA 2CR5A 3ZDMC 2KJRA 4DK5A 1OEYJ 4W9JA 2DENB 2CHXA 4TKNA 2G4DB 2M4NA 2AL3A 4GMVA 3JSVA 4NPNA 2HTHA 3PZDA 2MP2A 3KYDD 1E8YA 2RGFA 2J0JA 2R2OA 4IWQA 2LGDA 1WE7A 2MA9B 4KDLB 1E90A 1E8XA 3M63B 4EZLA 2FUHB 3H7PB 4I6PA 2C7MB 4IM2A 2C5LC 4EFOA 2O6VB 4FULA 3QARA 3WANA 3JW0X 4BKSD 1V6EA 4KZ0A 1EO6A
chains in the Genus database with same CATH superfamily
4ZRQA 2INNE 3ZNZB 1BXTA 1ZDXA 1R4MB 1OGWA 5JHAA 2QSDA 3QJZA 3ZO5B 2WXPA 1N5WA 4E74A 3FILB 4UDUC 2NBVB 5GXGB 3RD2A 3IT6B 3PZ8A 2JT4B 2N7DA 1NI3A 3ZTCA 1EWYC 2C9WB 4DDGD 3DVNU 1H8CA 4YTPB 4WAFA 4HCPB 5CX3A 3I5JC 4HROA 4HXDA 4IC7B 4NAWB 4OW0A 5D2MB 2N7EA 3ZNHB 1GUAB 3VHTC 1Q10A 3ABVB 1SEBD 1Z2MA 3JVZX 3APFA 1JWSD 4MH0E 2V3PA 5EE0A 4RH6A 1NVID 1WFYA 3QCAA 4L2YA 3K9PB 1L0XB 4KIKA 3EUB2 3NS1A 2SEBD 3A9JB 3NUHB 1SBBB 1GOZA 2V3SA 1J7BA 3L54A 2NTSA 3AE1B 2L3ZA 3AB5A 2N4FA 3IAS1 2WGSA 2ZW1A 3LB8C 3IVFA 2KWVB 2IO2B 1MJDA 3CWIA 1FD6A 3AE4B 2GB1A 5FK9C 1PGAA 2LHDA 5BYRA 2Z0EB 2D5GA 4W9EA 1KJTA 1C4PA 3ZJTA 2KOXA 2W3SA 1C1YB 1WI0A 3URYA 3AEFB 2KK8A 2MJDA 4GB9A 4RF0A 2TSSA 3VTWA 2BT6A 1P3QU 2WXMA 2IY1B 2KNBA 2LGSA 1GNUA 3ZDTA 1TGZB 4FBJB 4C00A 2WX0A 3VDZA 1F0ZA 1IGDA 1UUPA 3KUZA 4II2B 1UBIA 2KHWB 2ZVOA 1C9FA 2J52A 3QK0A 5J18A 2PE9A 3VR8B 4HWIB 1JRUA 1UD7A 1VZ8A 1WZ0A 4N58A 3GP7A 3DVGY 1WGHA 1WXAA 4M00A 2KJ6A 2EELA 1SE9A 3HM3A 4JLCA 2RSUA 2KDMA 3BY4B 1AW7A 2KANA 2IGHA 4A3PA 1WY8A 2EMSA 3L17A 5BO4B 1F77A 4KKJA 2ASQA 1STEA 3DOWA 5AZGA 2GBMA 1BT0A 1UZXB 1WF9A 1CZPA 1A5RA 2LGIA 2L0TA 4MGYE 2FIFA 1QOBA 2KXJA 2KMAA 4CO7A 2BYTA 4KSKC 2KTRA 1YJ1A 1V97A 5LNK1 2BYFA 1WGRA 2BGFA 3EA6A 1KF6B 1WJUA 2MWSB 1FRRA 4P1CC 3K9OB 1D3ZA 2JUOA 2PEAA 1TKGA 4ZRJA 3PRPB 4LNFA 4CYEA 4GGQA 2KDEB 2MJ3A 4DHZE 1LXDA 3N1ZC 5HHDG 2ZNVB 3Q3OC 4BKSA 5E6OA 2G4SA 3WA0A 3NVVA 5C3JB 1HTQA 3CF6E 1DOYA 5FR6A 4C80A 1QOGA 4LJOB 1ZW7A 4TSSA 4XWWA 4MGZE 4KV2A 3H7SA 1I4RA 1Q0WB 3U52E 3IAM1 5TR5A 2IO3B 5AUIA 3VXWA 2KN5A 2ZZPB 4ZRKA 3AE5B 1R4NB 1ZPSA 2WU5B 1LQBA 4BOSC 3PS6A 1RWSA 4BZAA 2L7RA 3TL5A 2PTLA 4ACFA 2JZPA 5JHBA 3OG5A 2Y5PA 3AULA 2EKEC 3TIXA 3Q3FA 1H4RA 3MC0B 1RFKA 5DCNA 4EEWA 1WYWB 1SF0A 4ZRIA 4KKIA 3ZKJC 2OJRA 1WX7A 4ARIA 2KDFB 1T5XD 2VH1A 1TZOA 1ZUD2 2N9EB 4LNNA 3ZXVA 2H89B 2WP9B 3EECA 3MTNB 1WGKA 1P1AA 3C8YA 2CHWA 5KHQA 2KDIA 4TUUA 2LXCA 4Q2JA 1PGBA 2MW5A 1PDXA 5BYSA 3FKYA 4B95A 1V49A 3AE6B 3QC8B 4WH4A 4HJGE 3AU4A 2PW9A 2QIEB 4YSZB 3P4QB 1P7EA 3E56A 3ML8A 1UWXA 3QAQA 1FIQA 4RM8A 4AS1A 2M1MA 4XX5A 1F9JA 2HDEA 3Q3NC 3ALBA 1IYFA 1DOXA 3U7DA 3PZ7A 1Z5SB 1V5OA 4KZCA 5AUKA 4DXGA 2PLPA 3PV1A 2INPE 4LLGM 2G3QB 3VUYA 3NRZA 2NPTB 3NZUA 2L00B 3AEBB 2D10A 4AWJA 1XO3A 4MGIE 4XGAB 5FR3A 4B0MA 4GN1A 1WX9A 3JSVB 3ZQ4A 1B9RA 1TS5A 2N9PC 4WAAA 1OFFA 1QLBB 2MRPA 4TQ1A 2WXFA 2BKFA 2DHZA 5GMVA 2VZKB 3RNBC 1JMLA 4ASWC 3VUXA 3RUIB 4EZJA 1LO5D 1MG8A 4YTMB 2IDYA 1M4VA 3IFWB 3NVYA 4RF1A 1JWUD 1AWDA 2JZ3B 4WQOB 1HZ5A 5DPSA 1WM2A 4EZKA 3D32A 3KUDB 2CU3A 4RGTA 3ZDMC 2KJRA 4DK5A 4W9JA 2CHXA 2HTME 2G4DB 3JSVA 1HXYD 2J0JA 4IWQA 3BWUD 2WQYB 2LGDA 1T0SC 4KDLB 3VRBB 4IM2A 4XDDA 3KWVA 2C7MB 2RMMA 3R2IA 3WANA 2WXRA 4KZ0A 2JWUA 1FMAD 2I2YA 1RAXA 4OZBA 1R7SA 1E9MA 2CKHB 1I4XA 1DOIA 2DZIA 3VFKA 3TEZA 1YQ4B 1SIFA 2WX1A 2IBIB 2W82A 3BVMA 4ICUA 1MHHE 1UF0A 2WXKA 3R3MA 3B0AA 1EF5A 1KM7A 2ZNVC 3V62A 1FRDA 1YQ3B 3AE2B 1L4DB 2BW2A 3ZJUA 4HK2A 1YN5A 4NZLB 2MCNB 4BBNF 4HKQA 2EKIA 2J42A 4GSWA 1TS3A 1ACCA 1DYQA 1PQSA 3ZNID 2CU1A 1L2NA 3RCZA 2A4ZA 5BMGA 4TV3A 2WWZA 4WWMA 2MJEA 2PE6B 2JRHA 3UINB 1HQRD 2KC2A 1YD8U 2LHEA 1TY0A 2QC8A 1WGDA 2MHJA 3AV8A 2LVQA 1QF6A 2JSVX 5IO9A 1DGJA 3R66C 3WAMA 2R2QA 3W9CB 2O2VA 1G6JA 3QX1A 2FAZA 2WDQB 2WXNA 3N9YC 1ET6A 4E71A 1F1HA 3P2BA 4OZCA 3RNGC 1EUVB 2FCMA 3V60A 3RI7C 4K81A 4WWPA 3AU5A 3H7PA 4PS7A 2DZKA 2H88B 3OJ3A 3CSFA 4ITKA 4NQLB 2KMMA 2K9XA 2C60A 1SSNA 1MVKA 4W9DA 3LJ3A 4LDTD 1T0YA 1JALA 2IPKD 2WXHA 4K3BA 2MP2B 2QHOA 3Q8EA 3ZNGC 3Q3MC 4HDQA 2KX3A 2O6VA 2BTEA 2MSED 4WJOA 3PTFC 2J0MA 5DPWA 1ET9A 3AI5A 2K6QA 2AWTA 2LVOA 5G55A 2K6DB 1SE4A 3Q3JA 1BUIC 1MHXA 2LRUA 4J6IA 1EM7A 4NAWA 4TMAB 3N1YC 2WNMA 3P63A 3U2SC 2MLBA 2JF5A 5C1ZA 4GLSC 2WXIA 4RM9A 3LXFA 4BFRA 2X38A 3PRZA 1TKYA 3ZJVA 1B1ZA 2AL6A 2PMVA 3Q14C 3Q8BA 4K7WA 1XCQL 3DWGC 3IT4B 3H1UA 3EFCA 5D94A 2ZEQA 1WJ6A 1OEYA 4RGMA 3A9KA 2HJ8A 1FNVA 4ZHOA 5J2RA 4DHJB 4RNAA 5E6JA 1SJHD 4W9KA 2SAKA 5L95C 4ARCA 1ZE3D 3DDCB 4WIPA 1C77A 1IGCA 1J7CA 3VAWA 3VUWA 1JWBD 1ZXHA 2KD0A 4MM3B 1LFDA 4PS8A 4P6VF 4W9FA 4HRSA 3ZXRA 4FA6A 2PPHA 5EDSA 4LTUA 1Y56A 1UBQA 1NI2A 1LM8B 3L16A 5D7GA 3U4EG 1I4PA 3HIZA 4YT0B 4XYCA 1VD2A 4MGKE 3RN9C 3T9LA 3TCAA 2LJ5A 2HD5B 1WRIA 2V9HA 3WAPA 2B3AA 3T3NA 4F8CB 2K0PA 2LD9A 5DPRA 1YN4A 4ZYNA 2O6VD 2N9LA 4LK0M 1V8CA 4YWGG 2CJOA 4IM0A 3QA8A 4NNJB 4PK1A 1WZ3A 4HVBA 3RNAC 3UQAA 1OQYA 1WMHB 4A9AA 1FNUA 1ZXIA 2LI5A 4HJKA 3DBHI 1R4MI 1WH3A 2WXGA 3L0WB 4WWNA 2LMCA 3EHVA 4GXBA 3P42A 1XF5L 3C19A 3PREA 4G50A 4MT5A 4XC2A 1TY2A 2CS4A 1NEKB 5AZFA 3SFEB 3NJTA 2FBWB 2DWQA 3AN1A 3MJ5A 3ZRCA 1MFWA 3B2GA 4DBGA 1XD3B 5IA7A 2JY6A 4US8A 2GBKA 1GC7A 4CQNA 3DPDA 3O65B 1RFAA 2AEHA 3IXSA 3TSSA 3W5UB 5L83A 1GPXA 1RM6C 4FHJA 2MBOA 1U4AA 1XCTL 5IKCM 1ZOYB 3DVGX 4RGOS 2AX5A 3Q6BA 1RYJA 3UI3A 2LVPA 4DQOC 3SD5A 2E6XA 4JQWC 3MP9A 4PYUA 1N63A 1D5XC 3A1QA 1K8RB 2KWCA 3N32A 3B9JA 4K7UA 4AUQC 2D2QA 3L08A 3N30A 3Q8FA 3SFDB 1T0RC 5LXHA 4HDOA 4IKGA 1GB1A 3DCGA 3A9KB 1N60A 3OJ4B 1QOAA 1VZ7A 3DBRI 5KHOA 3NVWA 2MBQA 3IG3A 4OZAA 1VLBA 4TQ0A 2DBYA 4NJCA 4O1NA 3ZUNA 5BMHA 1EU3A 4BOZB 1SJED 4DXAB 1ZDVA 5EE3A 2WU2B 4WJPA 3UF8A 1UWMA 4DWFA 3AEGB 2V4LA 2V4IB 4RGNA 4LJPB 2IGDA 4G11A 4WURA 1JW9D 4JWUC 3CSTA 2INDC 4REZA 4KIKB 4BAXA 3W1YA 4I6LB 1TS2A 3BVZA 4HEA1 1FXAA 2M56B 1NBFC 4YSXB 3W2DA 2PVOD 4GMVA 1SIJA 3H8HA 4J3OD 4D2KA 1WE7A 2MA9B 4C7YA 4ZRPA 2M19A 3H7PB 4DXFA 1I4QA 2O6VB 3JW0X 1V6EA 3KLSX 1EO6A 1TKEA 1YN3A 2JQRB 3KWLA 1QQRA 2ACZB 5C2TB 5IAAC 4PS3A 3BINA 3TJPA 2MX2A 1WSPA 2NCNA 2NBUA 3MHZA 1P7FA 1VDVA 1WYGA 3AH7A 4YTNB 4XWTA 5BYQA 1QILA 1QOFA 1LGRA 3CMMB 1FEHA 4JPSA 4LDTB 4L23A 5CHWA 2ZW0A 4ANWA 3ECIA 2C7NB 4L1BA 1PFDA 2AYOB 3RPFC 1E8WA 1SB3C 1XLOA 4AJYB 2D3BA 1TZ1A 2D11A 2DYMA 3BIID 1BMLC 2ZCCA 2LFIA 2FIDA 4HCNB 3ENEA 5J17A 2Z59B 3V05A 4BKTA 1V5TA 3PHXB 3CIRB 4GOCA 3RNCC 2KFKA 3AEDB 2XEWA 1K52A 2BYVE 2NR2A 1E7PB 2RR9A 2N1VA 4OVZA 4W9IA 3AEEB 1WR1A 2BVCA 4M01A 4QAYA 1J19A 3N20C 4GDKB 5T8IA 1E8ZA 3DBLB 1EU4A 4A55A 4KGRA 4US9A 1TBEA 1YX6B 3L10B 4N59A 2N7JA 1HZ6A 2WDRB 3PVLA 2W9NA 4USAA 4W9GA 3MJWA 4R3DA 4JWSC 3AE9B 3DWMA 3HRDD 4W9LA 4K1RB 4S0RA 1VZ6A 2YLMA 2GBJA 2BS3B 2MBEA 1SE2A 3RZFA 1M94A 2REXA 3RNEC 1KLVA 3SHQA 3EFUA 5JZEB 1ZGUB 3IBEA 2V1YA 2LGXA 2DZJA 3JYUA 5IP4D 1WXVA 2KTFA 4K3CA 4WQMA 3RZWC 3VRAB 2GLSA 2O2VB 3KVFB 4E3CA 1YJJA 4NAMA 3NG0A 2KC1A 4OHJA 1VJKA 3KH0A 1WJNA 2KAJA 3DHIC 3I57A 1I35A 2GBRA 3GS2A 2K1FA 5IN7A 2ICIA 1WXQA 3I9V1 4JL9A 5BMIA 4HLEA 3AE7B 2GMIC 1C4AA 1N61A 1WIAA 3VVWB 4NY0A 1WGGA 2N0SB 3P1MA 2KYWA 3DHGC 1E5WA 4MH8A 3ZRFA 2NVUI 2G1EA 4MSQB 2XNAC 2G9HD 1Q5WB 2GOWA 2L05A 1C79A 3O13A 2JXXA 3V61A 5HI1A 2IO0B 2FNJB 3ZW3A 4EE2A 2L52A 4BBNC 3SU8X 3HUIA 5LXIB 3UQBA 4HPMB 5EE1A 4MJSA 3ML9A 3B08A 2CHZA 3ONSA 3U8ZA 1L4ZB 3VTVA 4ANVA 2XK5B 3AE8B 2KWUB 2ZPYA 5TSSA 4KX6B 1XT9B 1E7VA 1N5XA 1HA5A 1IBXB 1HEZE 4ZDVA 1V1PB 2KQ7A 3GB1A 2BS4B 3PO0A 4BKGA 4GDLB 3VH3B 4OVVA 3B1LX 3R7QA 1VRAB 1OQRA 3U30A 3A33B 3BK2A 1HE8A 1WX8A 3UIOB 4A8XC 4FLHA 2PIAA 1I42A 1FFUA 1FXTB 3W1SC 2L76A 4AOFA 3EC8A 2B76B 2AQ3B 3PLUA 2BB5A 2K8HA 2V3NA 3ZGZA 3MHSD 4ICVA 3EGRA 4MDKE 3VR9B 4IWPA 4EOYA 5H92C 4G0NB 4I6NB 4IW0A 1P0RA 2LUEA 2KQSA 3QIJA 4FJYA 3DBSA 1WRDB 1XLPA 1AARA 5CHFA 3TUOA 3V6CB 5D3DA 3FC4A 2JZZA 1IP9A 4A20A 2NBWB 3PPAA 1TIFA 1MPEA 1PGXA 2J4XA 2KO3A 2VRRB 2I1KA 2KQ4X 2W55A 2V0GA 2K8BA 2VH2A 3APCA 1FPYA 2KKCA 4W9HA 1WXSA 3HHMA 1AYFA 4RFBA 4IDIA 2J7QB 3BYTB 2QJLA 1C76A 3Q69A 4LNKA 2BF8B 4EUTA 2KLGA 3TMPB 2Y5BB 1I4HA 2FCNA 3TEWA 4ZYSA 4EKUA 1OQQA 3FILA 4W9CA 2MH7A 5EE9A 1UELA 3TBLD 1NENB 3TEYA 2DNFA 4M0WB 5CTRC 1KOTA 1GAQB 4LNIA 2JRIB 5D6JB 1D5MC 1L0YB 4FJVB 1P9DU 3X0WA 1GB4A 2KN4A 4M0WA 2DYBA 2L1AA 4MM3A 4N9F4 2GI9A 4IOIE 2DLBA 4FHKA 2GBNA 5E6PA 2DAJA 2BWES 3RYTA 1CMXB 3WIMA 1KFYB 4NJ6A 4LNOA 2KZRA 1MI0A 2IJ0A 3RT3B 1WR6E 3I3TB 2OOBB 2UU7A 4NJ7A 2ONQA 3A1QB 3PSEB 2HE7A 3PLVA 3A4RA 4F7ZA 2FE8A 3ZYYX 1WXMA 2I1JA 1FNWA 2K8CA 2LWPA 4AJWA 3SEBA 1IBXA 4G3XB 2D3GA 2JXTA 2Q5WD 4GDKA 4YXDB 2QCZA 3AMZA 4IWOA 5HKHA 1YIWA 1WJ4A 2BB6A 2Y3AA 3BVGA 4PYZA 2WLBA 1XLQA 1MG4A 1XEEA 1TS4A 3WAOA 2RD0A 3KYCD 4LCDE 4YSYB 1ISNA 1TYGB 4XDCA 2D3CA 3I63C 3UGBB 5G5GA 2IO1B 2MBBB 2OJWA 1ESFA 1D5ZC 1TT5B 4PT5A 1F2RC 2KACA 3NS8A 2OHFA 1TJEA 2C7HA 1OEYJ 3TEXA 1UNSA 4TKNA 2M4NA 3MC8A 3R2TA 2HTHA 2MP2A 3KYDD 1YOVB 2RGFA 2R2OA 2WS3B 1E8XA 3M63B 4AQ7A 2L32A 4I6PA 4EFOA 4B0EA 4BKSD 1EF1A 2LRWA 3A4SC 2K39A 3N3KB 1JROA 3NOBA 2DYOA 1L6VA 3ZVVA 2XN9C 3ZTDA 4HKZE 1JCKB 1CJEA 5H8YE 4WJQA 2XK5A 2WXQA 4OVUA 2KTRB 2NMQA 1D4BA 1YQBA 4DHJD 1FFVA 4KVGB 1J7AA 2L0FA 2KVRA 4DHZB 1FXIA 5G5HA 1SXTA 2RDBC 5I4DA 4MSMB 4B6WA 3HK0A 2VZKD 4WJNA 1YNTE 2HJ1A 1QT9A 1C3TA 2M17A 5E6NA 2W54A 2KJHB 1C78A 2E3TA 1QZEA 3A9JA 3J9CA 2N9XA 2UWQA 5CHVC 1T6BX 1JWMD 3M62B 2WXOA 1K50A 2AQ1B 1PUTA 3RNFC 3H9DA 4ANXA 1J0GA 2ON8A 1D6EC 1V9JA 4C7ZA 2NPTA 2N1WA 3V6EB 2KMCA 2KFJA 1K51A 3T8MA 3RFZB 1I7HA 4GU2A 2BPSA 3NZSA 3KW5B 4P7IA 2Y5CA 3P4RB 3L4PA 1IPGA 3OLMD 3PRMB 3DBHB 3GZNB 2KLCA 3AEAB 2DX5B 4M8NA 1Y8RC 3RULA 2J53A 2LASA 3R7RA 1ZKHA 3L13A 2J0KA 4XZ4A 5IOIA 1V2YA 2L8JA 3M95A 3Q2AC 3PGEA 2M8SA 3NY5A 4HPLB 4IG7B 1FO4A 2NS5A 4JE3B 1GC6A 4IUMB 3HVZA 1S1QB 2QILA 1E6EB 1HTOA 2LJIA 1V1OA 3MC9A 5DPTA 1I4GA 1V86A 4NQKE 4GDLA 2M0AA 5AZHA 3SR6A 4URKA 1XXGA 1AN8A 1NYRA 2LXAA 1X1MA 4CHKA 4MELA 3P4SB 2JPHA 3P4PB 5MPOA 2WDTB 2X8XX 3NVZA 4M02A 1R4NI 1ROEA 5D3IB 2LZ6A 2KFKB 1GJZA 2Z8LA 3VQIA 1V80A 1FCLA 4MJSB 3AECB 2OEDA 4GIVA 1E7UA 1XQQA 5JXVA 3QQ8B 3VTUA 2GRIA 3QHTA 4IM3A 1ENFA 4KSLC 4KGSA 1YJIA 5JH5C 1IUEA 3AXCA 2YEPF 2QEJC 3BZDB 2R61A 3U7ZA 2IY0B 3RMKC 4A6QA 3ZIMA 3DBLI 3OAWA 1WWTA 3QWZB 3DVNV 4FJZA 1JQ4A 3NZ3A 4JIOU 2KT7A 4KDIC 4MEMA 1T3QA 2BS2B 1L0VB 3X23A 3GOEA 3DHHC 1E10A 3LDZE 1CK1A 1F52A 1YMHE 4RMAA 1A70A 2DZMA 4S17A 1S3SG 3BK1A 4N6EB 2MEKA 4B9KA 3KUCB 4F1SA 2PJHA 2W3RA 3LYYA 4FXCA 2WDVB 3WALA 1V1PA 1RLFA 1Q1OA 2FCSA 3ETRA 1VCBA 5G2NA 2CJNA 2JYEA 2QDFA 2JU6X 2K5PA 2A5UA 4FADA 2LGYA 3GZNI 3HM6X 2KWDA 3E9SA 1UH6A 3ZLZA 1XLNA 3PT2B 2YVCA 4C56C 3FAHA 1L6UA 1T0QC 2QMTA 3APDA 1L7YA 3DBRB 3T3OA 2KX0A 1K53A 1JWAD 3W5VB 1ZP0B 2KDBA 2RDHA 2MQJA 1J8CA 1TTNA 3DQVA 2Z0DB 2RPVA 2G45B 2YEPB 2ZCBA 2I38A 2BQQA 3R8BA 2DAFA 1PYWD 4FN2A 5C23A 1VR9A 4XE0A 5HG2A 1P98A 3OWEB 2INCC 2FCQA 1V81A 3C0RB 5HFYA 2BKRB 1KRHA 1SGHA 4ZHPA 2WXLA 4YL8A 2N9KA 3HVDA 1WMHA 4P1BC 2BYEA 3S2AA 1SE3A 5LLIA 3V3XA 2L83A 2IZVB 3WCQA 2JWZA 3AE3B 4MACA 3BYYB 1NYQA 3M3JA 1KLUD 2BBCA 1GG3A 2D07B 4WWOA 2WYQA 2K22A 2BWFA 3GE3C 4II3B 2JVCA 4ZOHC 3VH4B 2ZJDA 3MFGA 1N6ZA 3GE8C 2UYZB 2MBHA 1RRBA 2M0XA 2WHIA 5FKAC 1FCCC 1CQVA 2IGGA 4M8MA 1WM3A 1NDDA 2D3AA 2FUG1 2RPQA 4AP4C 4BVUC 1EWCA 3IHPC 1F2RI 4ANUA 2PVGC 3W1SA 3SDLC 4A90A 1FM0D 4JX1C 2K25A 3UIPB 2ZPNA 5AEKB 3H6NA 4A3OA 1N62A 4RCOA 1OTRB 2XBBC 1WE6A 3PHWB 2IYDB 4P16A 4X57B 3KQ4A 1KLGD 2LUMA 2RDGA 3NHEB 2KVZA 4K7SA 4DDID 2JX5A 2EMTA 1QKZA 3Q8CA 1L5PA 4C4VB 1KTKA 1UGMA 2NTTA 1UGJA 4HPPA 3AM9A 1WGYA 4JGHB 2WXJA 1YX5B 1E0ZA 3N1XC 2ZVNA 3Q8AA 4C4VA 2CR5A 2JYTA 2DENB 2AL3A 4H2AA 4NPNA 3PZDA 1E8YA 3B2FA 2AQ2B 1JRPA 2LEKA 1E90A 4EZLA 2K3UA 2PKOA 2FUHB 1C4CA 2C5LC 4FULA 3QARA 4KGTA 1KH0A
chains in the Genus database with same CATH topology
1EF1A 2LRWA 3ZNZB 3A4SC 2K39A 3N3KB 3NOBA 2DYOA 1RAXA 3ZVVA 1OGWA 3ZTDA 5IAAC 3QJZA 4PS3A 3ZO5B 5JHAA 3BINA 3TJPA 4WJQA 2MX2A 2CKHB 2XK5A 2DZIA 3VFKA 2NCNA 2NBUA 1SIFA 2WX1A 2IBIB 4OVUA 4E74A 2KTRB 2NBVB 1YQBA 4DHJD 4ICUA 4KVGB 3RD2A 3R3MA 3CMMB 3B0AA 1EF5A 2JT4B 4LDTB 2L0FA 1KM7A 2N7DA 2ZNVC 2KVRA 3V62A 3ZTCA 4DHZB 2C9WB 5CHWA 4DDGD 4ANWA 3ECIA 2C7NB 3DVNU 1H8CA 4MSMB 4HK2A 2AYOB 4B6WA 3HK0A 4WJNA 4HCPB 5CX3A 1E8WA 2M17A 2MCNB 4BBNF 1C3TA 5E6NA 4HXDA 4IC7B 4NAWB 5D2MB 4AJYB 2KJHB 1TZ1A 2D11A 2DYMA 2N7EA 2ZCCA 4GSWA 3ZNHB 1GUAB 1QZEA 3A9JA 2FIDA 4HCNB 3VHTC 3ENEA 1PQSA 2N9XA 3ZNID 2UWQA 5CHVC 5J17A 2CU1A 1L2NA 1Z2MA 2Z59B 3RCZA 1V5TA 2A4ZA 3M62B 4BKTA 3JVZX 3PHXB 3APFA 4TV3A 4GOCA 2KFKA 4MH0E 2XEWA 2BYVE 2WWZA 3H9DA 3UINB 2PE6B 2JRHA 2NR2A 2RR9A 4ANXA 2N1VA 1WFYA 3QCAA 1J0GA 3K9PB 4W9IA 2KC2A 1V9JA 2NPTA 1YD8U 2N1WA 4KIKA 3V6EB 1WR1A 2KMCA 2KFJA 1WGDA 3A9JB 2LVQA 3T8MA 2V3SA 3L54A 1J19A 2L3ZA 4GDKB 3R66C 3WAMA 4GU2A 2BPSA 2N4FA 3NZSA 2R2QA 1E8ZA 3KW5B 2O2VA 4P7IA 3IVFA 2KWVB 1G6JA 2IO2B 1IPGA 3OLMD 3QX1A 1TBEA 1YX6B 3L10B 2FAZA 3PRMB 2KLCA 2DX5B 4M8NA 3PVLA 2W9NA 4E71A 1Y8RC 3RULA 4W9GA 2LASA 3MJWA 3P2BA 3R7RA 2Z0EB 1ZKHA 1EUVB 4W9EA 3L13A 1KJTA 2J0KA 4XZ4A 1V2YA 2FCMA 4W9LA 3V60A 2L8JA 4K1RB 4K81A 4WWPA 3AU5A 2KOXA 3M95A 2YLMA 3H7PA 1C1YB 3PGEA 2GBJA 4PS7A 1WI0A 2DZKA 2M8SA 2MBEA 3OJ3A 3CSFA 3NY5A 4HPLB 4NQLB 3RZFA 1M94A 2KK8A 2REXA 4IG7B 1KLVA 3SHQA 2C60A 2NS5A 3EFUA 4GB9A 5JZEB 4W9DA 3VTWA 1ZGUB 3LJ3A 1GC6A 4IUMB 3IBEA 1P3QU 1S1QB 2IY1B 2V1YA 2KNBA 2DZJA 2LGXA 3JYUA 5DPTA 1GNUA 1T0YA 1WXVA 2KTFA 4LDTD 1V86A 4NQKE 3RZWC 3ZDTA 1TGZB 2O2VB 4GDLA 3KVFB 4E3CA 5AZHA 4FBJB 4URKA 2MP2B 2QHOA 2WX0A 3ZNGC 3VDZA 4HDQA 2KC1A 1X1MA 2KX3A 2LXAA 2O6VA 4CHKA 4MELA 3KH0A 2JPHA 1WJNA 2MSED 4WJOA 1I35A 3PTFC 3KUZA 2J0MA 2GBRA 5DPWA 2WDTB 4II2B 2K1FA 1UBIA 2KHWB 3AI5A 1R4NI 2ZVOA 2K6QA 4JL9A 2LZ6A 3QK0A 2KFKB 1GJZA 2AWTA 3VQIA 4HLEA 1V80A 2LVOA 5J18A 5G55A 2PE9A 4MJSB 4HWIB 1JRUA 1UD7A 2GMIC 1WZ0A 2K6DB 3Q3JA 3DVGY 4GIVA 1WIAA 1WGHA 3VVWB 4NY0A 1E7UA 1WXAA 1WGGA 1XQQA 2LRUA 2KJ6A 3QQ8B 3VTUA 4J6IA 3QHTA 4IM3A 1E5WA 1SE9A 3HM3A 4KSLC 4JLCA 4NAWA 3ZRFA 2NVUI 2RSUA 4MSQB 2MLBA 2JF5A 5JH5C 3BY4B 5C1ZA 3AXCA 2KANA 4RM9A 1Q5WB 2GOWA 4BFRA 4A3PA 2L05A 1WY8A 2EMSA 2IY0B 3L17A 3PRZA 5BO4B 2JXXA 2ASQA 5AZGA 3DOWA 2GBMA 1BT0A 1UZXB 3V61A 3ZIMA 3DBLI 3OAWA 1WF9A 2IO0B 2AL6A 2FNJB 3QWZB 3ZW3A 4K7WA 3DVNV 4FJZA 4BBNC 3H1UA 1A5RA 2L0TA 3SU8X 4MGYE 2FIFA 5LXIB 4HPMB 5D94A 3UQBA 2KXJA 2ZEQA 1WJ6A 2KMAA 1OEYA 4CO7A 3A9KA 2HJ8A 4JIOU 4KDIC 4KSKC 4MJSA 3ML9A 3B08A 2CHZA 3ONSA 3U8ZA 3VTVA 4ANVA 2XK5B 5J2RA 2KTRA 4DHJB 4MEMA 2KWUB 1YJ1A 2BYFA 1WGRA 2ZPYA 4W9KA 2BGFA 1XT9B 1WJUA 5L95C 1E7VA 2MWSB 3X23A 3DDCB 4ZDVA 3GOEA 3K9OB 2KQ7A 1D3ZA 2JUOA 3LDZE 3VAWA 3VUWA 4BKGA 2PEAA 4GDLB 2KD0A 3VH3B 4OVVA 4ZRJA 3PRPB 3B1LX 1LFDA 4PS8A 3R7QA 4CYEA 4RMAA 4W9FA 3A33B 4GGQA 2DZMA 3U30A 1S3SG 4B9KA 2KDEB 4FA6A 3KUCB 2PPHA 4DHZE 1LXDA 1HE8A 4F1SA 2PJHA 5EDSA 2ZNVB 1WX8A 3UIOB 4FLHA 4BKSA 5E6OA 2G4SA 3WALA 1UBQA 1NI2A 1LM8B 3WA0A 1I42A 1FXTB 3L16A 1RLFA 3W1SC 1Q1OA 5D7GA 2FCSA 2L76A 3CF6E 4AOFA 3EC8A 3PLUA 3HIZA 5FR6A 1VCBA 2K8HA 1VD2A 4MGKE 5G2NA 3T9LA 3TCAA 2LJ5A 4LJOB 2A5UA 1ZW7A 3MHSD 2HD5B 4ICVA 2LGYA 3GZNI 3HM6X 4IWPA 4MDKE 3WAPA 2B3AA 4MGZE 4EOYA 1UH6A 4KV2A 3H7SA 3PT2B 2YVCA 4G0NB 4I6NB 4IW0A 3ZLZA 1P0RA 1Q0WB 4F8CB 2LUEA 2KQSA 2IO3B 3QIJA 5TR5A 2LD9A 4FJYA 3DBSA 1WRDB 3APDA 5DPRA 1L7YA 1AARA 2KX0A 5CHFA 3VXWA 4ZYNA 3V6CB 2O6VD 2KN5A 2ZZPB 4ZRKA 4IM0A 2JZZA 1IP9A 3QA8A 4NNJB 1LQBA 2KDBA 2MQJA 4A20A 4BOSC 1WZ3A 2NBWB 4HVBA 1J8CA 3UQAA 1TTNA 3PPAA 3PS6A 1OQYA 1WMHB 2L7RA 3DQVA 3TL5A 2LI5A 2Z0DB 4HJKA 3DBHI 1R4MI 1WH3A 2G45B 3L0WB 4WWNA 3EHVA 2ZCBA 5JHBA 2KO3A 4GXBA 2VRRB 2I1KA 3AULA 2EKEC 3TIXA 3PREA 2K8BA 3Q3FA 1H4RA 2DAFA 4G50A 3APCA 4FN2A 4XC2A 5C23A 5DCNA 4EEWA 1WYWB 2KKCA 4W9HA 2CS4A 1WXSA 3HHMA 1P98A 4ZRIA 2J7QB 3ZKJC 2OJRA 2BF8B 5AZFA 4EUTA 2KLGA 1WX7A 3TMPB 2FCQA 2KDFB 3ZRCA 2Y5BB 4DBGA 1XD3B 5IA7A 1V81A 2FCNA 3C0RB 2N9EB 2JY6A 2BKRB 2GBKA 1SGHA 1GC7A 4EKUA 3DPDA 3O65B 1RFAA 2AEHA 4YL8A 5L83A 3EECA 1WMHA 4W9CA 3MTNB 2BYEA 4FHJA 2MBOA 1UELA 1P1AA 3S2AA 3TBLD 1U4AA 5LLIA 3DVGX 2IZVB 4M0WB 2JWZA 2CHWA 5KHQA 2KDIA 5CTRC 4TUUA 1KOTA 2LXCA 2JRIB 2LVPA 5D6JB 3M3JA 4FJVB 2MW5A 1GG3A 1P9DU 2D07B 4WWOA 3X0WA 2WYQA 4B95A 3SD5A 1V49A 4JQWC 2BWFA 3QC8B 4PYUA 2DYBA 3AU4A 4II3B 4MM3A 3A1QA 2JVCA 1K8RB 3VH4B 4N9F4 2KWCA 2ZJDA 3N32A 4FHKA 2GBNA 5E6PA 2DAJA 3ML8A 2BWES 3RYTA 4K7UA 4AUQC 2D2QA 1CMXB 3L08A 3N30A 2UYZB 3QAQA 3WIMA 4NJ6A 5LXHA 4HDOA 4RM8A 2M1MA 2MBHA 1RRBA 2M0XA 1F9JA 3A9KB 3DCGA 3ALBA 3OJ4B 4XX5A 1IYFA 3U7DA 1Z5SB 2KZRA 1V5OA 3DBRI 4M8MA 5KHOA 4KZCA 1WM3A 3RT3B 1NDDA 1WR6E 3I3TB 2MBQA 2OOBB 3IG3A 2RPQA 4NJ7A 4AP4C 3A1QB 3PV1A 4BVUC 3PSEB 4TQ0A 2HE7A 3IHPC 2G3QB 3VUYA 4ANUA 3NZUA 2NPTB 3W1SA 2L00B 3ZUNA 3PLVA 3SDLC 3A4RA 2D10A 4F7ZA 4AWJA 1WXMA 2I1JA 2K25A 4MGIE 4BOZB 3UIPB 2ZPNA 2K8CA 2LWPA 4AJWA 5AEKB 3H6NA 4A3OA 1OTRB 2XBBC 1WE6A 4G3XB 3PHWB 2IYDB 2D3GA 4GN1A 1WX9A 3JSVB 4DXAB 4GDKA 4X57B 4WJPA 2N9PC 4IWOA 4WAAA 3UF8A 5HKHA 1YIWA 1WJ4A 2MRPA 4DWFA 3NHEB 4PYZA 4TQ1A 2V4LA 4K7SA 2BKFA 4DDID 2DHZA 5GMVA 2EMTA 4ASWC 3VUXA 3RUIB 4EZJA 4LJPB 1MG8A 3WAOA 4G11A 2RD0A 3KYCD 4LCDE 1UGMA 3CSTA 1ISNA 3IFWB 4KIKB 3W1YA 4I6LB 3UGBB 2IO1B 2MBBB 1WGYA 4JGHB 1NBFC 2JZ3B 4WQOB 1YX5B 4FADA 3NS8A 2ZVNA 5DPSA 1WM2A 4EZKA 3D32A 3KUDB 2C7HA 2CR5A 3ZDMC 2KJRA 4DK5A 1OEYJ 4W9JA 2DENB 2CHXA 4TKNA 2G4DB 2M4NA 2AL3A 4GMVA 3JSVA 4NPNA 2HTHA 3PZDA 2MP2A 3KYDD 1E8YA 2RGFA 2J0JA 2R2OA 4IWQA 2LGDA 1WE7A 2MA9B 4KDLB 1E90A 1E8XA 3M63B 4EZLA 2FUHB 3H7PB 4I6PA 2C7MB 4IM2A 2C5LC 4EFOA 2O6VB 4FULA 3QARA 3WANA 3JW0X 4BKSD 1V6EA 4KZ0A 1EO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 A;  2LRW A;  3ZNZ B;  3A4S C;  2K39 A;  3N3K B;  3NOB A;  2DYO A;  1RAX A;  3ZVV A;  1OGW A;  3ZTD A;  5IAA C;  3QJZ A;  4PS3 A;  3ZO5 B;  5JHA A;  3BIN A;  3TJP A;  4WJQ A;  2MX2 A;  2CKH B;  2XK5 A;  2DZI A;  3VFK A;  2NCN A;  2NBU A;  1SIF A;  2WX1 A;  2IBI B;  4OVU A;  4E74 A;  2KTR B;  2NBV B;  1YQB A;  4DHJ D;  4ICU A;  4KVG B;  3RD2 A;  3R3M A;  3CMM B;  3B0A A;  1EF5 A;  2JT4 B;  4LDT B;  2L0F A;  1KM7 A;  2N7D A;  2ZNV C;  2KVR A;  3V62 A;  3ZTC A;  4DHZ B;  2C9W B;  5CHW A;  4DDG D;  4ANW A;  3ECI A;  2C7N B;  3DVN U;  1H8C A;  4MSM B;  4HK2 A;  2AYO B;  4B6W A;  3HK0 A;  4WJN A;  4HCP B;  5CX3 A;  1E8W A;  2M17 A;  2MCN B;  4BBN F;  1C3T A;  5E6N A;  4HXD A;  4IC7 B;  4NAW B;  5D2M B;  4AJY B;  2KJH B;  1TZ1 A;  2D11 A;  2DYM A;  2N7E A;  2ZCC A;  4GSW A;  3ZNH B;  1GUA B;  1QZE A;  3A9J A;  2FID A;  4HCN B;  3VHT C;  3ENE A;  1PQS A;  2N9X A;  3ZNI D;  2UWQ A;  5CHV C;  5J17 A;  2CU1 A;  1L2N A;  1Z2M A;  2Z59 B;  3RCZ A;  1V5T A;  2A4Z A;  3M62 B;  4BKT A;  3JVZ X;  3PHX B;  3APF A;  4TV3 A;  4GOC A;  2KFK A;  4MH0 E;  2XEW A;  2BYV E;  2WWZ A;  3H9D A;  3UIN B;  2PE6 B;  2JRH A;  2NR2 A;  2RR9 A;  4ANX A;  2N1V A;  1WFY A;  3QCA A;  1J0G A;  3K9P B;  4W9I A;  2KC2 A;  1V9J A;  2NPT A;  1YD8 U;  2N1W A;  4KIK A;  3V6E B;  1WR1 A;  2KMC A;  2KFJ A;  1WGD A;  3A9J B;  2LVQ A;  3T8M A;  2V3S A;  3L54 A;  1J19 A;  2L3Z A;  4GDK B;  3R66 C;  3WAM A;  4GU2 A;  2BPS A;  2N4F A;  3NZS A;  2R2Q A;  1E8Z A;  3KW5 B;  2O2V A;  4P7I A;  3IVF A;  2KWV B;  1G6J A;  2IO2 B;  1IPG A;  3OLM D;  3QX1 A;  1TBE A;  1YX6 B;  3L10 B;  2FAZ A;  3PRM B;  2KLC A;  2DX5 B;  4M8N A;  3PVL A;  2W9N A;  4E71 A;  1Y8R C;  3RUL A;  4W9G A;  2LAS A;  3MJW A;  3P2B A;  3R7R A;  2Z0E B;  1ZKH A;  1EUV B;  4W9E A;  3L13 A;  1KJT A;  2J0K A;  4XZ4 A;  1V2Y A;  2FCM A;  4W9L A;  3V60 A;  2L8J A;  4K1R B;  4K81 A;  4WWP A;  3AU5 A;  2KOX A;  3M95 A;  2YLM A;  3H7P A;  1C1Y B;  3PGE A;  2GBJ A;  4PS7 A;  1WI0 A;  2DZK A;  2M8S A;  2MBE A;  3OJ3 A;  3CSF A;  3NY5 A;  4HPL B;  4NQL B;  3RZF A;  1M94 A;  2KK8 A;  2REX A;  4IG7 B;  1KLV A;  3SHQ A;  2C60 A;  2NS5 A;  3EFU A;  4GB9 A;  5JZE B;  4W9D A;  3VTW A;  1ZGU B;  3LJ3 A;  1GC6 A;  4IUM B;  3IBE A;  1P3Q U;  1S1Q B;  2IY1 B;  2V1Y A;  2KNB A;  2DZJ A;  2LGX A;  3JYU A;  5DPT A;  1GNU A;  1T0Y A;  1WXV A;  2KTF A;  4LDT D;  1V86 A;  4NQK E;  3RZW C;  3ZDT A;  1TGZ B;  2O2V B;  4GDL A;  3KVF B;  4E3C A;  5AZH A;  4FBJ B;  4URK A;  2MP2 B;  2QHO A;  2WX0 A;  3ZNG C;  3VDZ A;  4HDQ A;  2KC1 A;  1X1M A;  2KX3 A;  2LXA A;  2O6V A;  4CHK A;  4MEL A;  3KH0 A;  2JPH A;  1WJN A;  2MSE D;  4WJO A;  1I35 A;  3PTF C;  3KUZ A;  2J0M A;  2GBR A;  5DPW A;  2WDT B;  4II2 B;  2K1F A;  1UBI A;  2KHW B;  3AI5 A;  1R4N I;  2ZVO A;  2K6Q A;  4JL9 A;  2LZ6 A;  3QK0 A;  2KFK B;  1GJZ A;  2AWT A;  3VQI A;  4HLE A;  1V80 A;  2LVO A;  5J18 A;  5G55 A;  2PE9 A;  4MJS B;  4HWI B;  1JRU A;  1UD7 A;  2GMI C;  1WZ0 A;  2K6D B;  3Q3J A;  3DVG Y;  4GIV A;  1WIA A;  1WGH A;  3VVW B;  4NY0 A;  1E7U A;  1WXA A;  1WGG A;  1XQQ A;  2LRU A;  2KJ6 A;  3QQ8 B;  3VTU A;  4J6I A;  3QHT A;  4IM3 A;  1E5W A;  1SE9 A;  3HM3 A;  4KSL C;  4JLC A;  4NAW A;  3ZRF A;  2NVU I;  2RSU A;  4MSQ B;  2MLB A;  2JF5 A;  5JH5 C;  3BY4 B;  5C1Z A;  3AXC A;  2KAN A;  4RM9 A;  1Q5W B;  2GOW A;  4BFR A;  4A3P A;  2L05 A;  1WY8 A;  2EMS A;  2IY0 B;  3L17 A;  3PRZ A;  5BO4 B;  2JXX A;  2ASQ A;  5AZG A;  3DOW A;  2GBM A;  1BT0 A;  1UZX B;  3V61 A;  3ZIM A;  3DBL I;  3OAW A;  1WF9 A;  2IO0 B;  2AL6 A;  2FNJ B;  3QWZ B;  3ZW3 A;  4K7W A;  3DVN V;  4FJZ A;  4BBN C;  3H1U A;  1A5R A;  2L0T A;  3SU8 X;  4MGY E;  2FIF A;  5LXI B;  4HPM B;  5D94 A;  3UQB A;  2KXJ A;  2ZEQ A;  1WJ6 A;  2KMA A;  1OEY A;  4CO7 A;  3A9K A;  2HJ8 A;  4JIO U;  4KDI C;  4KSK C;  4MJS A;  3ML9 A;  3B08 A;  2CHZ A;  3ONS A;  3U8Z A;  3VTV A;  4ANV A;  2XK5 B;  5J2R A;  2KTR A;  4DHJ B;  4MEM A;  2KWU B;  1YJ1 A;  2BYF A;  1WGR A;  2ZPY A;  4W9K A;  2BGF A;  1XT9 B;  1WJU A;  5L95 C;  1E7V A;  2MWS B;  3X23 A;  3DDC B;  4ZDV A;  3GOE A;  3K9O B;  2KQ7 A;  1D3Z A;  2JUO A;  3LDZ E;  3VAW A;  3VUW A;  4BKG A;  2PEA A;  4GDL B;  2KD0 A;  3VH3 B;  4OVV A;  4ZRJ A;  3PRP B;  3B1L X;  1LFD A;  4PS8 A;  3R7Q A;  4CYE A;  4RMA A;  4W9F A;  3A33 B;  4GGQ A;  2DZM A;  3U30 A;  1S3S G;  4B9K A;  2KDE B;  4FA6 A;  3KUC B;  2PPH A;  4DHZ E;  1LXD A;  1HE8 A;  4F1S A;  2PJH A;  5EDS A;  2ZNV B;  1WX8 A;  3UIO B;  4FLH A;  4BKS A;  5E6O A;  2G4S A;  3WAL A;  1UBQ A;  1NI2 A;  1LM8 B;  3WA0 A;  1I42 A;  1FXT B;  3L16 A;  1RLF A;  3W1S C;  1Q1O A;  5D7G A;  2FCS A;  2L76 A;  3CF6 E;  4AOF A;  3EC8 A;  3PLU A;  3HIZ A;  5FR6 A;  1VCB A;  2K8H A;  1VD2 A;  4MGK E;  5G2N A;  3T9L A;  3TCA A;  2LJ5 A;  4LJO B;  2A5U A;  1ZW7 A;  3MHS D;  2HD5 B;  4ICV A;  2LGY A;  3GZN I;  3HM6 X;  4IWP A;  4MDK E;  3WAP A;  2B3A A;  4MGZ E;  4EOY A;  1UH6 A;  4KV2 A;  3H7S A;  3PT2 B;  2YVC A;  4G0N B;  4I6N B;  4IW0 A;  3ZLZ A;  1P0R A;  1Q0W B;  4F8C B;  2LUE A;  2KQS A;  2IO3 B;  3QIJ A;  5TR5 A;  2LD9 A;  4FJY A;  3DBS A;  1WRD B;  3APD A;  5DPR A;  1L7Y A;  1AAR A;  2KX0 A;  5CHF A;  3VXW A;  4ZYN A;  3V6C B;  2O6V D;  2KN5 A;  2ZZP B;  4ZRK A;  4IM0 A;  2JZZ A;  1IP9 A;  3QA8 A;  4NNJ B;  1LQB A;  2KDB A;  2MQJ A;  4A20 A;  4BOS C;  1WZ3 A;  2NBW B;  4HVB A;  1J8C A;  3UQA A;  1TTN A;  3PPA A;  3PS6 A;  1OQY A;  1WMH B;  2L7R A;  3DQV A;  3TL5 A;  2LI5 A;  2Z0D B;  4HJK A;  3DBH I;  1R4M I;  1WH3 A;  2G45 B;  3L0W B;  4WWN A;  3EHV A;  2ZCB A;  5JHB A;  2KO3 A;  4GXB A;  2VRR B;  2I1K A;  3AUL A;  2EKE C;  3TIX A;  3PRE A;  2K8B A;  3Q3F A;  1H4R A;  2DAF A;  4G50 A;  3APC A;  4FN2 A;  4XC2 A;  5C23 A;  5DCN A;  4EEW A;  1WYW B;  2KKC A;  4W9H A;  2CS4 A;  1WXS A;  3HHM A;  1P98 A;  4ZRI A;  2J7Q B;  3ZKJ C;  2OJR A;  2BF8 B;  5AZF A;  4EUT A;  2KLG A;  1WX7 A;  3TMP B;  2FCQ A;  2KDF B;  3ZRC A;  2Y5B B;  4DBG A;  1XD3 B;  5IA7 A;  1V81 A;  2FCN A;  3C0R B;  2N9E B;  2JY6 A;  2BKR B;  2GBK A;  1SGH A;  1GC7 A;  4EKU A;  3DPD A;  3O65 B;  1RFA A;  2AEH A;  4YL8 A;  5L83 A;  3EEC A;  1WMH A;  4W9C A;  3MTN B;  2BYE A;  4FHJ A;  2MBO A;  1UEL A;  1P1A A;  3S2A A;  3TBL D;  1U4A A;  5LLI A;  3DVG X;  2IZV B;  4M0W B;  2JWZ A;  2CHW A;  5KHQ A;  2KDI A;  5CTR C;  4TUU A;  1KOT A;  2LXC A;  2JRI B;  2LVP A;  5D6J B;  3M3J A;  4FJV B;  2MW5 A;  1GG3 A;  1P9D U;  2D07 B;  4WWO A;  3X0W A;  2WYQ A;  4B95 A;  3SD5 A;  1V49 A;  4JQW C;  2BWF A;  3QC8 B;  4PYU A;  2DYB A;  3AU4 A;  4II3 B;  4MM3 A;  3A1Q A;  2JVC A;  1K8R B;  3VH4 B;  4N9F 4;  2KWC A;  2ZJD A;  3N32 A;  4FHK A;  2GBN A;  5E6P A;  2DAJ A;  3ML8 A;  2BWE S;  3RYT A;  4K7U A;  4AUQ C;  2D2Q A;  1CMX B;  3L08 A;  3N30 A;  2UYZ B;  3QAQ A;  3WIM A;  4NJ6 A;  5LXH A;  4HDO A;  4RM8 A;  2M1M A;  2MBH A;  1RRB A;  2M0X A;  1F9J A;  3A9K B;  3DCG A;  3ALB A;  3OJ4 B;  4XX5 A;  1IYF A;  3U7D A;  1Z5S B;  2KZR A;  1V5O A;  3DBR I;  4M8M A;  5KHO A;  4KZC A;  1WM3 A;  3RT3 B;  1NDD A;  1WR6 E;  3I3T B;  2MBQ A;  2OOB B;  3IG3 A;  2RPQ A;  4NJ7 A;  4AP4 C;  3A1Q B;  3PV1 A;  4BVU C;  3PSE B;  4TQ0 A;  2HE7 A;  3IHP C;  2G3Q B;  3VUY A;  4ANU A;  3NZU A;  2NPT B;  3W1S A;  2L00 B;  3ZUN A;  3PLV A;  3SDL C;  3A4R A;  2D10 A;  4F7Z A;  4AWJ A;  1WXM A;  2I1J A;  2K25 A;  4MGI E;  4BOZ B;  3UIP B;  2ZPN A;  2K8C A;  2LWP A;  4AJW A;  5AEK B;  3H6N A;  4A3O A;  1OTR B;  2XBB C;  1WE6 A;  4G3X B;  3PHW B;  2IYD B;  2D3G A;  4GN1 A;  1WX9 A;  3JSV B;  4DXA B;  4GDK A;  4X57 B;  4WJP A;  2N9P C;  4IWO A;  4WAA A;  3UF8 A;  5HKH A;  1YIW A;  1WJ4 A;  2MRP A;  4DWF A;  3NHE B;  4PYZ A;  4TQ1 A;  2V4L A;  4K7S A;  2BKF A;  4DDI D;  2DHZ A;  5GMV A;  2EMT A;  4ASW C;  3VUX A;  3RUI B;  4EZJ A;  4LJP B;  1MG8 A;  3WAO A;  4G11 A;  2RD0 A;  3KYC D;  4LCD E;  1UGM A;  3CST A;  1ISN A;  3IFW B;  4KIK B;  3W1Y A;  4I6L B;  3UGB B;  2IO1 B;  2MBB B;  1WGY A;  4JGH B;  1NBF C;  2JZ3 B;  4WQO B;  1YX5 B;  4FAD A;  3NS8 A;  2ZVN A;  5DPS A;  1WM2 A;  4EZK A;  3D32 A;  3KUD B;  2C7H A;  2CR5 A;  3ZDM C;  2KJR A;  4DK5 A;  1OEY J;  4W9J A;  2DEN B;  2CHX A;  4TKN A;  2G4D B;  2M4N A;  2AL3 A;  4GMV A;  3JSV A;  4NPN A;  2HTH A;  3PZD A;  2MP2 A;  3KYD D;  1E8Y A;  2RGF A;  2J0J A;  2R2O A;  4IWQ A;  2LGD A;  1WE7 A;  2MA9 B;  4KDL B;  1E90 A;  1E8X A;  3M63 B;  4EZL A;  2FUH B;  3H7P B;  4I6P A;  2C7M B;  4IM2 A;  2C5L C;  4EFO A;  2O6V B;  4FUL A;  3QAR A;  3WAN A;  3JW0 X;  4BKS D;  1V6E A;  4KZ0 A;  1EO6 A; 
#chains in the Genus database with same CATH topology
 4ZRQ A;  2INN E;  3ZNZ B;  1BXT A;  1ZDX A;  1R4M B;  1OGW A;  5JHA A;  2QSD A;  3QJZ A;  3ZO5 B;  2WXP A;  1N5W A;  4E74 A;  3FIL B;  4UDU C;  2NBV B;  5GXG B;  3RD2 A;  3IT6 B;  3PZ8 A;  2JT4 B;  2N7D A;  1NI3 A;  3ZTC A;  1EWY C;  2C9W B;  4DDG D;  3DVN U;  1H8C A;  4YTP B;  4WAF A;  4HCP B;  5CX3 A;  3I5J C;  4HRO A;  4HXD A;  4IC7 B;  4NAW B;  4OW0 A;  5D2M B;  2N7E A;  3ZNH B;  1GUA B;  3VHT C;  1Q10 A;  3ABV B;  1SEB D;  1Z2M A;  3JVZ X;  3APF A;  1JWS D;  4MH0 E;  2V3P A;  5EE0 A;  4RH6 A;  1NVI D;  1WFY A;  3QCA A;  4L2Y A;  3K9P B;  1L0X B;  4KIK A;  3EUB 2;  3NS1 A;  2SEB D;  3A9J B;  3NUH B;  1SBB B;  1GOZ A;  2V3S A;  1J7B A;  3L54 A;  2NTS A;  3AE1 B;  2L3Z A;  3AB5 A;  2N4F A;  3IAS 1;  2WGS A;  2ZW1 A;  3LB8 C;  3IVF A;  2KWV B;  2IO2 B;  1MJD A;  3CWI A;  1FD6 A;  3AE4 B;  2GB1 A;  5FK9 C;  1PGA A;  2LHD A;  5BYR A;  2Z0E B;  2D5G A;  4W9E A;  1KJT A;  1C4P A;  3ZJT A;  2KOX A;  2W3S A;  1C1Y B;  1WI0 A;  3URY A;  3AEF B;  2KK8 A;  2MJD A;  4GB9 A;  4RF0 A;  2TSS A;  3VTW A;  2BT6 A;  1P3Q U;  2WXM A;  2IY1 B;  2KNB A;  2LGS A;  1GNU A;  3ZDT A;  1TGZ B;  4FBJ B;  4C00 A;  2WX0 A;  3VDZ A;  1F0Z A;  1IGD A;  1UUP A;  3KUZ A;  4II2 B;  1UBI A;  2KHW B;  2ZVO A;  1C9F A;  2J52 A;  3QK0 A;  5J18 A;  2PE9 A;  3VR8 B;  4HWI B;  1JRU A;  1UD7 A;  1VZ8 A;  1WZ0 A;  4N58 A;  3GP7 A;  3DVG Y;  1WGH A;  1WXA A;  4M00 A;  2KJ6 A;  2EEL A;  1SE9 A;  3HM3 A;  4JLC A;  2RSU A;  2KDM A;  3BY4 B;  1AW7 A;  2KAN A;  2IGH A;  4A3P A;  1WY8 A;  2EMS A;  3L17 A;  5BO4 B;  1F77 A;  4KKJ A;  2ASQ A;  1STE A;  3DOW A;  5AZG A;  2GBM A;  1BT0 A;  1UZX B;  1WF9 A;  1CZP A;  1A5R A;  2LGI A;  2L0T A;  4MGY E;  2FIF A;  1QOB A;  2KXJ A;  2KMA A;  4CO7 A;  2BYT A;  4KSK C;  2KTR A;  1YJ1 A;  1V97 A;  5LNK 1;  2BYF A;  1WGR A;  2BGF A;  3EA6 A;  1KF6 B;  1WJU A;  2MWS B;  1FRR A;  4P1C C;  3K9O B;  1D3Z A;  2JUO A;  2PEA A;  1TKG A;  4ZRJ A;  3PRP B;  4LNF A;  4CYE A;  4GGQ A;  2KDE B;  2MJ3 A;  4DHZ E;  1LXD A;  3N1Z C;  5HHD G;  2ZNV B;  3Q3O C;  4BKS A;  5E6O A;  2G4S A;  3WA0 A;  3NVV A;  5C3J B;  1HTQ A;  3CF6 E;  1DOY A;  5FR6 A;  4C80 A;  1QOG A;  4LJO B;  1ZW7 A;  4TSS A;  4XWW A;  4MGZ E;  4KV2 A;  3H7S A;  1I4R A;  1Q0W B;  3U52 E;  3IAM 1;  5TR5 A;  2IO3 B;  5AUI A;  3VXW A;  2KN5 A;  2ZZP B;  4ZRK A;  3AE5 B;  1R4N B;  1ZPS A;  2WU5 B;  1LQB A;  4BOS C;  3PS6 A;  1RWS A;  4BZA A;  2L7R A;  3TL5 A;  2PTL A;  4ACF A;  2JZP A;  5JHB A;  3OG5 A;  2Y5P A;  3AUL A;  2EKE C;  3TIX A;  3Q3F A;  1H4R A;  3MC0 B;  1RFK A;  5DCN A;  4EEW A;  1WYW B;  1SF0 A;  4ZRI A;  4KKI A;  3ZKJ C;  2OJR A;  1WX7 A;  4ARI A;  2KDF B;  1T5X D;  2VH1 A;  1TZO A;  1ZUD 2;  2N9E B;  4LNN A;  3ZXV A;  2H89 B;  2WP9 B;  3EEC A;  3MTN B;  1WGK A;  1P1A A;  3C8Y A;  2CHW A;  5KHQ A;  2KDI A;  4TUU A;  2LXC A;  4Q2J A;  1PGB A;  2MW5 A;  1PDX A;  5BYS A;  3FKY A;  4B95 A;  1V49 A;  3AE6 B;  3QC8 B;  4WH4 A;  4HJG E;  3AU4 A;  2PW9 A;  2QIE B;  4YSZ B;  3P4Q B;  1P7E A;  3E56 A;  3ML8 A;  1UWX A;  3QAQ A;  1FIQ A;  4RM8 A;  4AS1 A;  2M1M A;  4XX5 A;  1F9J A;  2HDE A;  3Q3N C;  3ALB A;  1IYF A;  1DOX A;  3U7D A;  3PZ7 A;  1Z5S B;  1V5O A;  4KZC A;  5AUK A;  4DXG A;  2PLP A;  3PV1 A;  2INP E;  4LLG M;  2G3Q B;  3VUY A;  3NRZ A;  2NPT B;  3NZU A;  2L00 B;  3AEB B;  2D10 A;  4AWJ A;  1XO3 A;  4MGI E;  4XGA B;  5FR3 A;  4B0M A;  4GN1 A;  1WX9 A;  3JSV B;  3ZQ4 A;  1B9R A;  1TS5 A;  2N9P C;  4WAA A;  1OFF A;  1QLB B;  2MRP A;  4TQ1 A;  2WXF A;  2BKF A;  2DHZ A;  5GMV A;  2VZK B;  3RNB C;  1JML A;  4ASW C;  3VUX A;  3RUI B;  4EZJ A;  1LO5 D;  1MG8 A;  4YTM B;  2IDY A;  1M4V A;  3IFW B;  3NVY A;  4RF1 A;  1JWU D;  1AWD A;  2JZ3 B;  4WQO B;  1HZ5 A;  5DPS A;  1WM2 A;  4EZK A;  3D32 A;  3KUD B;  2CU3 A;  4RGT A;  3ZDM C;  2KJR A;  4DK5 A;  4W9J A;  2CHX A;  2HTM E;  2G4D B;  3JSV A;  1HXY D;  2J0J A;  4IWQ A;  3BWU D;  2WQY B;  2LGD A;  1T0S C;  4KDL B;  3VRB B;  4IM2 A;  4XDD A;  3KWV A;  2C7M B;  2RMM A;  3R2I A;  3WAN A;  2WXR A;  4KZ0 A;  2JWU A;  1FMA D;  2I2Y A;  1RAX A;  4OZB A;  1R7S A;  1E9M A;  2CKH B;  1I4X A;  1DOI A;  2DZI A;  3VFK A;  3TEZ A;  1YQ4 B;  1SIF A;  2WX1 A;  2IBI B;  2W82 A;  3BVM A;  4ICU A;  1MHH E;  1UF0 A;  2WXK A;  3R3M A;  3B0A A;  1EF5 A;  1KM7 A;  2ZNV C;  3V62 A;  1FRD A;  1YQ3 B;  3AE2 B;  1L4D B;  2BW2 A;  3ZJU A;  4HK2 A;  1YN5 A;  4NZL B;  2MCN B;  4BBN F;  4HKQ A;  2EKI A;  2J42 A;  4GSW A;  1TS3 A;  1ACC A;  1DYQ A;  1PQS A;  3ZNI D;  2CU1 A;  1L2N A;  3RCZ A;  2A4Z A;  5BMG A;  4TV3 A;  2WWZ A;  4WWM A;  2MJE A;  2PE6 B;  2JRH A;  3UIN B;  1HQR D;  2KC2 A;  1YD8 U;  2LHE A;  1TY0 A;  2QC8 A;  1WGD A;  2MHJ A;  3AV8 A;  2LVQ A;  1QF6 A;  2JSV X;  5IO9 A;  1DGJ A;  3R66 C;  3WAM A;  2R2Q A;  3W9C B;  2O2V A;  1G6J A;  3QX1 A;  2FAZ A;  2WDQ B;  2WXN A;  3N9Y C;  1ET6 A;  4E71 A;  1F1H A;  3P2B A;  4OZC A;  3RNG C;  1EUV B;  2FCM A;  3V60 A;  3RI7 C;  4K81 A;  4WWP A;  3AU5 A;  3H7P A;  4PS7 A;  2DZK A;  2H88 B;  3OJ3 A;  3CSF A;  4ITK A;  4NQL B;  2KMM A;  2K9X A;  2C60 A;  1SSN A;  1MVK A;  4W9D A;  3LJ3 A;  4LDT D;  1T0Y A;  1JAL A;  2IPK D;  2WXH A;  4K3B A;  2MP2 B;  2QHO A;  3Q8E A;  3ZNG C;  3Q3M C;  4HDQ A;  2KX3 A;  2O6V A;  2BTE A;  2MSE D;  4WJO A;  3PTF C;  2J0M A;  5DPW A;  1ET9 A;  3AI5 A;  2K6Q A;  2AWT A;  2LVO A;  5G55 A;  2K6D B;  1SE4 A;  3Q3J A;  1BUI C;  1MHX A;  2LRU A;  4J6I A;  1EM7 A;  4NAW A;  4TMA B;  3N1Y C;  2WNM A;  3P63 A;  3U2S C;  2MLB A;  2JF5 A;  5C1Z A;  4GLS C;  2WXI A;  4RM9 A;  3LXF A;  4BFR A;  2X38 A;  3PRZ A;  1TKY A;  3ZJV A;  1B1Z A;  2AL6 A;  2PMV A;  3Q14 C;  3Q8B A;  4K7W A;  1XCQ L;  3DWG C;  3IT4 B;  3H1U A;  3EFC A;  5D94 A;  2ZEQ A;  1WJ6 A;  1OEY A;  4RGM A;  3A9K A;  2HJ8 A;  1FNV A;  4ZHO A;  5J2R A;  4DHJ B;  4RNA A;  5E6J A;  1SJH D;  4W9K A;  2SAK A;  5L95 C;  4ARC A;  1ZE3 D;  3DDC B;  4WIP A;  1C77 A;  1IGC A;  1J7C A;  3VAW A;  3VUW A;  1JWB D;  1ZXH A;  2KD0 A;  4MM3 B;  1LFD A;  4PS8 A;  4P6V F;  4W9F A;  4HRS A;  3ZXR A;  4FA6 A;  2PPH A;  5EDS A;  4LTU A;  1Y56 A;  1UBQ A;  1NI2 A;  1LM8 B;  3L16 A;  5D7G A;  3U4E G;  1I4P A;  3HIZ A;  4YT0 B;  4XYC A;  1VD2 A;  4MGK E;  3RN9 C;  3T9L A;  3TCA A;  2LJ5 A;  2HD5 B;  1WRI A;  2V9H A;  3WAP A;  2B3A A;  3T3N A;  4F8C B;  2K0P A;  2LD9 A;  5DPR A;  1YN4 A;  4ZYN A;  2O6V D;  2N9L A;  4LK0 M;  1V8C A;  4YWG G;  2CJO A;  4IM0 A;  3QA8 A;  4NNJ B;  4PK1 A;  1WZ3 A;  4HVB A;  3RNA C;  3UQA A;  1OQY A;  1WMH B;  4A9A A;  1FNU A;  1ZXI A;  2LI5 A;  4HJK A;  3DBH I;  1R4M I;  1WH3 A;  2WXG A;  3L0W B;  4WWN A;  2LMC A;  3EHV A;  4GXB A;  3P42 A;  1XF5 L;  3C19 A;  3PRE A;  4G50 A;  4MT5 A;  4XC2 A;  1TY2 A;  2CS4 A;  1NEK B;  5AZF A;  3SFE B;  3NJT A;  2FBW B;  2DWQ A;  3AN1 A;  3MJ5 A;  3ZRC A;  1MFW A;  3B2G A;  4DBG A;  1XD3 B;  5IA7 A;  2JY6 A;  4US8 A;  2GBK A;  1GC7 A;  4CQN A;  3DPD A;  3O65 B;  1RFA A;  2AEH A;  3IXS A;  3TSS A;  3W5U B;  5L83 A;  1GPX A;  1RM6 C;  4FHJ A;  2MBO A;  1U4A A;  1XCT L;  5IKC M;  1ZOY B;  3DVG X;  4RGO S;  2AX5 A;  3Q6B A;  1RYJ A;  3UI3 A;  2LVP A;  4DQO C;  3SD5 A;  2E6X A;  4JQW C;  3MP9 A;  4PYU A;  1N63 A;  1D5X C;  3A1Q A;  1K8R B;  2KWC A;  3N32 A;  3B9J A;  4K7U A;  4AUQ C;  2D2Q A;  3L08 A;  3N30 A;  3Q8F A;  3SFD B;  1T0R C;  5LXH A;  4HDO A;  4IKG A;  1GB1 A;  3DCG A;  3A9K B;  1N60 A;  3OJ4 B;  1QOA A;  1VZ7 A;  3DBR I;  5KHO A;  3NVW A;  2MBQ A;  3IG3 A;  4OZA A;  1VLB A;  4TQ0 A;  2DBY A;  4NJC A;  4O1N A;  3ZUN A;  5BMH A;  1EU3 A;  4BOZ B;  1SJE D;  4DXA B;  1ZDV A;  5EE3 A;  2WU2 B;  4WJP A;  3UF8 A;  1UWM A;  4DWF A;  3AEG B;  2V4L A;  2V4I B;  4RGN A;  4LJP B;  2IGD A;  4G11 A;  4WUR A;  1JW9 D;  4JWU C;  3CST A;  2IND C;  4REZ A;  4KIK B;  4BAX A;  3W1Y A;  4I6L B;  1TS2 A;  3BVZ A;  4HEA 1;  1FXA A;  2M56 B;  1NBF C;  4YSX B;  3W2D A;  2PVO D;  4GMV A;  1SIJ A;  3H8H A;  4J3O D;  4D2K A;  1WE7 A;  2MA9 B;  4C7Y A;  4ZRP A;  2M19 A;  3H7P B;  4DXF A;  1I4Q A;  2O6V B;  3JW0 X;  1V6E A;  3KLS X;  1EO6 A;  1TKE A;  1YN3 A;  2JQR B;  3KWL A;  1QQR A;  2ACZ B;  5C2T B;  5IAA C;  4PS3 A;  3BIN A;  3TJP A;  2MX2 A;  1WSP A;  2NCN A;  2NBU A;  3MHZ A;  1P7F A;  1VDV A;  1WYG A;  3AH7 A;  4YTN B;  4XWT A;  5BYQ A;  1QIL A;  1QOF A;  1LGR A;  3CMM B;  1FEH A;  4JPS A;  4LDT B;  4L23 A;  5CHW A;  2ZW0 A;  4ANW A;  3ECI A;  2C7N B;  4L1B A;  1PFD A;  2AYO B;  3RPF C;  1E8W A;  1SB3 C;  1XLO A;  4AJY B;  2D3B A;  1TZ1 A;  2D11 A;  2DYM A;  3BII D;  1BML C;  2ZCC A;  2LFI A;  2FID A;  4HCN B;  3ENE A;  5J17 A;  2Z59 B;  3V05 A;  4BKT A;  1V5T A;  3PHX B;  3CIR B;  4GOC A;  3RNC C;  2KFK A;  3AED B;  2XEW A;  1K52 A;  2BYV E;  2NR2 A;  1E7P B;  2RR9 A;  2N1V A;  4OVZ A;  4W9I A;  3AEE B;  1WR1 A;  2BVC A;  4M01 A;  4QAY A;  1J19 A;  3N20 C;  4GDK B;  5T8I A;  1E8Z A;  3DBL B;  1EU4 A;  4A55 A;  4KGR A;  4US9 A;  1TBE A;  1YX6 B;  3L10 B;  4N59 A;  2N7J A;  1HZ6 A;  2WDR B;  3PVL A;  2W9N A;  4USA A;  4W9G A;  3MJW A;  4R3D A;  4JWS C;  3AE9 B;  3DWM A;  3HRD D;  4W9L A;  4K1R B;  4S0R A;  1VZ6 A;  2YLM A;  2GBJ A;  2BS3 B;  2MBE A;  1SE2 A;  3RZF A;  1M94 A;  2REX A;  3RNE C;  1KLV A;  3SHQ A;  3EFU A;  5JZE B;  1ZGU B;  3IBE A;  2V1Y A;  2LGX A;  2DZJ A;  3JYU A;  5IP4 D;  1WXV A;  2KTF A;  4K3C A;  4WQM A;  3RZW C;  3VRA B;  2GLS A;  2O2V B;  3KVF B;  4E3C A;  1YJJ A;  4NAM A;  3NG0 A;  2KC1 A;  4OHJ A;  1VJK A;  3KH0 A;  1WJN A;  2KAJ A;  3DHI C;  3I57 A;  1I35 A;  2GBR A;  3GS2 A;  2K1F A;  5IN7 A;  2ICI A;  1WXQ A;  3I9V 1;  4JL9 A;  5BMI A;  4HLE A;  3AE7 B;  2GMI C;  1C4A A;  1N61 A;  1WIA A;  3VVW B;  4NY0 A;  1WGG A;  2N0S B;  3P1M A;  2KYW A;  3DHG C;  1E5W A;  4MH8 A;  3ZRF A;  2NVU I;  2G1E A;  4MSQ B;  2XNA C;  2G9H D;  1Q5W B;  2GOW A;  2L05 A;  1C79 A;  3O13 A;  2JXX A;  3V61 A;  5HI1 A;  2IO0 B;  2FNJ B;  3ZW3 A;  4EE2 A;  2L52 A;  4BBN C;  3SU8 X;  3HUI A;  5LXI B;  3UQB A;  4HPM B;  5EE1 A;  4MJS A;  3ML9 A;  3B08 A;  2CHZ A;  3ONS A;  3U8Z A;  1L4Z B;  3VTV A;  4ANV A;  2XK5 B;  3AE8 B;  2KWU B;  2ZPY A;  5TSS A;  4KX6 B;  1XT9 B;  1E7V A;  1N5X A;  1HA5 A;  1IBX B;  1HEZ E;  4ZDV A;  1V1P B;  2KQ7 A;  3GB1 A;  2BS4 B;  3PO0 A;  4BKG A;  4GDL B;  3VH3 B;  4OVV A;  3B1L X;  3R7Q A;  1VRA B;  1OQR A;  3U30 A;  3A33 B;  3BK2 A;  1HE8 A;  1WX8 A;  3UIO B;  4A8X C;  4FLH A;  2PIA A;  1I42 A;  1FFU A;  1FXT B;  3W1S C;  2L76 A;  4AOF A;  3EC8 A;  2B76 B;  2AQ3 B;  3PLU A;  2BB5 A;  2K8H A;  2V3N A;  3ZGZ A;  3MHS D;  4ICV A;  3EGR A;  4MDK E;  3VR9 B;  4IWP A;  4EOY A;  5H92 C;  4G0N B;  4I6N B;  4IW0 A;  1P0R A;  2LUE A;  2KQS A;  3QIJ A;  4FJY A;  3DBS A;  1WRD B;  1XLP A;  1AAR A;  5CHF A;  3TUO A;  3V6C B;  5D3D A;  3FC4 A;  2JZZ A;  1IP9 A;  4A20 A;  2NBW B;  3PPA A;  1TIF A;  1MPE A;  1PGX A;  2J4X A;  2KO3 A;  2VRR B;  2I1K A;  2KQ4 X;  2W55 A;  2V0G A;  2K8B A;  2VH2 A;  3APC A;  1FPY A;  2KKC A;  4W9H A;  1WXS A;  3HHM A;  1AYF A;  4RFB A;  4IDI A;  2J7Q B;  3BYT B;  2QJL A;  1C76 A;  3Q69 A;  4LNK A;  2BF8 B;  4EUT A;  2KLG A;  3TMP B;  2Y5B B;  1I4H A;  2FCN A;  3TEW A;  4ZYS A;  4EKU A;  1OQQ A;  3FIL A;  4W9C A;  2MH7 A;  5EE9 A;  1UEL A;  3TBL D;  1NEN B;  3TEY A;  2DNF A;  4M0W B;  5CTR C;  1KOT A;  1GAQ B;  4LNI A;  2JRI B;  5D6J B;  1D5M C;  1L0Y B;  4FJV B;  1P9D U;  3X0W A;  1GB4 A;  2KN4 A;  4M0W A;  2DYB A;  2L1A A;  4MM3 A;  4N9F 4;  2GI9 A;  4IOI E;  2DLB A;  4FHK A;  2GBN A;  5E6P A;  2DAJ A;  2BWE S;  3RYT A;  1CMX B;  3WIM A;  1KFY B;  4NJ6 A;  4LNO A;  2KZR A;  1MI0 A;  2IJ0 A;  3RT3 B;  1WR6 E;  3I3T B;  2OOB B;  2UU7 A;  4NJ7 A;  2ONQ A;  3A1Q B;  3PSE B;  2HE7 A;  3PLV A;  3A4R A;  4F7Z A;  2FE8 A;  3ZYY X;  1WXM A;  2I1J A;  1FNW A;  2K8C A;  2LWP A;  4AJW A;  3SEB A;  1IBX A;  4G3X B;  2D3G A;  2JXT A;  2Q5W D;  4GDK A;  4YXD B;  2QCZ A;  3AMZ A;  4IWO A;  5HKH A;  1YIW A;  1WJ4 A;  2BB6 A;  2Y3A A;  3BVG A;  4PYZ A;  2WLB A;  1XLQ A;  1MG4 A;  1XEE A;  1TS4 A;  3WAO A;  2RD0 A;  3KYC D;  4LCD E;  4YSY B;  1ISN A;  1TYG B;  4XDC A;  2D3C A;  3I63 C;  3UGB B;  5G5G A;  2IO1 B;  2MBB B;  2OJW A;  1ESF A;  1D5Z C;  1TT5 B;  4PT5 A;  1F2R C;  2KAC A;  3NS8 A;  2OHF A;  1TJE A;  2C7H A;  1OEY J;  3TEX A;  1UNS A;  4TKN A;  2M4N A;  3MC8 A;  3R2T A;  2HTH A;  2MP2 A;  3KYD D;  1YOV B;  2RGF A;  2R2O A;  2WS3 B;  1E8X A;  3M63 B;  4AQ7 A;  2L32 A;  4I6P A;  4EFO A;  4B0E A;  4BKS D;  1EF1 A;  2LRW A;  3A4S C;  2K39 A;  3N3K B;  1JRO A;  3NOB A;  2DYO A;  1L6V A;  3ZVV A;  2XN9 C;  3ZTD A;  4HKZ E;  1JCK B;  1CJE A;  5H8Y E;  4WJQ A;  2XK5 A;  2WXQ A;  4OVU A;  2KTR B;  2NMQ A;  1D4B A;  1YQB A;  4DHJ D;  1FFV A;  4KVG B;  1J7A A;  2L0F A;  2KVR A;  4DHZ B;  1FXI A;  5G5H A;  1SXT A;  2RDB C;  5I4D A;  4MSM B;  4B6W A;  3HK0 A;  2VZK D;  4WJN A;  1YNT E;  2HJ1 A;  1QT9 A;  1C3T A;  2M17 A;  5E6N A;  2W54 A;  2KJH B;  1C78 A;  2E3T A;  1QZE A;  3A9J A;  3J9C A;  2N9X A;  2UWQ A;  5CHV C;  1T6B X;  1JWM D;  3M62 B;  2WXO A;  1K50 A;  2AQ1 B;  1PUT A;  3RNF C;  3H9D A;  4ANX A;  1J0G A;  2ON8 A;  1D6E C;  1V9J A;  4C7Z A;  2NPT A;  2N1W A;  3V6E B;  2KMC A;  2KFJ A;  1K51 A;  3T8M A;  3RFZ B;  1I7H A;  4GU2 A;  2BPS A;  3NZS A;  3KW5 B;  4P7I A;  2Y5C A;  3P4R B;  3L4P A;  1IPG A;  3OLM D;  3PRM B;  3DBH B;  3GZN B;  2KLC A;  3AEA B;  2DX5 B;  4M8N A;  1Y8R C;  3RUL A;  2J53 A;  2LAS A;  3R7R A;  1ZKH A;  3L13 A;  2J0K A;  4XZ4 A;  5IOI A;  1V2Y A;  2L8J A;  3M95 A;  3Q2A C;  3PGE A;  2M8S A;  3NY5 A;  4HPL B;  4IG7 B;  1FO4 A;  2NS5 A;  4JE3 B;  1GC6 A;  4IUM B;  3HVZ A;  1S1Q B;  2QIL A;  1E6E B;  1HTO A;  2LJI A;  1V1O A;  3MC9 A;  5DPT A;  1I4G A;  1V86 A;  4NQK E;  4GDL A;  2M0A A;  5AZH A;  3SR6 A;  4URK A;  1XXG A;  1AN8 A;  1NYR A;  2LXA A;  1X1M A;  4CHK A;  4MEL A;  3P4S B;  2JPH A;  3P4P B;  5MPO A;  2WDT B;  2X8X X;  3NVZ A;  4M02 A;  1R4N I;  1ROE A;  5D3I B;  2LZ6 A;  2KFK B;  1GJZ A;  2Z8L A;  3VQI A;  1V80 A;  1FCL A;  4MJS B;  3AEC B;  2OED A;  4GIV A;  1E7U A;  1XQQ A;  5JXV A;  3QQ8 B;  3VTU A;  2GRI A;  3QHT A;  4IM3 A;  1ENF A;  4KSL C;  4KGS A;  1YJI A;  5JH5 C;  1IUE A;  3AXC A;  2YEP F;  2QEJ C;  3BZD B;  2R61 A;  3U7Z A;  2IY0 B;  3RMK C;  4A6Q A;  3ZIM A;  3DBL I;  3OAW A;  1WWT A;  3QWZ B;  3DVN V;  4FJZ A;  1JQ4 A;  3NZ3 A;  4JIO U;  2KT7 A;  4KDI C;  4MEM A;  1T3Q A;  2BS2 B;  1L0V B;  3X23 A;  3GOE A;  3DHH C;  1E10 A;  3LDZ E;  1CK1 A;  1F52 A;  1YMH E;  4RMA A;  1A70 A;  2DZM A;  4S17 A;  1S3S G;  3BK1 A;  4N6E B;  2MEK A;  4B9K A;  3KUC B;  4F1S A;  2PJH A;  2W3R A;  3LYY A;  4FXC A;  2WDV B;  3WAL A;  1V1P A;  1RLF A;  1Q1O A;  2FCS A;  3ETR A;  1VCB A;  5G2N A;  2CJN A;  2JYE A;  2QDF A;  2JU6 X;  2K5P A;  2A5U A;  4FAD A;  2LGY A;  3GZN I;  3HM6 X;  2KWD A;  3E9S A;  1UH6 A;  3ZLZ A;  1XLN A;  3PT2 B;  2YVC A;  4C56 C;  3FAH A;  1L6U A;  1T0Q C;  2QMT A;  3APD A;  1L7Y A;  3DBR B;  3T3O A;  2KX0 A;  1K53 A;  1JWA D;  3W5V B;  1ZP0 B;  2KDB A;  2RDH A;  2MQJ A;  1J8C A;  1TTN A;  3DQV A;  2Z0D B;  2RPV A;  2G45 B;  2YEP B;  2ZCB A;  2I38 A;  2BQQ A;  3R8B A;  2DAF A;  1PYW D;  4FN2 A;  5C23 A;  1VR9 A;  4XE0 A;  5HG2 A;  1P98 A;  3OWE B;  2INC C;  2FCQ A;  1V81 A;  3C0R B;  5HFY A;  2BKR B;  1KRH A;  1SGH A;  4ZHP A;  2WXL A;  4YL8 A;  2N9K A;  3HVD A;  1WMH A;  4P1B C;  2BYE A;  3S2A A;  1SE3 A;  5LLI A;  3V3X A;  2L83 A;  2IZV B;  3WCQ A;  2JWZ A;  3AE3 B;  4MAC A;  3BYY B;  1NYQ A;  3M3J A;  1KLU D;  2BBC A;  1GG3 A;  2D07 B;  4WWO A;  2WYQ A;  2K22 A;  2BWF A;  3GE3 C;  4II3 B;  2JVC A;  4ZOH C;  3VH4 B;  2ZJD A;  3MFG A;  1N6Z A;  3GE8 C;  2UYZ B;  2MBH A;  1RRB A;  2M0X A;  2WHI A;  5FKA C;  1FCC C;  1CQV A;  2IGG A;  4M8M A;  1WM3 A;  1NDD A;  2D3A A;  2FUG 1;  2RPQ A;  4AP4 C;  4BVU C;  1EWC A;  3IHP C;  1F2R I;  4ANU A;  2PVG C;  3W1S A;  3SDL C;  4A90 A;  1FM0 D;  4JX1 C;  2K25 A;  3UIP B;  2ZPN A;  5AEK B;  3H6N A;  4A3O A;  1N62 A;  4RCO A;  1OTR B;  2XBB C;  1WE6 A;  3PHW B;  2IYD B;  4P16 A;  4X57 B;  3KQ4 A;  1KLG D;  2LUM A;  2RDG A;  3NHE B;  2KVZ A;  4K7S A;  4DDI D;  2JX5 A;  2EMT A;  1QKZ A;  3Q8C A;  1L5P A;  4C4V B;  1KTK A;  1UGM A;  2NTT A;  1UGJ A;  4HPP A;  3AM9 A;  1WGY A;  4JGH B;  2WXJ A;  1YX5 B;  1E0Z A;  3N1X C;  2ZVN A;  3Q8A A;  4C4V A;  2CR5 A;  2JYT A;  2DEN B;  2AL3 A;  4H2A A;  4NPN A;  3PZD A;  1E8Y A;  3B2F A;  2AQ2 B;  1JRP A;  2LEK A;  1E90 A;  4EZL A;  2K3U A;  2PKO A;  2FUH B;  1C4C A;  2C5L C;  4FUL A;  3QAR A;  4KGT A;  1KH0 A; 
#chains in the Genus database with same CATH homology
 1EF1 A;  2LRW A;  3ZNZ B;  3A4S C;  2K39 A;  3N3K B;  3NOB A;  2DYO A;  1RAX A;  3ZVV A;  1OGW A;  3ZTD A;  5IAA C;  3QJZ A;  4PS3 A;  3ZO5 B;  5JHA A;  3BIN A;  3TJP A;  4WJQ A;  2MX2 A;  2CKH B;  2XK5 A;  2DZI A;  3VFK A;  2NCN A;  2NBU A;  1SIF A;  2WX1 A;  2IBI B;  4OVU A;  4E74 A;  2KTR B;  2NBV B;  1YQB A;  4DHJ D;  4ICU A;  4KVG B;  3RD2 A;  3R3M A;  3CMM B;  3B0A A;  1EF5 A;  2JT4 B;  4LDT B;  2L0F A;  1KM7 A;  2N7D A;  2ZNV C;  2KVR A;  3V62 A;  3ZTC A;  4DHZ B;  2C9W B;  5CHW A;  4DDG D;  4ANW A;  3ECI A;  2C7N B;  3DVN U;  1H8C A;  4MSM B;  4HK2 A;  2AYO B;  4B6W A;  3HK0 A;  4WJN A;  4HCP B;  5CX3 A;  1E8W A;  2M17 A;  2MCN B;  4BBN F;  1C3T A;  5E6N A;  4HXD A;  4IC7 B;  4NAW B;  5D2M B;  4AJY B;  2KJH B;  1TZ1 A;  2D11 A;  2DYM A;  2N7E A;  2ZCC A;  4GSW A;  3ZNH B;  1GUA B;  1QZE A;  3A9J A;  2FID A;  4HCN B;  3VHT C;  3ENE A;  1PQS A;  2N9X A;  3ZNI D;  2UWQ A;  5CHV C;  5J17 A;  2CU1 A;  1L2N A;  1Z2M A;  2Z59 B;  3RCZ A;  1V5T A;  2A4Z A;  3M62 B;  4BKT A;  3JVZ X;  3PHX B;  3APF A;  4TV3 A;  4GOC A;  2KFK A;  4MH0 E;  2XEW A;  2BYV E;  2WWZ A;  3H9D A;  3UIN B;  2PE6 B;  2JRH A;  2NR2 A;  2RR9 A;  4ANX A;  2N1V A;  1WFY A;  3QCA A;  1J0G A;  3K9P B;  4W9I A;  2KC2 A;  1V9J A;  2NPT A;  1YD8 U;  2N1W A;  4KIK A;  3V6E B;  1WR1 A;  2KMC A;  2KFJ A;  1WGD A;  3A9J B;  2LVQ A;  3T8M A;  2V3S A;  3L54 A;  1J19 A;  2L3Z A;  4GDK B;  3R66 C;  3WAM A;  4GU2 A;  2BPS A;  2N4F A;  3NZS A;  2R2Q A;  1E8Z A;  3KW5 B;  2O2V A;  4P7I A;  3IVF A;  2KWV B;  1G6J A;  2IO2 B;  1IPG A;  3OLM D;  3QX1 A;  1TBE A;  1YX6 B;  3L10 B;  2FAZ A;  3PRM B;  2KLC A;  2DX5 B;  4M8N A;  3PVL A;  2W9N A;  4E71 A;  1Y8R C;  3RUL A;  4W9G A;  2LAS A;  3MJW A;  3P2B A;  3R7R A;  2Z0E B;  1ZKH A;  1EUV B;  4W9E A;  3L13 A;  1KJT A;  2J0K A;  4XZ4 A;  1V2Y A;  2FCM A;  4W9L A;  3V60 A;  2L8J A;  4K1R B;  4K81 A;  4WWP A;  3AU5 A;  2KOX A;  3M95 A;  2YLM A;  3H7P A;  1C1Y B;  3PGE A;  2GBJ A;  4PS7 A;  1WI0 A;  2DZK A;  2M8S A;  2MBE A;  3OJ3 A;  3CSF A;  3NY5 A;  4HPL B;  4NQL B;  3RZF A;  1M94 A;  2KK8 A;  2REX A;  4IG7 B;  1KLV A;  3SHQ A;  2C60 A;  2NS5 A;  3EFU A;  4GB9 A;  5JZE B;  4W9D A;  3VTW A;  1ZGU B;  3LJ3 A;  1GC6 A;  4IUM B;  3IBE A;  1P3Q U;  1S1Q B;  2IY1 B;  2V1Y A;  2KNB A;  2DZJ A;  2LGX A;  3JYU A;  5DPT A;  1GNU A;  1T0Y A;  1WXV A;  2KTF A;  4LDT D;  1V86 A;  4NQK E;  3RZW C;  3ZDT A;  1TGZ B;  2O2V B;  4GDL A;  3KVF B;  4E3C A;  5AZH A;  4FBJ B;  4URK A;  2MP2 B;  2QHO A;  2WX0 A;  3ZNG C;  3VDZ A;  4HDQ A;  2KC1 A;  1X1M A;  2KX3 A;  2LXA A;  2O6V A;  4CHK A;  4MEL A;  3KH0 A;  2JPH A;  1WJN A;  2MSE D;  4WJO A;  1I35 A;  3PTF C;  3KUZ A;  2J0M A;  2GBR A;  5DPW A;  2WDT B;  4II2 B;  2K1F A;  1UBI A;  2KHW B;  3AI5 A;  1R4N I;  2ZVO A;  2K6Q A;  4JL9 A;  2LZ6 A;  3QK0 A;  2KFK B;  1GJZ A;  2AWT A;  3VQI A;  4HLE A;  1V80 A;  2LVO A;  5J18 A;  5G55 A;  2PE9 A;  4MJS B;  4HWI B;  1JRU A;  1UD7 A;  2GMI C;  1WZ0 A;  2K6D B;  3Q3J A;  3DVG Y;  4GIV A;  1WIA A;  1WGH A;  3VVW B;  4NY0 A;  1E7U A;  1WXA A;  1WGG A;  1XQQ A;  2LRU A;  2KJ6 A;  3QQ8 B;  3VTU A;  4J6I A;  3QHT A;  4IM3 A;  1E5W A;  1SE9 A;  3HM3 A;  4KSL C;  4JLC A;  4NAW A;  3ZRF A;  2NVU I;  2RSU A;  4MSQ B;  2MLB A;  2JF5 A;  5JH5 C;  3BY4 B;  5C1Z A;  3AXC A;  2KAN A;  4RM9 A;  1Q5W B;  2GOW A;  4BFR A;  4A3P A;  2L05 A;  1WY8 A;  2EMS A;  2IY0 B;  3L17 A;  3PRZ A;  5BO4 B;  2JXX A;  2ASQ A;  5AZG A;  3DOW A;  2GBM A;  1BT0 A;  1UZX B;  3V61 A;  3ZIM A;  3DBL I;  3OAW A;  1WF9 A;  2IO0 B;  2AL6 A;  2FNJ B;  3QWZ B;  3ZW3 A;  4K7W A;  3DVN V;  4FJZ A;  4BBN C;  3H1U A;  1A5R A;  2L0T A;  3SU8 X;  4MGY E;  2FIF A;  5LXI B;  4HPM B;  5D94 A;  3UQB A;  2KXJ A;  2ZEQ A;  1WJ6 A;  2KMA A;  1OEY A;  4CO7 A;  3A9K A;  2HJ8 A;  4JIO U;  4KDI C;  4KSK C;  4MJS A;  3ML9 A;  3B08 A;  2CHZ A;  3ONS A;  3U8Z A;  3VTV A;  4ANV A;  2XK5 B;  5J2R A;  2KTR A;  4DHJ B;  4MEM A;  2KWU B;  1YJ1 A;  2BYF A;  1WGR A;  2ZPY A;  4W9K A;  2BGF A;  1XT9 B;  1WJU A;  5L95 C;  1E7V A;  2MWS B;  3X23 A;  3DDC B;  4ZDV A;  3GOE A;  3K9O B;  2KQ7 A;  1D3Z A;  2JUO A;  3LDZ E;  3VAW A;  3VUW A;  4BKG A;  2PEA A;  4GDL B;  2KD0 A;  3VH3 B;  4OVV A;  4ZRJ A;  3PRP B;  3B1L X;  1LFD A;  4PS8 A;  3R7Q A;  4CYE A;  4RMA A;  4W9F A;  3A33 B;  4GGQ A;  2DZM A;  3U30 A;  1S3S G;  4B9K A;  2KDE B;  4FA6 A;  3KUC B;  2PPH A;  4DHZ E;  1LXD A;  1HE8 A;  4F1S A;  2PJH A;  5EDS A;  2ZNV B;  1WX8 A;  3UIO B;  4FLH A;  4BKS A;  5E6O A;  2G4S A;  3WAL A;  1UBQ A;  1NI2 A;  1LM8 B;  3WA0 A;  1I42 A;  1FXT B;  3L16 A;  1RLF A;  3W1S C;  1Q1O A;  5D7G A;  2FCS A;  2L76 A;  3CF6 E;  4AOF A;  3EC8 A;  3PLU A;  3HIZ A;  5FR6 A;  1VCB A;  2K8H A;  1VD2 A;  4MGK E;  5G2N A;  3T9L A;  3TCA A;  2LJ5 A;  4LJO B;  2A5U A;  1ZW7 A;  3MHS D;  2HD5 B;  4ICV A;  2LGY A;  3GZN I;  3HM6 X;  4IWP A;  4MDK E;  3WAP A;  2B3A A;  4MGZ E;  4EOY A;  1UH6 A;  4KV2 A;  3H7S A;  3PT2 B;  2YVC A;  4G0N B;  4I6N B;  4IW0 A;  3ZLZ A;  1P0R A;  1Q0W B;  4F8C B;  2LUE A;  2KQS A;  2IO3 B;  3QIJ A;  5TR5 A;  2LD9 A;  4FJY A;  3DBS A;  1WRD B;  3APD A;  5DPR A;  1L7Y A;  1AAR A;  2KX0 A;  5CHF A;  3VXW A;  4ZYN A;  3V6C B;  2O6V D;  2KN5 A;  2ZZP B;  4ZRK A;  4IM0 A;  2JZZ A;  1IP9 A;  3QA8 A;  4NNJ B;  1LQB A;  2KDB A;  2MQJ A;  4A20 A;  4BOS C;  1WZ3 A;  2NBW B;  4HVB A;  1J8C A;  3UQA A;  1TTN A;  3PPA A;  3PS6 A;  1OQY A;  1WMH B;  2L7R A;  3DQV A;  3TL5 A;  2LI5 A;  2Z0D B;  4HJK A;  3DBH I;  1R4M I;  1WH3 A;  2G45 B;  3L0W B;  4WWN A;  3EHV A;  2ZCB A;  5JHB A;  2KO3 A;  4GXB A;  2VRR B;  2I1K A;  3AUL A;  2EKE C;  3TIX A;  3PRE A;  2K8B A;  3Q3F A;  1H4R A;  2DAF A;  4G50 A;  3APC A;  4FN2 A;  4XC2 A;  5C23 A;  5DCN A;  4EEW A;  1WYW B;  2KKC A;  4W9H A;  2CS4 A;  1WXS A;  3HHM A;  1P98 A;  4ZRI A;  2J7Q B;  3ZKJ C;  2OJR A;  2BF8 B;  5AZF A;  4EUT A;  2KLG A;  1WX7 A;  3TMP B;  2FCQ A;  2KDF B;  3ZRC A;  2Y5B B;  4DBG A;  1XD3 B;  5IA7 A;  1V81 A;  2FCN A;  3C0R B;  2N9E B;  2JY6 A;  2BKR B;  2GBK A;  1SGH A;  1GC7 A;  4EKU A;  3DPD A;  3O65 B;  1RFA A;  2AEH A;  4YL8 A;  5L83 A;  3EEC A;  1WMH A;  4W9C A;  3MTN B;  2BYE A;  4FHJ A;  2MBO A;  1UEL A;  1P1A A;  3S2A A;  3TBL D;  1U4A A;  5LLI A;  3DVG X;  2IZV B;  4M0W B;  2JWZ A;  2CHW A;  5KHQ A;  2KDI A;  5CTR C;  4TUU A;  1KOT A;  2LXC A;  2JRI B;  2LVP A;  5D6J B;  3M3J A;  4FJV B;  2MW5 A;  1GG3 A;  1P9D U;  2D07 B;  4WWO A;  3X0W A;  2WYQ A;  4B95 A;  3SD5 A;  1V49 A;  4JQW C;  2BWF A;  3QC8 B;  4PYU A;  2DYB A;  3AU4 A;  4II3 B;  4MM3 A;  3A1Q A;  2JVC A;  1K8R B;  3VH4 B;  4N9F 4;  2KWC A;  2ZJD A;  3N32 A;  4FHK A;  2GBN A;  5E6P A;  2DAJ A;  3ML8 A;  2BWE S;  3RYT A;  4K7U A;  4AUQ C;  2D2Q A;  1CMX B;  3L08 A;  3N30 A;  2UYZ B;  3QAQ A;  3WIM A;  4NJ6 A;  5LXH A;  4HDO A;  4RM8 A;  2M1M A;  2MBH A;  1RRB A;  2M0X A;  1F9J A;  3A9K B;  3DCG A;  3ALB A;  3OJ4 B;  4XX5 A;  1IYF A;  3U7D A;  1Z5S B;  2KZR A;  1V5O A;  3DBR I;  4M8M A;  5KHO A;  4KZC A;  1WM3 A;  3RT3 B;  1NDD A;  1WR6 E;  3I3T B;  2MBQ A;  2OOB B;  3IG3 A;  2RPQ A;  4NJ7 A;  4AP4 C;  3A1Q B;  3PV1 A;  4BVU C;  3PSE B;  4TQ0 A;  2HE7 A;  3IHP C;  2G3Q B;  3VUY A;  4ANU A;  3NZU A;  2NPT B;  3W1S A;  2L00 B;  3ZUN A;  3PLV A;  3SDL C;  3A4R A;  2D10 A;  4F7Z A;  4AWJ A;  1WXM A;  2I1J A;  2K25 A;  4MGI E;  4BOZ B;  3UIP B;  2ZPN A;  2K8C A;  2LWP A;  4AJW A;  5AEK B;  3H6N A;  4A3O A;  1OTR B;  2XBB C;  1WE6 A;  4G3X B;  3PHW B;  2IYD B;  2D3G A;  4GN1 A;  1WX9 A;  3JSV B;  4DXA B;  4GDK A;  4X57 B;  4WJP A;  2N9P C;  4IWO A;  4WAA A;  3UF8 A;  5HKH A;  1YIW A;  1WJ4 A;  2MRP A;  4DWF A;  3NHE B;  4PYZ A;  4TQ1 A;  2V4L A;  4K7S A;  2BKF A;  4DDI D;  2DHZ A;  5GMV A;  2EMT A;  4ASW C;  3VUX A;  3RUI B;  4EZJ A;  4LJP B;  1MG8 A;  3WAO A;  4G11 A;  2RD0 A;  3KYC D;  4LCD E;  1UGM A;  3CST A;  1ISN A;  3IFW B;  4KIK B;  3W1Y A;  4I6L B;  3UGB B;  2IO1 B;  2MBB B;  1WGY A;  4JGH B;  1NBF C;  2JZ3 B;  4WQO B;  1YX5 B;  4FAD A;  3NS8 A;  2ZVN A;  5DPS A;  1WM2 A;  4EZK A;  3D32 A;  3KUD B;  2C7H A;  2CR5 A;  3ZDM C;  2KJR A;  4DK5 A;  1OEY J;  4W9J A;  2DEN B;  2CHX A;  4TKN A;  2G4D B;  2M4N A;  2AL3 A;  4GMV A;  3JSV A;  4NPN A;  2HTH A;  3PZD A;  2MP2 A;  3KYD D;  1E8Y A;  2RGF A;  2J0J A;  2R2O A;  4IWQ A;  2LGD A;  1WE7 A;  2MA9 B;  4KDL B;  1E90 A;  1E8X A;  3M63 B;  4EZL A;  2FUH B;  3H7P B;  4I6P A;  2C7M B;  4IM2 A;  2C5L C;  4EFO A;  2O6V B;  4FUL A;  3QAR A;  3WAN A;  3JW0 X;  4BKS D;  1V6E A;  4KZ0 A;  1EO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...