1V6EA

Solution structure of a n-terminal ubiquitin-like domain in mouse tubulin-specific chaperone b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cytoskeleton-associated protein 1
publication title Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B
rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 10
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v6eA01
2MP2B 1E8XA 3H6NA 2D3GA 2KTRA 2KDBA 2LXAA 2ZZPB 3UINB 1F9JA 5CX3A 4WJQA 4ANXA 4GIVA 1GUAB 3H9DA 5G55A 1SGHA 4II2B 4KDIC 5EDSA 1V6EA 2IY0B 2ZNVB 5DPSA 3VTWA 3KUZA 1P9DU 4M0WB 4I6LB 2C60A 4BKSA 1A5RA 1NI2A 2MBQA 5DPTA 2Z0EB 3MJWA 3K9OB 5J18A 2MSED 1YX6B 3U30A 4NY0A 5CTRC 2LZ6A 2N9PC 1LFDA 3DVNV 4II3B 2MX2A 2MBEA 4GN1A 4ANVA 2L0TA 5HKHA 2IO1B 2KWCA 2LRWA 4K81A 4AP4C 2ZJDA 3PS6A 3PHWB 3VVWB 2V4LA 3R7QA 3KH0A 1L7YA 5C23A 1D3ZA 1WMHA 2DX5B 2D10A 2N1WA 4F1SA 4LDTB 3HM6X 3P2BA 5LLIA 3QK0A 2XEWA 3IVFA 1WGYA 1IP9A 1WM2A 4GB9A 2GBRA 3ZVVA 3UIPB 1WR6E 1PQSA 5KHQA 2BYEA 1C3TA 2PJHA 3EC8A 1GG3A 2FCQA 2JVCA 3A9JA 3V61A 2KANA 3VXWA 2L00B 4B6WA 3L0WB 1KOTA 3RYTA 5JZEB 3KUCB 3OLMD 2LXCA 4FADA 3QWZB 2CHZA 4GDLB 3W1SC 4G11A 3WA0A 1UBIA 2VRRB 2PEAA 1R4MI 5C1ZA 3H7PB 3DDCB 3RUIB 2IY1B 3Q3JA 1SIFA 4NJ7A 3ZTCA 1YD8U 3Q3FA 4A3OA 3LDZE 5AEKB 3ML8A 4E74A 2D2QA 3AU4A 2WWZA 3APDA 4WWNA 1WRDB 3JYUA 3BINA 2D07B 5L95C 2B3AA 3JW0X 4DDID 2NPTA 2KOXA 2L76A 3PRZA 4FHKA 3JVZX 2JY6A 2HE7A 2KQSA 2KC2A 5CHFA 3MTNB 1YJ1A 4WAAA 1CMXB 3V6CB 2K8BA 3SU8X 1WE6A 3CSFA 3N30A 3OJ4B 1MG8A 4ANWA 4E3CA 3DVGX 2GBNA 3DBLI 3ZDMC 3DOWA 3OJ3A 4KSKC 4FULA 2O2VA 1C1YB 5AZGA 2M1MA 2L0FA 4DWFA 3H7SA 4PS8A 1G6JA 1ISNA 3KW5B 2I1JA 3ZNGC 4A3PA 4GXBA 1X1MA 2RGFA 4HLEA 1EF1A 4GGQA 4MJSB 3RZFA 3N32A 4K7WA 5JHBA 3VTUA 4G50A 2DZIA 2ZCCA 4ICVA 3RZWC 4NQLB 2LUEA 3U7DA 2KDIA 1WF9A 3UIOB 3L10B 3AULA 5CHVC 2R2QA 3VQIA 1OQYA 1TBEA 5AZHA 4DHZE 4EUTA 1ZGUB 2IO0B 5CHWA 2KX0A 1WFYA 4AJWA 4EEWA 3EFUA 4IC7B 3HM3A 3TCAA 1BT0A 4RMAA 2D11A 2EMTA 3ZDTA 4EZLA 1V5OA 1OTRB 3LJ3A 2BGFA 4KZCA 2K1FA 3HIZA 4IG7B 1ZW7A 3I3TB 2DZJA 1OEYJ 3WIMA 4F8CB 3TIXA 4MSQB 2ZEQA 1FXTB 2RSUA 4BKSD 2NBVB 2DZKA 3APFA 2FCNA 4WQOB 2KNBA 1WI0A 3K9PB 5E6NA 1WXMA 1QZEA 2MBOA 3GZNI 4J6IA 2KDFB 1VCBA 3SD5A 4JIOU 2JRIB 1RFAA 2N7EA 1OEYA 4WWOA 3JSVA 2IYDB 3KYDD 1RRBA 2LGYA 2NPTB 2Y5BB 4TV3A 2R2OA 2BWES 4N9F4 3A9KA 3BY4B 3PRMB 2NBWB 3X23A 2KJHB 3CSTA 2G3QB 1UD7A 3QX1A 2O6VA 2IO2B 2NVUI 3R66C 4ZDVA 3VUXA 2KLGA 4PS7A 5E6PA 1WJNA 1J8CA 2L05A 2KJ6A 2CHWA 2J0JA 4W9KA 3A33B 2XBBC 3S2AA 4JQWC 4FN2A 4ZRKA 4HDQA 2O2VB 4WJPA 5DPRA 4AJYB 4DBGA 2DYOA 3M95A 2KFKA 1LQBA 3NOBA 3NS8A 2C7MB 3DVNU 4JLCA 3WAPA 2KHWB 2KK8A 1WYWB 4DHJB 1OGWA 4BBNF 4GU2A 4W9DA 2J7QB 2FAZA 2I1KA 2A4ZA 3DBRI 5D2MB 3V6EB 3ZNHB 4ASWC 3A4SC 3EECA 3VDZA 3N3KB 2KXJA 2DYBA 4W9EA 3VH3B 1WGGA 1U4AA 1WX9A 4IWQA 4GOCA 4MEMA 5FR6A 4TQ0A 1GC7A 3ZO5B 4LJPB 3UQAA 4ZRIA 4FA6A 3M3JA 1E8YA 1WJUA 3VH4B 3ZIMA 1GJZA 4FLHA 4EFOA 1GC6A 1EUVB 2LRUA 1WZ3A 3H1UA 4ANUA 2AL3A 4BBNC 1E7VA 5D94A 2GBMA 4PS3A 5IA7A 1WGHA 2KLCA 1TGZB 3X0WA 2ZVOA 3B1LX 2XK5A 5IAAC 1LM8B 2N1VA 3KUDB 2PPHA 2MW5A 4W9HA 4GDKA 4MGKE 4PYUA 4KIKB 1WGDA 4M8MA 2JWZA 4W9IA 4RM9A 3APCA 4X57B 4AUQC 1V86A 3L17A 3IG3A 3W1YA 3L08A 2ASQA 4HPLB 1Y8RC 4MELA 2C7HA 4IM2A 3ZW3A 3B0AA 3R3MA 2KTRB 3R7RA 4DHJD 4HWIB 3ALBA 3HK0A 2A5UA 2AEHA 3V62A 3ZRFA 3A4RA 1V2YA 3JSVB 3ONSA 2KX3A 4KVGB 3TBLD 3DBSA 2LJ5A 2ZPYA 3L13A 3ZNID 3PREA 1V81A 5J17A 3A9KB 4TQ1A 4W9CA 3UF8A 4BFRA 2MRPA 1SE9A 4MM3A 4BKTA 2O6VB 1TTNA 3ZRCA 2LGXA 3L16A 2DHZA 2LVPA 4EZJA 1I42A 2RPQA 5J2RA 2JRHA 1XQQA 4FJVB 1S3SG 2LVQA 2M0XA 1P3QU 3PLVA 2WYQA 4I6NB 4LJOB 5KHOA 3RD2A 4FBJB 1WMHB 2KFKB 4KV2A 5E6OA 3ZKJC 4XZ4A 2MA9B 5DCNA 4K7UA 2MCNB 5BO4B 5LXHA 4IM0A 1V9JA 2WDTB 1WJ6A 3ENEA 4KDLB 2OJRA 4GSWA 3AXCA 4AOFA 2IBIB 2JZ3B 2KWUB 3A9JB 3QARA 4HJKA 3ZTDA 3AI5A 1M94A 4IUMB 4W9FA 2KMCA 2LVOA 4K1RB 2AL6A 1Z5SB 2JUOA 1S1QB 2J0KA 2N4FA 3PT2B 2WX0A 1P98A 4RM8A 1IYFA 3ZNZB 2NR2A 2K25A 2LASA 1RLFA 2BWFA 3AU5A 2BF8B 4GDLA 2O6VD 3VFKA 2XK5B 1J19A 4MGZE 4PYZA 2GOWA 2CKHB 3H7PA 2KJRA 4GDKB 2M17A 4WJOA 1WXSA 1YX5B 3ECIA 4M8NA 4WWPA 3VUWA 2NS5A 3NZUA 4CO7A 1LXDA 2KD0A 3QCAA 3SHQA 3CMMB 3PV1A 3C0RB 2W9NA 2BYVE 4HCNB 4EOYA 2GMIC 2LGDA 4URKA 2RR9A 3KYCD 2BYFA 4XC2A 4E71A 2BPSA 2GBJA 4TKNA 1EO6A 3HHMA 4IWOA 1RAXA 4HPMB 2M4NA 1JRUA 2AYOB 3MHSD 2KTFA 2DYMA 2OOBB 4K7SA 2DAFA 3NHEB 4DXAB 3UQBA 2K6QA 4W9GA 2IO3B 4HDOA 2KMAA 4BKGA 3RCZA 2ZNVC 4NQKE 2LI5A 5GMVA 2K6DB 3WANA 2KWVB 2FCMA 2K39A 3PHXB 4CYEA 5JHAA 1KLVA 3DQVA 2JPHA 1YQBA 2ZVNA 4FJYA 4A20A 4F7ZA 4DHZB 1Q5WB 2DENB 3A1QA 3T9LA 3TL5A 2MQJA 3UGBB 3TMPB 3PVLA 4DDGD 2HTHA 1WGRA 2L8JA 3ML9A 4MJSA 2KFJA 2FIFA 2KKCA 3IHPC 4FJZA 2CR5A 1UELA 1XD3B 3DBHI 3O65B 2K8HA 2FCSA 1GNUA 1I35A 2JT4B 2KQ7A 2UYZB 4MSMB 3OAWA 1V80A 2BKFA 2MBBB 1WX7A 2LWPA 3PPAA 3VHTC 3M62B 2KDEB 2NBUA 2KZRA 4P7IA 2C5LC 2NCNA 4NPNA 4WJNA 4EKUA 4CHKA 1NDDA 4MGYE 1WH3A 5DPWA 4NAWA 4ZYNA 1KJTA 2ZCBA 5JH5C 3PSEB 1UZXB 2BKRB 3QC8B 4JL9A 1H4RA 1Q0WB 1WE7A 4MH0E 2DZMA 3EHVA 2CS4A 3PZDA 3SDLC 3KVFB 1P0RA 2L7RA 3CF6E 4IW0A 4G3XB 4NNJB 4TUUA 1YIWA 4W9LA 3QJZA 1UBQA 4EZKA 3GOEA 1E7UA 3M63B 1VD2A 1Z2MA 4JGHB 4W9JA 1WXAA 3RULA 3L54A 4HCPB 1UH6A 3VUYA 2MP2A 1E8ZA 2PE9A 1H8CA 4I6PA 2V1YA 3DPDA 1Q1OA 4BOSC 3NZSA 5LXIB 3TJPA 2K8CA 4LCDE 3QHTA 4XX5A 2EKEC 2G4SA 3QA8A 3VAWA 5D7GA 3D32A 1HE8A 1V49A 4YL8A 4HK2A 1KM7A 4NJ6A 2Z0DB 4IM3A 4AWJA 2FUHB 2MWSB 2FIDA 2DAJA 1E90A 1WXVA 2KO3A 4LDTD 1WJ4A 2C9WB 5AZFA 1J0GA 1WX8A 2J0MA 3DCGA 3VTVA 1WY8A 2N7DA 3PGEA 3ZUNA 2KN5A 4BVUC 2L3ZA 1WR1A 2JXXA 4IWPA 2YVCA 2YLMA 2CHXA 2ZPNA 1P1AA 1WM3A 4HXDA 5L83A 4BOZB 2HJ8A 1WZ0A 4OVVA 3B08A 3WALA 2G45B 2PE6B 2M8SA 5D6JB 3V60A 2IZVB 1UGMA 1NBFC 2HD5B 3A1QB 2AWTA 4GMVA 1EF5A 2EMSA 4DK5A 1AARA 1IPGA 1XT9B 2FNJB 2LD9A 3ZLZA 2N9XA 3T8MA 1R4NI 4KSLC 4HVBA 2UWQA 4B9KA 2KC1A 3U8ZA 3IFWB 3PLUA 2WX1A 1T0YA 3WAMA 3W1SA 1ZKHA 1WIAA 4ICUA 2G4DB 1V5TA 3IBEA 2KVRA 2RD0A 2Z59B 3PRPB 4ZRJA 5G2NA 2V3SA 4NAWB 4B95A 3NY5A 1L2NA 2CU1A 3QQ8B 1K8RB 1E8WA 2GBKA 4G0NB 2C7NB 4MDKE 5TR5A 3QIJA 3DVGY 4OVUA 3RT3B 1E5WA 4KIKA 2MBHA 3QAQA 4KZ0A 4FHJA 1TZ1A 2QHOA 2MLBA 3PTFC 2JZZA 3WAOA 2JF5A 2N9EB 2REXA 4MGIE
chains in the Genus database with same CATH superfamily
2MP2B 3TEXA 2OHFA 2D3GA 2LXAA 4LNIA 4WJQA 1SGHA 1V6EA 1P9DU 2BTEA 4YXDB 2C60A 1A5RA 1YX6B 2Y5PA 4NY0A 1FD6A 3DVNV 4LNNA 2IO1B 2LRWA 4AP4C 2ZJDA 3PS6A 2H88B 3KH0A 1L7YA 4M01A 5C23A 3Q8AA 2N1WA 1GOZA 2JX5A 4NZLB 1N63A 2WXFA 3IVFA 1WGYA 2GBRA 3ZVVA 3UIPB 1WR6E 2RMMA 1FCCC 4B0MA 1B1ZA 3V61A 1PYWD 1SE4A 2KANA 2LJIA 4B6WA 1C9FA 3AE3B 4K3CA 3OLMD 5HG2A 3QWZB 1VR9A 3W1SC 4G11A 1UBIA 1MHHE 4YTPB 3RUIB 2IY1B 1R4NB 1SIFA 1HZ6A 3LDZE 3URYA 3ML8A 4E74A 5BMIA 3AU4A 3BINA 2ICIA 3RNEC 2I2YA 4KGTA 2KOXA 2L76A 4P6VF 2WXQA 2BBCA 3JVZX 4M00A 2JY6A 3NRZA 1YJ1A 4YSYB 4HJGE 1QQRA 1WE6A 3CSFA 4A9AA 3Q2AC 1WSPA 2O2VA 2RDHA 1G6JA 4PS8A 3GZNB 1QOFA 1X1MA 2RGFA 1C4AA 1EF1A 2W3SA 3BVZA 4K7WA 2WU2B 4ZRQA 2LUEA 4C4VB 1C76A 2NTTA 3AULA 4WQMA 3VQIA 3FKYA 2MH7A 1GPXA 1L4ZB 5CHWA 4AJWA 1WFYA 4RMAA 2EMTA 3ZDTA 2G1EA 3R8BA 4WAFA 1TY2A 4IG7B 2DZJA 4MSQB 4MACA 2ZEQA 5D3IB 4RF0A 2DZKA 3PZ8A 2MBOA 4ZHOA 2AX5A 1OEYA 4WWOA 1NENB 4A90A 1UWXA 2R2OA 4N9F4 1SJED 3RI7C 2KJHB 3QX1A 1FXAA 1VJKA 2KLGA 1FM0D 4W9KA 3A33B 3S2AA 3IT4B 1EWYC 5BYRA 4JLCA 2WS3B 2KHWB 2KK8A 1WYWB 4LNKA 4CHKA 2J7QB 3V6EB 2A4ZA 2CJNA 1L0YB 3EECA 3VDZA 3N3KB 1PFDA 1ZDXA 1XLNA 2LHDA 1U4AA 3SFEB 3BZDB 4O1NA 4EFOA 1I4GA 4C80A 2KN4A 1DYQA 1YNTE 2WQYB 4S0RA 3Q3MC 3B1LX 5IAAC 1ZE3D 2WXRA 4ZHPA 3U2SC 1RM6C 2PPHA 1E6EB 1QILA 2WDQB 4GDKA 2ACZB 4XDCA 4YTNB 5IOIA 4M8MA 2PVOD 3L17A 1TS3A 1YN4A 2ASQA 4HPLB 3HUIA 1J7AA 3EUB2 1UF0A 1XEEA 2KTRB 3N1YC 4HWIB 3ALBA 5FR3A 3V62A 1F0ZA 2QSDA 1V2YA 3JSVB 4AS1A 2KX3A 1B9RA 2LJ5A 3L13A 2L32A 4W9CA 4FXCA 3NJTA 1TTNA 2GRIA 2BW2A 2LVPA 2JRHA 1XQQA 1FNUA 4I6NB 4OZAA 4FBJB 1WMHB 4KV2A 3AE5B 3ZKJC 4K7UA 3GP7A 5BO4B 3I9V1 2OJRA 1DOXA 2JZ3B 3QARA 4H2AA 4HJKA 4DQOC 4ITKA 1S1QB 3Q8FA 3BK1A 2K25A 2LASA 2H89B 2XK5B 1J19A 2DBYA 2CKHB 2KJRA 4HKZE 1YX5B 3ECIA 3VRBB 3CMMB 2QCZA 3TEYA 4URKA 1HXYD 2BYFA 1I4QA 2ONQA 4E71A 5IN7A 3DWMA 1TKGA 4IWOA 4HPMB 2OOBB 2DAFA 4WURA 2K6QA 1I4HA 4HDOA 1VZ7A 5H92C 4NQKE 2LI5A 5GMVA 2K6DB 1SE3A 3WANA 3V3XA 2FCMA 2K39A 1TJEA 3SEBA 2JPHA 4F7ZA 4DHZB 1SXTA 4YSZB 3T9LA 1IGCA 3PVLA 3MHZA 2WXJA 3ML9A 3U4EG 3ZJVA 1IUEA 3WCQA 2FCSA 1GNUA 1XLPA 3CWIA 3EFCA 2LWPA 3PPAA 1RFKA 5JXVA 1ZUD2 2KZRA 4P7IA 1ROEA 1WH3A 3DHHC 1P7FA 3AMZA 1UZXB 2BKRB 4JL9A 1Q0WB 1XO3A 1R7SA 3P4QB 1WE7A 4MH0E 2CS4A 3SDLC 2L7RA 4W9LA 3QJZA 2N9KA 4LK0M 1UBQA 1E7UA 2WDRB 1Z2MA 2QJLA 1HTQA 1UH6A 2X38A 4RGTA 3ZGZA 4XX5A 2FBWB 3VAWA 3D32A 2J4XA 4ARIA 2Z0DB 4IM3A 4AWJA 5C3JB 2DAJA 2KO3A 1WJ4A 2C9WB 2EKIA 5AZFA 1FNVA 4L23A 1XCTL 2N7DA 3PGEA 4XE0A 4BVUC 1WR1A 2JXXA 1C78A 2YVCA 2YLMA 3T3NA 1P1AA 1WM3A 4HXDA 2HJ8A 4YT0B 1WZ0A 2Y3AA 3B08A 3WALA 3NUHB 5D6JB 5C2TB 1UGMA 4IDIA 1E0ZA 2INPE 1VLBA 1PGAA 2N9XA 3T8MA 4HVBA 2UWQA 4B9KA 3IFWB 1T0YA 1FCLA 1WIAA 4ICUA 2KVRA 3LYYA 5GXGB 2IGHA 4G0NB 3QIJA 3DVGY 4OVUA 3QAQA 2MLBA 5BYQA 3GE8C 4MH8A 1EWCA 2JF5A 3Q8EA 4MGIE 3N20C 2AQ1B 1WXQA 1E8XA 2KTRA 3H9DA 1T0SC 4KDIC 5EDSA 5DPSA 2ZNVB 3TEZA 4M0WB 2J52A 3FILB 1QOAA 3Q8BA 4BKSA 1NI2A 3MJWA 3K9OB 3U30A 2LZ6A 2PTLA 1C79A 5HKHA 2OEDA 1RYJA 2I38A 3VVWB 1ET6A 2WLBA 4DXFA 1WMHA 2D10A 4F1SA 4WH4A 4RNAA 1WM2A 2LGIA 4JPSA 1GG3A 2L00B 3NS1A 1KOTA 2E3TA 1VRAB 4FADA 1C4PA 3UI3A 1J7BA 3RPFC 2DWQA 3Q69A 3I5JC 3GE3C 1ZDVA 2WWZA 3C19A 5L95C 2B3AA 3JW0X 4OW0A 3AEBB 2NPTA 4C56C 5BMHA 2M19A 1JWAD 2KC2A 5CHFA 1V1PA 4WAAA 3V6CB 3SU8X 2WXIA 3DVGX 3OJ3A 4D2KA 1YQ4B 1C1YB 2Q5WD 3H7SA 3ZNGC 1L4DB 3ZJUA 4HLEA 1FIQA 1SEBD 4MJSB 1FNWA 3RZFA 3N32A 5JHBA 3VTUA 4G50A 2DZIA 2ZCCA 3P4SB 4ICVA 5LNK1 3U7DA 3UIOB 3NVZA 3RNBC 3W5VB 2ZW0A 4EEWA 1LO5D 1RWSA 1BT0A 1OTRB 2BGFA 2BS2B 1NYRA 4KZCA 3NVVA 2VH1A 1E9MA 1I4PA 1ZW7A 3I3TB 1OEYJ 3TIXA 1K53A 2KNBA 3I63C 1YJJA 3GZNI 2N7EA 2IYDB 1RRBA 2Y5BB 4TV3A 3IT6B 4NAMA 3A9KA 1K51A 2BQQA 2NBWB 3AEEB 2O6VA 2IO2B 4K3BA 4XWTA 1FFVA 1FFUA 1WJNA 2L05A 3N1ZC 2CHWA 1KF6B 2J0JA 2V0GA 3PZ7A 1D5ZC 1CK1A 4JQWC 4FN2A 1MHXA 1I4XA 1D4BA 3AEAB 4ZRKA 4C7ZA 4WJPA 5DPRA 4DBGA 2LHEA 2KFKA 2NTSA 3DVNU 3LXFA 4DHJB 3HRDD 1OGWA 2FAZA 4ASWC 5D2MB 1XLOA 1T0QC 3A4SC 2DYBA 4W9EA 1WGGA 5FR6A 1L6VA 3TSSA 1GC7A 3UQAA 4C7YA 3M3JA 3ZIMA 1T0RC 2K22A 2LRUA 3H1UA 4ANUA 4BBNC 4PS3A 2DLBA 5IA7A 1WGHA 2IJ0A 2ZVOA 1DOIA 3KUDB 3P4RB 2MW5A 2RDGA 4MGKE 1KRHA 4KIKB 2JWZA 2TSSA 2BS4B 2N9LA 3APCA 4X57B 2WNMA 4AUQC 1V86A 5EE9A 4AQ7A 3T3OA 1TIFA 4IM2A 3B0AA 3H8HA 4DHJD 2WXHA 1T5XD 1SB3C 3ONSA 3TBLD 4BFRA 2MRPA 4BAXA 2JQRB 2HJ1A 2INCC 4BKTA 1QOBA 4M0WA 1V97A 1N6ZA 1DOYA 1TS4A 1I4RA 3FILA 4EZJA 1JWMD 1C77A 2WXMA 2M0XA 1YQ3B 3RD2A 4XDDA 4XZ4A 2MCNB 1MVKA 1V9JA 2WDTB 1WJ6A 3ENEA 2D3BA 1WYGA 2V9HA 4GSWA 3Q8CA 3DWGC 1M94A 4K1RB 1Y56A 2AL6A 2N4FA 2J0KA 5HHDG 1IYFA 4YWGG 2INDC 3V05A 1RLFA 1ESFA 2BF8B 3RNCC 4PYZA 1ZXIA 4WJOA 1WXSA 4M8NA 4WWPA 3DBHB 2NS5A 3NZUA 3QCAA 3PV1A 1KLUD 1YMHE 3E56A 3C0RB 2BYVE 2LGDA 3B9JA 3KYCD 2BPSA 2GBJA 1JCKB 5FKAC 3HHMA 2M4NA 1JRUA 4K7SA 4XYCA 3UQBA 4W9GA 3RCZA 2ZNVC 1JWUD 1HA5A 2KWVB 4LTUA 2ZVNA 4FJYA 4A20A 1Q5WB 3ABVB 2PLPA 4US9A 1WGRA 4MJSA 2KFJA 4XGAB 3KWVA 2CR5A 2Z8LA 5HI1A 1XD3B 3O65B 4LNOA 2JT4B 2KQ7A 1F2RI 2BKFA 2KDEB 2KYWA 2NBUA 2IGDA 1KJTA 5H8YE 5JH5C 1VZ8A 1VDVA 2QEJC 2L52A 2KWDA 3PZDA 4NNJB 1P0RA 2IDYA 3C8YA 1QT9A 3Q3OC 1EU3A 3GOEA 1N60A 1VD2A 1NEKB 3L54A 2MP2A 3NG0A 1E8ZA 2PE9A 1H8CA 4I6PA 3DPDA 1Q1OA 1D5XC 3TJPA 2K8CA 3QHTA 4DXGA 3QA8A 1HE8A 1KM7A 1SE2A 1VZ6A 2MWSB 4LDTD 1L6UA 4C00A 2L1AA 3DCGA 1WY8A 2KN5A 3VRAB 2D3CA 3O13A 2CHXA 2ZPNA 1UUPA 3EGRA 3AM9A 2M8SA 3A1QB 2AWTA 4GMVA 1EF5A 2EMSA 4L1BA 1AARA 4RFBA 1XT9B 2FNJB 2LD9A 1V1OA 4KSLC 2W82A 1QF6A 2KC1A 3U8ZA 1F52A 2WX1A 2KAJA 2Z59B 2RD0A 3PRPB 5G2NA 4NAWB 3VR8B 2CU1A 3QQ8B 1K8RB 1ZOYB 4KIKA 1L5PA 4KZ0A 4OZBA 4FHJA 1I7HA 2JZZA 2MEKA 1NVID 1F9JA 3ZXRA 1JWSD 4GIVA 5G55A 4IOIE 4MM3B 4PK1A 1R4MB 3VTWA 3KUZA 2LUMA 4I6LB 3B2FA 2MBQA 5DPTA 4A8XC 2R61A 5CTRC 2N9PC 3RFZB 1SSNA 2MBEA 4ANVA 2L0TA 1JALA 2KWCA 4K81A 4HROA 2V4LA 3N1XC 2INNE 4C4VA 2JYEA 3P4PB 3GB1A 5LLIA 3QK0A 2XEWA 1IP9A 4GB9A 2BYEA 1C3TA 3P1MA 1PGBA 2PJHA 2FCQA 3W5UB 5JZEB 2LXCA 1IBXB 2HTME 4JE3B 4GDLB 3WA0A 1IGDA 5C1ZA 4OZCA 4KGRA 2WP9B 1BXTA 2K5PA 3Q3JA 4NJ7A 4A3OA 3Q3FA 5AEKB 4REZA 2D2QA 4WWNA 5MPOA 2D07B 4LNFA 2BB5A 4FHKA 2KQSA 4RGOS 2WXLA 1EU4A 2KACA 1CMXB 2PKOA 2YEPF 4ZRPA 2K8BA 1BUIC 2CJOA 4N58A 3OJ4B 4ANWA 3DBLI 4KSKC 4FULA 5AZGA 2L0FA 4DWFA 1ISNA 2I1JA 4A3PA 3AN1A 1MPEA 4GGQA 1MJDA 2KDIA 2R2QA 4HRSA 2KDMA 4EUTA 2IO0B 5HFYA 1TS5A 1TYGB 3TCAA 1PGXA 4EZLA 1V5OA 3LJ3A 2V4IB 4P1BC 2PVGC 3WIMA 1ENFA 1FXTB 2RSUA 3AEGB 2FUG1 3MC8A 4YTMB 3K9PB 5E6NA 1WXMA 4M02A 3BYYB 4J6IA 4BZAA 2KDFB 3SD5A 4JIOU 2JRIB 1RFAA 3JSVA 3KYDD 2LGYA 2LMCA 2BWES 5IP4D 3PRMB 1K52A 3CSTA 1UD7A 1TS2A 2NVUI 3R66C 4ZDVA 1UNSA 3W2DA 5E6PA 2JSVX 2WXNA 4TSSA 2XBBC 1TKEA 2KVZA 2O2VB 4AJYB 3M95A 3NS8A 3NOBA 2C7MB 1F1HA 3WAPA 2OJWA 4GU2A 3DBRI 2M56B 2I1KA 2JU6X 2WU5B 1D5MC 2KXJA 1AWDA 1N5WA 3DBLB 4R3DA 1WX9A 1E7PB 4IWQA 4MEMA 4TQ0A 3B2GA 4B0EA 4LJPB 1C4CA 3P63A 1GJZA 3AE6B 3VH4B 4Q2JA 3AE4B 4FLHA 1EUVB 2RPVA 1T3QA 5D94A 2GBMA 1TGZB 2XK5A 1LM8B 2N1VA 1N5XA 1J7CA 4W9HA 1STEA 4W9IA 5D3DA 3IG3A 1V8CA 3NVYA 1PUTA 4MELA 2C7HA 1CQVA 3R3MA 2ON8A 3HK0A 1HZ5A 4JX1C 2XN9C 3ZRFA 4KVGB 2AQ3B 4TMAB 2ZPYA 3ZNID 1V81A 1P7EA 4MM3A 2SAKA 3ZRCA 2LGXA 4HKQA 1N61A 1Q10A 2D5GA 2RPQA 5J2RA 3AV8A 2LVQA 4J3OD 2N0SB 1P3QU 3PLVA 2WYQA 3Q6BA 4LJOB 5KHOA 3DHGC 5E6OA 2BVCA 1N62A 2K9XA 1OFFA 4IM0A 4NJCA 4KDLB 2KT7A 3AE2B 2PMVA 3A9JB 3RMKC 1QLBB 1JMLA 4W9FA 1UGJA 4UDUC 3DBRB 2JUOA 3PT2B 3BVGA 1P98A 1FRDA 2NR2A 3ZNZB 1IBXA 2BWFA 4GDLA 1L0XB 1TKYA 2WDVB 4MGZE 2V3NA 4GDKB 2BYTA 3DHIC 4IKGA 2KD0A 4CO7A 1QKZA 1F2RC 2V3PA 3ZYYX 2W9NA 4HCNB 2GMIC 3AECB 3TUOA 4XC2A 2XNAC 1KLGD 4TKNA 1EO6A 1SBBB 3ZJTA 1RAXA 2JWUA 5FK9C 2AYOB 3MHSD 2DYMA 4DXAB 2IO3B 1BMLC 5G5HA 2K3UA 2QIEB 1SJHD 3DQVA 1YQBA 3TL5A 3UGBB 4DDGD 2HTHA 2L8JA 4FJZA 1HEZE 2GLSA 1UELA 3DBHI 2WXKA 2UYZB 2PW9A 1V80A 1WX7A 3AE7B 4A6QA 3M62B 2WXGA 2IGGA 2C5LC 2NCNA 4NPNA 1NDDA 3EA6A 5DPWA 4PT5A 1SIJA 1UWMA 2ZCBA 5G5GA 3ZQ4A 1NI3A 3PSEB 4RF1A 3EHVA 4G3XB 1AN8A 3LB8C 3M63B 4W9JA 1WXAA 4HCPB 2D3AA 3VUYA 4N59A 2BB6A 2G9HD 4BOSC 3NZSA 4JWSC 2HDEA 5LXIB 4LCDE 1V49A 4NJ6A 1YJIA 1E10A 3BK2A 2FIDA 1WXVA 1WX8A 2LGSA 3VTVA 3VR9B 4IWPA 5L83A 4BOZB 2G45B 3AE1B 4ARCA 2PE6B 3IAM1 1T6BX 5I4DA 2IZVB 2WXOA 3U52E 1JROA 3MC0B 1AW7A 4LLGM 3PLUA 3WAMA 1ZKHA 3IBEA 1K50A 4B95A 3NY5A 1L2NA 2GBKA 3W9CB 2C7NB 1MI0A 1XCQL 2J42A 1LGRA 1TZ1A 5BMGA 3PTFC 3WAOA 2N9EB 2REXA 1WWTA 3H6NA 2KDBA 2ZZPB 3UINB 5CX3A 4ANXA 1GUAB 2K0PA 2W3RA 4II2B 2IY0B 1PDXA 4ZYSA 1KFYB 2LFIA 1ZXHA 2Z0EB 1QOGA 5J18A 2MSED 2GI9A 4EE2A 1LFDA 4II3B 2MX2A 4GN1A 3PHWB 3R7QA 1D3ZA 1M4VA 2DX5B 4MT5A 2CU3A 4RCOA 4LDTB 3HM6X 3P2BA 4KX6B 1YOVB 4KGSA 1FPYA 1PQSA 5KHQA 3HVZA 2UU7A 3EC8A 2JVCA 2WGSA 3A9JA 3VXWA 2MJEA 3L0WB 3RYTA 3KUCB 2CHZA 2VRRB 4S17A 2PEAA 1R4MI 5TSSA 3H7PB 3DDCB 4OHJA 3ZTCA 4QAYA 1YD8U 5EE1A 4KKJA 1CJEA 4RGNA 3APDA 1WRDB 3JYUA 4DDID 3PRZA 2QILA 2HE7A 3SR6A 2Y5CA 4N6EB 3MTNB 3RN9C 3P42A 3N30A 1WRIA 1MG8A 4E3CA 3MJ5A 1ET9A 2GBNA 3MFGA 3ZDMC 3DOWA 3I57A 2AQ2B 2M1MA 2WXPA 2JZPA 3KW5B 4GXBA 3KWLA 1XF5L 3RZWC 5EE3A 4NQLB 3J9CA 1CZPA 1WF9A 3L10B 5CHVC 5AUIA 1OQYA 1TBEA 1ZP0B 5AZHA 4DHZE 1ZGUB 3R2TA 3ZXVA 3FC4A 2KX0A 3EFUA 4IC7B 3HM3A 2QDFA 1OQQA 2D11A 3SFDB 3TEWA 4OVZA 2K1FA 1FEHA 3HIZA 1SF0A 4F8CB 3NVWA 1XLQA 4USAA 4BKSD 2NBVB 3AB5A 3APFA 2FCNA 4WQOB 1WI0A 1QZEA 1VCBA 2VH2A 2IPKD 2EELA 2NPTB 3L4PA 3BY4B 2X8XX 3X23A 2G3QB 1V1PB 4HPPA 3VUXA 4PS7A 1J8CA 2KJ6A 3BWUD 3BYTB 1NYQA 4HEA1 5IKCM 4HDQA 2DYOA 1LQBA 3RNFC 4BBNF 4W9DA 3ZNHB 4YSXB 3AH7A 1TZOA 3VH3B 4WWMA 4GOCA 3ZO5B 4ZRIA 4FA6A 1E8YA 1WJUA 4US8A 1GC6A 3RNAC 1WZ3A 2W55A 1JQ4A 2KQ4X 4JWUC 2AL3A 1E7VA 2M0AA 2E6XA 2KLCA 3X0WA 4PYUA 3R2IA 1WGDA 4RM9A 3ETRA 2WHIA 3W1YA 1ZPSA 3L08A 1HTOA 1Y8RC 4P16A 3ZW3A 1DGJA 3R7RA 4KKIA 2A5UA 2AEHA 1MFWA 3A4RA 5J17A 3DBSA 3PREA 3A9KB 4TQ1A 3UF8A 3HVDA 1F77A 2VZKB 1SE9A 2O6VB 1YN5A 5AUKA 3L16A 2BS3B 2DHZA 3MC9A 4P1CC 1I42A 1GB4A 2L83A 2YEPB 4GLSC 1XXGA 4FJVB 1S3SG 3IXSA 3AEDB 2MHJA 2KFKB 4RGMA 5DCNA 2MA9B 2QC8A 5LXHA 3Q3NC 3AXCA 4A55A 4AOFA 2IBIB 3CIRB 2KWUB 1D6EC 1GAQB 3ZTDA 2LEKA 3AI5A 4IUMB 5IO9A 2KMCA 2LVOA 1Z5SB 1HQRD 3U7ZA 2WX0A 4RM8A 2VZKD 3AU5A 3MP9A 2O6VD 3Q14C 2JXTA 3VFKA 1JWBD 2GOWA 3BVMA 3H7PA 2M17A 3VUWA 2NMQA 1FRRA 5BYSA 1LXDA 3SHQA 2ZW1A 4EOYA 2RR9A 3AE9B 3BIID 2KTFA 3NHEB 1FO4A 2KMAA 4BKGA 3N9YC 3FAHA 2W54A 3E9SA 2SEBD 3PHXB 4CYEA 5JHAA 1KLVA 1FXIA 2PIAA 2DENB 3A1QA 3PO0A 2MQJA 3TMPB 5T8IA 2FIFA 2KKCA 3IHPC 2K8HA 1I35A 4MSMB 1OQRA 3OAWA 2MBBB 2J53A 3VHTC 1TT5B 3NZ3A 4L2YA 4WJNA 4EKUA 4MGYE 4NAWA 1A70A 3AE8B 4ZYNA 2KMMA 3QC8B 1H4RA 3KLSX 2DZMA 3KVFB 3CF6E 4IW0A 1JW9D 4TUUA 1YIWA 4EZKA 4WIPA 4RH6A 3OWEB 4JGHB 4ZOHC 3RULA 4ACFA 2V1YA 3AEFB 2EKEC 2G4SA 5D7GA 5EE0A 5E6JA 4YL8A 4HK2A 2FUHB 3GS2A 1E90A 1J0GA 2J0MA 3ZUNA 2B76B 2L3ZA 4XWWA 2GB1A 2MJ3A 1GB1A 3RNGC 2FE8A 4OVVA 4CQNA 1EM7A 3V60A 2MJDA 1L0VB 1NBFC 2HD5B 4DK5A 1IPGA 2RDBC 3IAS1 2N7JA 3ZLZA 1KTKA 1FMAD 1YN3A 3OG5A 1MG4A 1AYFA 1R4NI 1KH0A 1WGKA 1ACCA 2QMTA 3W1SA 2JYTA 2G4DB 1V5TA 4ZRJA 2V3SA 1E8WA 2BT6A 4MDKE 5TR5A 3RT3B 1E5WA 1TY0A 2DNFA 2MBHA 2QHOA 3KQ4A 1JRPA
chains in the Genus database with same CATH topology
2MP2B 1E8XA 3H6NA 2D3GA 2KTRA 2KDBA 2LXAA 2ZZPB 3UINB 1F9JA 5CX3A 4WJQA 4ANXA 4GIVA 1GUAB 3H9DA 5G55A 1SGHA 4II2B 4KDIC 5EDSA 1V6EA 2IY0B 2ZNVB 5DPSA 3VTWA 3KUZA 1P9DU 4M0WB 4I6LB 2C60A 4BKSA 1A5RA 1NI2A 2MBQA 5DPTA 2Z0EB 3MJWA 3K9OB 5J18A 2MSED 1YX6B 3U30A 4NY0A 5CTRC 2LZ6A 2N9PC 1LFDA 3DVNV 4II3B 2MX2A 2MBEA 4GN1A 4ANVA 2L0TA 5HKHA 2IO1B 2KWCA 2LRWA 4K81A 4AP4C 2ZJDA 3PS6A 3PHWB 3VVWB 2V4LA 3R7QA 3KH0A 1L7YA 5C23A 1D3ZA 1WMHA 2DX5B 2D10A 2N1WA 4F1SA 4LDTB 3HM6X 3P2BA 5LLIA 3QK0A 2XEWA 3IVFA 1WGYA 1IP9A 1WM2A 4GB9A 2GBRA 3ZVVA 3UIPB 1WR6E 1PQSA 5KHQA 2BYEA 1C3TA 2PJHA 3EC8A 1GG3A 2FCQA 2JVCA 3A9JA 3V61A 2KANA 3VXWA 2L00B 4B6WA 3L0WB 1KOTA 3RYTA 5JZEB 3KUCB 3OLMD 2LXCA 4FADA 3QWZB 2CHZA 4GDLB 3W1SC 4G11A 3WA0A 1UBIA 2VRRB 2PEAA 1R4MI 5C1ZA 3H7PB 3DDCB 3RUIB 2IY1B 3Q3JA 1SIFA 4NJ7A 3ZTCA 1YD8U 3Q3FA 4A3OA 3LDZE 5AEKB 3ML8A 4E74A 2D2QA 3AU4A 2WWZA 3APDA 4WWNA 1WRDB 3JYUA 3BINA 2D07B 5L95C 2B3AA 3JW0X 4DDID 2NPTA 2KOXA 2L76A 3PRZA 4FHKA 3JVZX 2JY6A 2HE7A 2KQSA 2KC2A 5CHFA 3MTNB 1YJ1A 4WAAA 1CMXB 3V6CB 2K8BA 3SU8X 1WE6A 3CSFA 3N30A 3OJ4B 1MG8A 4ANWA 4E3CA 3DVGX 2GBNA 3DBLI 3ZDMC 3DOWA 3OJ3A 4KSKC 4FULA 2O2VA 1C1YB 5AZGA 2M1MA 2L0FA 4DWFA 3H7SA 4PS8A 1G6JA 1ISNA 3KW5B 2I1JA 3ZNGC 4A3PA 4GXBA 1X1MA 2RGFA 4HLEA 1EF1A 4GGQA 4MJSB 3RZFA 3N32A 4K7WA 5JHBA 3VTUA 4G50A 2DZIA 2ZCCA 4ICVA 3RZWC 4NQLB 2LUEA 3U7DA 2KDIA 1WF9A 3UIOB 3L10B 3AULA 5CHVC 2R2QA 3VQIA 1OQYA 1TBEA 5AZHA 4DHZE 4EUTA 1ZGUB 2IO0B 5CHWA 2KX0A 1WFYA 4AJWA 4EEWA 3EFUA 4IC7B 3HM3A 3TCAA 1BT0A 4RMAA 2D11A 2EMTA 3ZDTA 4EZLA 1V5OA 1OTRB 3LJ3A 2BGFA 4KZCA 2K1FA 3HIZA 4IG7B 1ZW7A 3I3TB 2DZJA 1OEYJ 3WIMA 4F8CB 3TIXA 4MSQB 2ZEQA 1FXTB 2RSUA 4BKSD 2NBVB 2DZKA 3APFA 2FCNA 4WQOB 2KNBA 1WI0A 3K9PB 5E6NA 1WXMA 1QZEA 2MBOA 3GZNI 4J6IA 2KDFB 1VCBA 3SD5A 4JIOU 2JRIB 1RFAA 2N7EA 1OEYA 4WWOA 3JSVA 2IYDB 3KYDD 1RRBA 2LGYA 2NPTB 2Y5BB 4TV3A 2R2OA 2BWES 4N9F4 3A9KA 3BY4B 3PRMB 2NBWB 3X23A 2KJHB 3CSTA 2G3QB 1UD7A 3QX1A 2O6VA 2IO2B 2NVUI 3R66C 4ZDVA 3VUXA 2KLGA 4PS7A 5E6PA 1WJNA 1J8CA 2L05A 2KJ6A 2CHWA 2J0JA 4W9KA 3A33B 2XBBC 3S2AA 4JQWC 4FN2A 4ZRKA 4HDQA 2O2VB 4WJPA 5DPRA 4AJYB 4DBGA 2DYOA 3M95A 2KFKA 1LQBA 3NOBA 3NS8A 2C7MB 3DVNU 4JLCA 3WAPA 2KHWB 2KK8A 1WYWB 4DHJB 1OGWA 4BBNF 4GU2A 4W9DA 2J7QB 2FAZA 2I1KA 2A4ZA 3DBRI 5D2MB 3V6EB 3ZNHB 4ASWC 3A4SC 3EECA 3VDZA 3N3KB 2KXJA 2DYBA 4W9EA 3VH3B 1WGGA 1U4AA 1WX9A 4IWQA 4GOCA 4MEMA 5FR6A 4TQ0A 1GC7A 3ZO5B 4LJPB 3UQAA 4ZRIA 4FA6A 3M3JA 1E8YA 1WJUA 3VH4B 3ZIMA 1GJZA 4FLHA 4EFOA 1GC6A 1EUVB 2LRUA 1WZ3A 3H1UA 4ANUA 2AL3A 4BBNC 1E7VA 5D94A 2GBMA 4PS3A 5IA7A 1WGHA 2KLCA 1TGZB 3X0WA 2ZVOA 3B1LX 2XK5A 5IAAC 1LM8B 2N1VA 3KUDB 2PPHA 2MW5A 4W9HA 4GDKA 4MGKE 4PYUA 4KIKB 1WGDA 4M8MA 2JWZA 4W9IA 4RM9A 3APCA 4X57B 4AUQC 1V86A 3L17A 3IG3A 3W1YA 3L08A 2ASQA 4HPLB 1Y8RC 4MELA 2C7HA 4IM2A 3ZW3A 3B0AA 3R3MA 2KTRB 3R7RA 4DHJD 4HWIB 3ALBA 3HK0A 2A5UA 2AEHA 3V62A 3ZRFA 3A4RA 1V2YA 3JSVB 3ONSA 2KX3A 4KVGB 3TBLD 3DBSA 2LJ5A 2ZPYA 3L13A 3ZNID 3PREA 1V81A 5J17A 3A9KB 4TQ1A 4W9CA 3UF8A 4BFRA 2MRPA 1SE9A 4MM3A 4BKTA 2O6VB 1TTNA 3ZRCA 2LGXA 3L16A 2DHZA 2LVPA 4EZJA 1I42A 2RPQA 5J2RA 2JRHA 1XQQA 4FJVB 1S3SG 2LVQA 2M0XA 1P3QU 3PLVA 2WYQA 4I6NB 4LJOB 5KHOA 3RD2A 4FBJB 1WMHB 2KFKB 4KV2A 5E6OA 3ZKJC 4XZ4A 2MA9B 5DCNA 4K7UA 2MCNB 5BO4B 5LXHA 4IM0A 1V9JA 2WDTB 1WJ6A 3ENEA 4KDLB 2OJRA 4GSWA 3AXCA 4AOFA 2IBIB 2JZ3B 2KWUB 3A9JB 3QARA 4HJKA 3ZTDA 3AI5A 1M94A 4IUMB 4W9FA 2KMCA 2LVOA 4K1RB 2AL6A 1Z5SB 2JUOA 1S1QB 2J0KA 2N4FA 3PT2B 2WX0A 1P98A 4RM8A 1IYFA 3ZNZB 2NR2A 2K25A 2LASA 1RLFA 2BWFA 3AU5A 2BF8B 4GDLA 2O6VD 3VFKA 2XK5B 1J19A 4MGZE 4PYZA 2GOWA 2CKHB 3H7PA 2KJRA 4GDKB 2M17A 4WJOA 1WXSA 1YX5B 3ECIA 4M8NA 4WWPA 3VUWA 2NS5A 3NZUA 4CO7A 1LXDA 2KD0A 3QCAA 3SHQA 3CMMB 3PV1A 3C0RB 2W9NA 2BYVE 4HCNB 4EOYA 2GMIC 2LGDA 4URKA 2RR9A 3KYCD 2BYFA 4XC2A 4E71A 2BPSA 2GBJA 4TKNA 1EO6A 3HHMA 4IWOA 1RAXA 4HPMB 2M4NA 1JRUA 2AYOB 3MHSD 2KTFA 2DYMA 2OOBB 4K7SA 2DAFA 3NHEB 4DXAB 3UQBA 2K6QA 4W9GA 2IO3B 4HDOA 2KMAA 4BKGA 3RCZA 2ZNVC 4NQKE 2LI5A 5GMVA 2K6DB 3WANA 2KWVB 2FCMA 2K39A 3PHXB 4CYEA 5JHAA 1KLVA 3DQVA 2JPHA 1YQBA 2ZVNA 4FJYA 4A20A 4F7ZA 4DHZB 1Q5WB 2DENB 3A1QA 3T9LA 3TL5A 2MQJA 3UGBB 3TMPB 3PVLA 4DDGD 2HTHA 1WGRA 2L8JA 3ML9A 4MJSA 2KFJA 2FIFA 2KKCA 3IHPC 4FJZA 2CR5A 1UELA 1XD3B 3DBHI 3O65B 2K8HA 2FCSA 1GNUA 1I35A 2JT4B 2KQ7A 2UYZB 4MSMB 3OAWA 1V80A 2BKFA 2MBBB 1WX7A 2LWPA 3PPAA 3VHTC 3M62B 2KDEB 2NBUA 2KZRA 4P7IA 2C5LC 2NCNA 4NPNA 4WJNA 4EKUA 4CHKA 1NDDA 4MGYE 1WH3A 5DPWA 4NAWA 4ZYNA 1KJTA 2ZCBA 5JH5C 3PSEB 1UZXB 2BKRB 3QC8B 4JL9A 1H4RA 1Q0WB 1WE7A 4MH0E 2DZMA 3EHVA 2CS4A 3PZDA 3SDLC 3KVFB 1P0RA 2L7RA 3CF6E 4IW0A 4G3XB 4NNJB 4TUUA 1YIWA 4W9LA 3QJZA 1UBQA 4EZKA 3GOEA 1E7UA 3M63B 1VD2A 1Z2MA 4JGHB 4W9JA 1WXAA 3RULA 3L54A 4HCPB 1UH6A 3VUYA 2MP2A 1E8ZA 2PE9A 1H8CA 4I6PA 2V1YA 3DPDA 1Q1OA 4BOSC 3NZSA 5LXIB 3TJPA 2K8CA 4LCDE 3QHTA 4XX5A 2EKEC 2G4SA 3QA8A 3VAWA 5D7GA 3D32A 1HE8A 1V49A 4YL8A 4HK2A 1KM7A 4NJ6A 2Z0DB 4IM3A 4AWJA 2FUHB 2MWSB 2FIDA 2DAJA 1E90A 1WXVA 2KO3A 4LDTD 1WJ4A 2C9WB 5AZFA 1J0GA 1WX8A 2J0MA 3DCGA 3VTVA 1WY8A 2N7DA 3PGEA 3ZUNA 2KN5A 4BVUC 2L3ZA 1WR1A 2JXXA 4IWPA 2YVCA 2YLMA 2CHXA 2ZPNA 1P1AA 1WM3A 4HXDA 5L83A 4BOZB 2HJ8A 1WZ0A 4OVVA 3B08A 3WALA 2G45B 2PE6B 2M8SA 5D6JB 3V60A 2IZVB 1UGMA 1NBFC 2HD5B 3A1QB 2AWTA 4GMVA 1EF5A 2EMSA 4DK5A 1AARA 1IPGA 1XT9B 2FNJB 2LD9A 3ZLZA 2N9XA 3T8MA 1R4NI 4KSLC 4HVBA 2UWQA 4B9KA 2KC1A 3U8ZA 3IFWB 3PLUA 2WX1A 1T0YA 3WAMA 3W1SA 1ZKHA 1WIAA 4ICUA 2G4DB 1V5TA 3IBEA 2KVRA 2RD0A 2Z59B 3PRPB 4ZRJA 5G2NA 2V3SA 4NAWB 4B95A 3NY5A 1L2NA 2CU1A 3QQ8B 1K8RB 1E8WA 2GBKA 4G0NB 2C7NB 4MDKE 5TR5A 3QIJA 3DVGY 4OVUA 3RT3B 1E5WA 4KIKA 2MBHA 3QAQA 4KZ0A 4FHJA 1TZ1A 2QHOA 2MLBA 3PTFC 2JZZA 3WAOA 2JF5A 2N9EB 2REXA 4MGIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MP2 B;  1E8X A;  3H6N A;  2D3G A;  2KTR A;  2KDB A;  2LXA A;  2ZZP B;  3UIN B;  1F9J A;  5CX3 A;  4WJQ A;  4ANX A;  4GIV A;  1GUA B;  3H9D A;  5G55 A;  1SGH A;  4II2 B;  4KDI C;  5EDS A;  1V6E A;  2IY0 B;  2ZNV B;  5DPS A;  3VTW A;  3KUZ A;  1P9D U;  4M0W B;  4I6L B;  2C60 A;  4BKS A;  1A5R A;  1NI2 A;  2MBQ A;  5DPT A;  2Z0E B;  3MJW A;  3K9O B;  5J18 A;  2MSE D;  1YX6 B;  3U30 A;  4NY0 A;  5CTR C;  2LZ6 A;  2N9P C;  1LFD A;  3DVN V;  4II3 B;  2MX2 A;  2MBE A;  4GN1 A;  4ANV A;  2L0T A;  5HKH A;  2IO1 B;  2KWC A;  2LRW A;  4K81 A;  4AP4 C;  2ZJD A;  3PS6 A;  3PHW B;  3VVW B;  2V4L A;  3R7Q A;  3KH0 A;  1L7Y A;  5C23 A;  1D3Z A;  1WMH A;  2DX5 B;  2D10 A;  2N1W A;  4F1S A;  4LDT B;  3HM6 X;  3P2B A;  5LLI A;  3QK0 A;  2XEW A;  3IVF A;  1WGY A;  1IP9 A;  1WM2 A;  4GB9 A;  2GBR A;  3ZVV A;  3UIP B;  1WR6 E;  1PQS A;  5KHQ A;  2BYE A;  1C3T A;  2PJH A;  3EC8 A;  1GG3 A;  2FCQ A;  2JVC A;  3A9J A;  3V61 A;  2KAN A;  3VXW A;  2L00 B;  4B6W A;  3L0W B;  1KOT A;  3RYT A;  5JZE B;  3KUC B;  3OLM D;  2LXC A;  4FAD A;  3QWZ B;  2CHZ A;  4GDL B;  3W1S C;  4G11 A;  3WA0 A;  1UBI A;  2VRR B;  2PEA A;  1R4M I;  5C1Z A;  3H7P B;  3DDC B;  3RUI B;  2IY1 B;  3Q3J A;  1SIF A;  4NJ7 A;  3ZTC A;  1YD8 U;  3Q3F A;  4A3O A;  3LDZ E;  5AEK B;  3ML8 A;  4E74 A;  2D2Q A;  3AU4 A;  2WWZ A;  3APD A;  4WWN A;  1WRD B;  3JYU A;  3BIN A;  2D07 B;  5L95 C;  2B3A A;  3JW0 X;  4DDI D;  2NPT A;  2KOX A;  2L76 A;  3PRZ A;  4FHK A;  3JVZ X;  2JY6 A;  2HE7 A;  2KQS A;  2KC2 A;  5CHF A;  3MTN B;  1YJ1 A;  4WAA A;  1CMX B;  3V6C B;  2K8B A;  3SU8 X;  1WE6 A;  3CSF A;  3N30 A;  3OJ4 B;  1MG8 A;  4ANW A;  4E3C A;  3DVG X;  2GBN A;  3DBL I;  3ZDM C;  3DOW A;  3OJ3 A;  4KSK C;  4FUL A;  2O2V A;  1C1Y B;  5AZG A;  2M1M A;  2L0F A;  4DWF A;  3H7S A;  4PS8 A;  1G6J A;  1ISN A;  3KW5 B;  2I1J A;  3ZNG C;  4A3P A;  4GXB A;  1X1M A;  2RGF A;  4HLE A;  1EF1 A;  4GGQ A;  4MJS B;  3RZF A;  3N32 A;  4K7W A;  5JHB A;  3VTU A;  4G50 A;  2DZI A;  2ZCC A;  4ICV A;  3RZW C;  4NQL B;  2LUE A;  3U7D A;  2KDI A;  1WF9 A;  3UIO B;  3L10 B;  3AUL A;  5CHV C;  2R2Q A;  3VQI A;  1OQY A;  1TBE A;  5AZH A;  4DHZ E;  4EUT A;  1ZGU B;  2IO0 B;  5CHW A;  2KX0 A;  1WFY A;  4AJW A;  4EEW A;  3EFU A;  4IC7 B;  3HM3 A;  3TCA A;  1BT0 A;  4RMA A;  2D11 A;  2EMT A;  3ZDT A;  4EZL A;  1V5O A;  1OTR B;  3LJ3 A;  2BGF A;  4KZC A;  2K1F A;  3HIZ A;  4IG7 B;  1ZW7 A;  3I3T B;  2DZJ A;  1OEY J;  3WIM A;  4F8C B;  3TIX A;  4MSQ B;  2ZEQ A;  1FXT B;  2RSU A;  4BKS D;  2NBV B;  2DZK A;  3APF A;  2FCN A;  4WQO B;  2KNB A;  1WI0 A;  3K9P B;  5E6N A;  1WXM A;  1QZE A;  2MBO A;  3GZN I;  4J6I A;  2KDF B;  1VCB A;  3SD5 A;  4JIO U;  2JRI B;  1RFA A;  2N7E A;  1OEY A;  4WWO A;  3JSV A;  2IYD B;  3KYD D;  1RRB A;  2LGY A;  2NPT B;  2Y5B B;  4TV3 A;  2R2O A;  2BWE S;  4N9F 4;  3A9K A;  3BY4 B;  3PRM B;  2NBW B;  3X23 A;  2KJH B;  3CST A;  2G3Q B;  1UD7 A;  3QX1 A;  2O6V A;  2IO2 B;  2NVU I;  3R66 C;  4ZDV A;  3VUX A;  2KLG A;  4PS7 A;  5E6P A;  1WJN A;  1J8C A;  2L05 A;  2KJ6 A;  2CHW A;  2J0J A;  4W9K A;  3A33 B;  2XBB C;  3S2A A;  4JQW C;  4FN2 A;  4ZRK A;  4HDQ A;  2O2V B;  4WJP A;  5DPR A;  4AJY B;  4DBG A;  2DYO A;  3M95 A;  2KFK A;  1LQB A;  3NOB A;  3NS8 A;  2C7M B;  3DVN U;  4JLC A;  3WAP A;  2KHW B;  2KK8 A;  1WYW B;  4DHJ B;  1OGW A;  4BBN F;  4GU2 A;  4W9D A;  2J7Q B;  2FAZ A;  2I1K A;  2A4Z A;  3DBR I;  5D2M B;  3V6E B;  3ZNH B;  4ASW C;  3A4S C;  3EEC A;  3VDZ A;  3N3K B;  2KXJ A;  2DYB A;  4W9E A;  3VH3 B;  1WGG A;  1U4A A;  1WX9 A;  4IWQ A;  4GOC A;  4MEM A;  5FR6 A;  4TQ0 A;  1GC7 A;  3ZO5 B;  4LJP B;  3UQA A;  4ZRI A;  4FA6 A;  3M3J A;  1E8Y A;  1WJU A;  3VH4 B;  3ZIM A;  1GJZ A;  4FLH A;  4EFO A;  1GC6 A;  1EUV B;  2LRU A;  1WZ3 A;  3H1U A;  4ANU A;  2AL3 A;  4BBN C;  1E7V A;  5D94 A;  2GBM A;  4PS3 A;  5IA7 A;  1WGH A;  2KLC A;  1TGZ B;  3X0W A;  2ZVO A;  3B1L X;  2XK5 A;  5IAA C;  1LM8 B;  2N1V A;  3KUD B;  2PPH A;  2MW5 A;  4W9H A;  4GDK A;  4MGK E;  4PYU A;  4KIK B;  1WGD A;  4M8M A;  2JWZ A;  4W9I A;  4RM9 A;  3APC A;  4X57 B;  4AUQ C;  1V86 A;  3L17 A;  3IG3 A;  3W1Y A;  3L08 A;  2ASQ A;  4HPL B;  1Y8R C;  4MEL A;  2C7H A;  4IM2 A;  3ZW3 A;  3B0A A;  3R3M A;  2KTR B;  3R7R A;  4DHJ D;  4HWI B;  3ALB A;  3HK0 A;  2A5U A;  2AEH A;  3V62 A;  3ZRF A;  3A4R A;  1V2Y A;  3JSV B;  3ONS A;  2KX3 A;  4KVG B;  3TBL D;  3DBS A;  2LJ5 A;  2ZPY A;  3L13 A;  3ZNI D;  3PRE A;  1V81 A;  5J17 A;  3A9K B;  4TQ1 A;  4W9C A;  3UF8 A;  4BFR A;  2MRP A;  1SE9 A;  4MM3 A;  4BKT A;  2O6V B;  1TTN A;  3ZRC A;  2LGX A;  3L16 A;  2DHZ A;  2LVP A;  4EZJ A;  1I42 A;  2RPQ A;  5J2R A;  2JRH A;  1XQQ A;  4FJV B;  1S3S G;  2LVQ A;  2M0X A;  1P3Q U;  3PLV A;  2WYQ A;  4I6N B;  4LJO B;  5KHO A;  3RD2 A;  4FBJ B;  1WMH B;  2KFK B;  4KV2 A;  5E6O A;  3ZKJ C;  4XZ4 A;  2MA9 B;  5DCN A;  4K7U A;  2MCN B;  5BO4 B;  5LXH A;  4IM0 A;  1V9J A;  2WDT B;  1WJ6 A;  3ENE A;  4KDL B;  2OJR A;  4GSW A;  3AXC A;  4AOF A;  2IBI B;  2JZ3 B;  2KWU B;  3A9J B;  3QAR A;  4HJK A;  3ZTD A;  3AI5 A;  1M94 A;  4IUM B;  4W9F A;  2KMC A;  2LVO A;  4K1R B;  2AL6 A;  1Z5S B;  2JUO A;  1S1Q B;  2J0K A;  2N4F A;  3PT2 B;  2WX0 A;  1P98 A;  4RM8 A;  1IYF A;  3ZNZ B;  2NR2 A;  2K25 A;  2LAS A;  1RLF A;  2BWF A;  3AU5 A;  2BF8 B;  4GDL A;  2O6V D;  3VFK A;  2XK5 B;  1J19 A;  4MGZ E;  4PYZ A;  2GOW A;  2CKH B;  3H7P A;  2KJR A;  4GDK B;  2M17 A;  4WJO A;  1WXS A;  1YX5 B;  3ECI A;  4M8N A;  4WWP A;  3VUW A;  2NS5 A;  3NZU A;  4CO7 A;  1LXD A;  2KD0 A;  3QCA A;  3SHQ A;  3CMM B;  3PV1 A;  3C0R B;  2W9N A;  2BYV E;  4HCN B;  4EOY A;  2GMI C;  2LGD A;  4URK A;  2RR9 A;  3KYC D;  2BYF A;  4XC2 A;  4E71 A;  2BPS A;  2GBJ A;  4TKN A;  1EO6 A;  3HHM A;  4IWO A;  1RAX A;  4HPM B;  2M4N A;  1JRU A;  2AYO B;  3MHS D;  2KTF A;  2DYM A;  2OOB B;  4K7S A;  2DAF A;  3NHE B;  4DXA B;  3UQB A;  2K6Q A;  4W9G A;  2IO3 B;  4HDO A;  2KMA A;  4BKG A;  3RCZ A;  2ZNV C;  4NQK E;  2LI5 A;  5GMV A;  2K6D B;  3WAN A;  2KWV B;  2FCM A;  2K39 A;  3PHX B;  4CYE A;  5JHA A;  1KLV A;  3DQV A;  2JPH A;  1YQB A;  2ZVN A;  4FJY A;  4A20 A;  4F7Z A;  4DHZ B;  1Q5W B;  2DEN B;  3A1Q A;  3T9L A;  3TL5 A;  2MQJ A;  3UGB B;  3TMP B;  3PVL A;  4DDG D;  2HTH A;  1WGR A;  2L8J A;  3ML9 A;  4MJS A;  2KFJ A;  2FIF A;  2KKC A;  3IHP C;  4FJZ A;  2CR5 A;  1UEL A;  1XD3 B;  3DBH I;  3O65 B;  2K8H A;  2FCS A;  1GNU A;  1I35 A;  2JT4 B;  2KQ7 A;  2UYZ B;  4MSM B;  3OAW A;  1V80 A;  2BKF A;  2MBB B;  1WX7 A;  2LWP A;  3PPA A;  3VHT C;  3M62 B;  2KDE B;  2NBU A;  2KZR A;  4P7I A;  2C5L C;  2NCN A;  4NPN A;  4WJN A;  4EKU A;  4CHK A;  1NDD A;  4MGY E;  1WH3 A;  5DPW A;  4NAW A;  4ZYN A;  1KJT A;  2ZCB A;  5JH5 C;  3PSE B;  1UZX B;  2BKR B;  3QC8 B;  4JL9 A;  1H4R A;  1Q0W B;  1WE7 A;  4MH0 E;  2DZM A;  3EHV A;  2CS4 A;  3PZD A;  3SDL C;  3KVF B;  1P0R A;  2L7R A;  3CF6 E;  4IW0 A;  4G3X B;  4NNJ B;  4TUU A;  1YIW A;  4W9L A;  3QJZ A;  1UBQ A;  4EZK A;  3GOE A;  1E7U A;  3M63 B;  1VD2 A;  1Z2M A;  4JGH B;  4W9J A;  1WXA A;  3RUL A;  3L54 A;  4HCP B;  1UH6 A;  3VUY A;  2MP2 A;  1E8Z A;  2PE9 A;  1H8C A;  4I6P A;  2V1Y A;  3DPD A;  1Q1O A;  4BOS C;  3NZS A;  5LXI B;  3TJP A;  2K8C A;  4LCD E;  3QHT A;  4XX5 A;  2EKE C;  2G4S A;  3QA8 A;  3VAW A;  5D7G A;  3D32 A;  1HE8 A;  1V49 A;  4YL8 A;  4HK2 A;  1KM7 A;  4NJ6 A;  2Z0D B;  4IM3 A;  4AWJ A;  2FUH B;  2MWS B;  2FID A;  2DAJ A;  1E90 A;  1WXV A;  2KO3 A;  4LDT D;  1WJ4 A;  2C9W B;  5AZF A;  1J0G A;  1WX8 A;  2J0M A;  3DCG A;  3VTV A;  1WY8 A;  2N7D A;  3PGE A;  3ZUN A;  2KN5 A;  4BVU C;  2L3Z A;  1WR1 A;  2JXX A;  4IWP A;  2YVC A;  2YLM A;  2CHX A;  2ZPN A;  1P1A A;  1WM3 A;  4HXD A;  5L83 A;  4BOZ B;  2HJ8 A;  1WZ0 A;  4OVV A;  3B08 A;  3WAL A;  2G45 B;  2PE6 B;  2M8S A;  5D6J B;  3V60 A;  2IZV B;  1UGM A;  1NBF C;  2HD5 B;  3A1Q B;  2AWT A;  4GMV A;  1EF5 A;  2EMS A;  4DK5 A;  1AAR A;  1IPG A;  1XT9 B;  2FNJ B;  2LD9 A;  3ZLZ A;  2N9X A;  3T8M A;  1R4N I;  4KSL C;  4HVB A;  2UWQ A;  4B9K A;  2KC1 A;  3U8Z A;  3IFW B;  3PLU A;  2WX1 A;  1T0Y A;  3WAM A;  3W1S A;  1ZKH A;  1WIA A;  4ICU A;  2G4D B;  1V5T A;  3IBE A;  2KVR A;  2RD0 A;  2Z59 B;  3PRP B;  4ZRJ A;  5G2N A;  2V3S A;  4NAW B;  4B95 A;  3NY5 A;  1L2N A;  2CU1 A;  3QQ8 B;  1K8R B;  1E8W A;  2GBK A;  4G0N B;  2C7N B;  4MDK E;  5TR5 A;  3QIJ A;  3DVG Y;  4OVU A;  3RT3 B;  1E5W A;  4KIK A;  2MBH A;  3QAQ A;  4KZ0 A;  4FHJ A;  1TZ1 A;  2QHO A;  2MLB A;  3PTF C;  2JZZ A;  3WAO A;  2JF5 A;  2N9E B;  2REX A;  4MGI E; 
#chains in the Genus database with same CATH topology
 2MP2 B;  3TEX A;  2OHF A;  2D3G A;  2LXA A;  4LNI A;  4WJQ A;  1SGH A;  1V6E A;  1P9D U;  2BTE A;  4YXD B;  2C60 A;  1A5R A;  1YX6 B;  2Y5P A;  4NY0 A;  1FD6 A;  3DVN V;  4LNN A;  2IO1 B;  2LRW A;  4AP4 C;  2ZJD A;  3PS6 A;  2H88 B;  3KH0 A;  1L7Y A;  4M01 A;  5C23 A;  3Q8A A;  2N1W A;  1GOZ A;  2JX5 A;  4NZL B;  1N63 A;  2WXF A;  3IVF A;  1WGY A;  2GBR A;  3ZVV A;  3UIP B;  1WR6 E;  2RMM A;  1FCC C;  4B0M A;  1B1Z A;  3V61 A;  1PYW D;  1SE4 A;  2KAN A;  2LJI A;  4B6W A;  1C9F A;  3AE3 B;  4K3C A;  3OLM D;  5HG2 A;  3QWZ B;  1VR9 A;  3W1S C;  4G11 A;  1UBI A;  1MHH E;  4YTP B;  3RUI B;  2IY1 B;  1R4N B;  1SIF A;  1HZ6 A;  3LDZ E;  3URY A;  3ML8 A;  4E74 A;  5BMI A;  3AU4 A;  3BIN A;  2ICI A;  3RNE C;  2I2Y A;  4KGT A;  2KOX A;  2L76 A;  4P6V F;  2WXQ A;  2BBC A;  3JVZ X;  4M00 A;  2JY6 A;  3NRZ A;  1YJ1 A;  4YSY B;  4HJG E;  1QQR A;  1WE6 A;  3CSF A;  4A9A A;  3Q2A C;  1WSP A;  2O2V A;  2RDH A;  1G6J A;  4PS8 A;  3GZN B;  1QOF A;  1X1M A;  2RGF A;  1C4A A;  1EF1 A;  2W3S A;  3BVZ A;  4K7W A;  2WU2 B;  4ZRQ A;  2LUE A;  4C4V B;  1C76 A;  2NTT A;  3AUL A;  4WQM A;  3VQI A;  3FKY A;  2MH7 A;  1GPX A;  1L4Z B;  5CHW A;  4AJW A;  1WFY A;  4RMA A;  2EMT A;  3ZDT A;  2G1E A;  3R8B A;  4WAF A;  1TY2 A;  4IG7 B;  2DZJ A;  4MSQ B;  4MAC A;  2ZEQ A;  5D3I B;  4RF0 A;  2DZK A;  3PZ8 A;  2MBO A;  4ZHO A;  2AX5 A;  1OEY A;  4WWO A;  1NEN B;  4A90 A;  1UWX A;  2R2O A;  4N9F 4;  1SJE D;  3RI7 C;  2KJH B;  3QX1 A;  1FXA A;  1VJK A;  2KLG A;  1FM0 D;  4W9K A;  3A33 B;  3S2A A;  3IT4 B;  1EWY C;  5BYR A;  4JLC A;  2WS3 B;  2KHW B;  2KK8 A;  1WYW B;  4LNK A;  4CHK A;  2J7Q B;  3V6E B;  2A4Z A;  2CJN A;  1L0Y B;  3EEC A;  3VDZ A;  3N3K B;  1PFD A;  1ZDX A;  1XLN A;  2LHD A;  1U4A A;  3SFE B;  3BZD B;  4O1N A;  4EFO A;  1I4G A;  4C80 A;  2KN4 A;  1DYQ A;  1YNT E;  2WQY B;  4S0R A;  3Q3M C;  3B1L X;  5IAA C;  1ZE3 D;  2WXR A;  4ZHP A;  3U2S C;  1RM6 C;  2PPH A;  1E6E B;  1QIL A;  2WDQ B;  4GDK A;  2ACZ B;  4XDC A;  4YTN B;  5IOI A;  4M8M A;  2PVO D;  3L17 A;  1TS3 A;  1YN4 A;  2ASQ A;  4HPL B;  3HUI A;  1J7A A;  3EUB 2;  1UF0 A;  1XEE A;  2KTR B;  3N1Y C;  4HWI B;  3ALB A;  5FR3 A;  3V62 A;  1F0Z A;  2QSD A;  1V2Y A;  3JSV B;  4AS1 A;  2KX3 A;  1B9R A;  2LJ5 A;  3L13 A;  2L32 A;  4W9C A;  4FXC A;  3NJT A;  1TTN A;  2GRI A;  2BW2 A;  2LVP A;  2JRH A;  1XQQ A;  1FNU A;  4I6N B;  4OZA A;  4FBJ B;  1WMH B;  4KV2 A;  3AE5 B;  3ZKJ C;  4K7U A;  3GP7 A;  5BO4 B;  3I9V 1;  2OJR A;  1DOX A;  2JZ3 B;  3QAR A;  4H2A A;  4HJK A;  4DQO C;  4ITK A;  1S1Q B;  3Q8F A;  3BK1 A;  2K25 A;  2LAS A;  2H89 B;  2XK5 B;  1J19 A;  2DBY A;  2CKH B;  2KJR A;  4HKZ E;  1YX5 B;  3ECI A;  3VRB B;  3CMM B;  2QCZ A;  3TEY A;  4URK A;  1HXY D;  2BYF A;  1I4Q A;  2ONQ A;  4E71 A;  5IN7 A;  3DWM A;  1TKG A;  4IWO A;  4HPM B;  2OOB B;  2DAF A;  4WUR A;  2K6Q A;  1I4H A;  4HDO A;  1VZ7 A;  5H92 C;  4NQK E;  2LI5 A;  5GMV A;  2K6D B;  1SE3 A;  3WAN A;  3V3X A;  2FCM A;  2K39 A;  1TJE A;  3SEB A;  2JPH A;  4F7Z A;  4DHZ B;  1SXT A;  4YSZ B;  3T9L A;  1IGC A;  3PVL A;  3MHZ A;  2WXJ A;  3ML9 A;  3U4E G;  3ZJV A;  1IUE A;  3WCQ A;  2FCS A;  1GNU A;  1XLP A;  3CWI A;  3EFC A;  2LWP A;  3PPA A;  1RFK A;  5JXV A;  1ZUD 2;  2KZR A;  4P7I A;  1ROE A;  1WH3 A;  3DHH C;  1P7F A;  3AMZ A;  1UZX B;  2BKR B;  4JL9 A;  1Q0W B;  1XO3 A;  1R7S A;  3P4Q B;  1WE7 A;  4MH0 E;  2CS4 A;  3SDL C;  2L7R A;  4W9L A;  3QJZ A;  2N9K A;  4LK0 M;  1UBQ A;  1E7U A;  2WDR B;  1Z2M A;  2QJL A;  1HTQ A;  1UH6 A;  2X38 A;  4RGT A;  3ZGZ A;  4XX5 A;  2FBW B;  3VAW A;  3D32 A;  2J4X A;  4ARI A;  2Z0D B;  4IM3 A;  4AWJ A;  5C3J B;  2DAJ A;  2KO3 A;  1WJ4 A;  2C9W B;  2EKI A;  5AZF A;  1FNV A;  4L23 A;  1XCT L;  2N7D A;  3PGE A;  4XE0 A;  4BVU C;  1WR1 A;  2JXX A;  1C78 A;  2YVC A;  2YLM A;  3T3N A;  1P1A A;  1WM3 A;  4HXD A;  2HJ8 A;  4YT0 B;  1WZ0 A;  2Y3A A;  3B08 A;  3WAL A;  3NUH B;  5D6J B;  5C2T B;  1UGM A;  4IDI A;  1E0Z A;  2INP E;  1VLB A;  1PGA A;  2N9X A;  3T8M A;  4HVB A;  2UWQ A;  4B9K A;  3IFW B;  1T0Y A;  1FCL A;  1WIA A;  4ICU A;  2KVR A;  3LYY A;  5GXG B;  2IGH A;  4G0N B;  3QIJ A;  3DVG Y;  4OVU A;  3QAQ A;  2MLB A;  5BYQ A;  3GE8 C;  4MH8 A;  1EWC A;  2JF5 A;  3Q8E A;  4MGI E;  3N20 C;  2AQ1 B;  1WXQ A;  1E8X A;  2KTR A;  3H9D A;  1T0S C;  4KDI C;  5EDS A;  5DPS A;  2ZNV B;  3TEZ A;  4M0W B;  2J52 A;  3FIL B;  1QOA A;  3Q8B A;  4BKS A;  1NI2 A;  3MJW A;  3K9O B;  3U30 A;  2LZ6 A;  2PTL A;  1C79 A;  5HKH A;  2OED A;  1RYJ A;  2I38 A;  3VVW B;  1ET6 A;  2WLB A;  4DXF A;  1WMH A;  2D10 A;  4F1S A;  4WH4 A;  4RNA A;  1WM2 A;  2LGI A;  4JPS A;  1GG3 A;  2L00 B;  3NS1 A;  1KOT A;  2E3T A;  1VRA B;  4FAD A;  1C4P A;  3UI3 A;  1J7B A;  3RPF C;  2DWQ A;  3Q69 A;  3I5J C;  3GE3 C;  1ZDV A;  2WWZ A;  3C19 A;  5L95 C;  2B3A A;  3JW0 X;  4OW0 A;  3AEB B;  2NPT A;  4C56 C;  5BMH A;  2M19 A;  1JWA D;  2KC2 A;  5CHF A;  1V1P A;  4WAA A;  3V6C B;  3SU8 X;  2WXI A;  3DVG X;  3OJ3 A;  4D2K A;  1YQ4 B;  1C1Y B;  2Q5W D;  3H7S A;  3ZNG C;  1L4D B;  3ZJU A;  4HLE A;  1FIQ A;  1SEB D;  4MJS B;  1FNW A;  3RZF A;  3N32 A;  5JHB A;  3VTU A;  4G50 A;  2DZI A;  2ZCC A;  3P4S B;  4ICV A;  5LNK 1;  3U7D A;  3UIO B;  3NVZ A;  3RNB C;  3W5V B;  2ZW0 A;  4EEW A;  1LO5 D;  1RWS A;  1BT0 A;  1OTR B;  2BGF A;  2BS2 B;  1NYR A;  4KZC A;  3NVV A;  2VH1 A;  1E9M A;  1I4P A;  1ZW7 A;  3I3T B;  1OEY J;  3TIX A;  1K53 A;  2KNB A;  3I63 C;  1YJJ A;  3GZN I;  2N7E A;  2IYD B;  1RRB A;  2Y5B B;  4TV3 A;  3IT6 B;  4NAM A;  3A9K A;  1K51 A;  2BQQ A;  2NBW B;  3AEE B;  2O6V A;  2IO2 B;  4K3B A;  4XWT A;  1FFV A;  1FFU A;  1WJN A;  2L05 A;  3N1Z C;  2CHW A;  1KF6 B;  2J0J A;  2V0G A;  3PZ7 A;  1D5Z C;  1CK1 A;  4JQW C;  4FN2 A;  1MHX A;  1I4X A;  1D4B A;  3AEA B;  4ZRK A;  4C7Z A;  4WJP A;  5DPR A;  4DBG A;  2LHE A;  2KFK A;  2NTS A;  3DVN U;  3LXF A;  4DHJ B;  3HRD D;  1OGW A;  2FAZ A;  4ASW C;  5D2M B;  1XLO A;  1T0Q C;  3A4S C;  2DYB A;  4W9E A;  1WGG A;  5FR6 A;  1L6V A;  3TSS A;  1GC7 A;  3UQA A;  4C7Y A;  3M3J A;  3ZIM A;  1T0R C;  2K22 A;  2LRU A;  3H1U A;  4ANU A;  4BBN C;  4PS3 A;  2DLB A;  5IA7 A;  1WGH A;  2IJ0 A;  2ZVO A;  1DOI A;  3KUD B;  3P4R B;  2MW5 A;  2RDG A;  4MGK E;  1KRH A;  4KIK B;  2JWZ A;  2TSS A;  2BS4 B;  2N9L A;  3APC A;  4X57 B;  2WNM A;  4AUQ C;  1V86 A;  5EE9 A;  4AQ7 A;  3T3O A;  1TIF A;  4IM2 A;  3B0A A;  3H8H A;  4DHJ D;  2WXH A;  1T5X D;  1SB3 C;  3ONS A;  3TBL D;  4BFR A;  2MRP A;  4BAX A;  2JQR B;  2HJ1 A;  2INC C;  4BKT A;  1QOB A;  4M0W A;  1V97 A;  1N6Z A;  1DOY A;  1TS4 A;  1I4R A;  3FIL A;  4EZJ A;  1JWM D;  1C77 A;  2WXM A;  2M0X A;  1YQ3 B;  3RD2 A;  4XDD A;  4XZ4 A;  2MCN B;  1MVK A;  1V9J A;  2WDT B;  1WJ6 A;  3ENE A;  2D3B A;  1WYG A;  2V9H A;  4GSW A;  3Q8C A;  3DWG C;  1M94 A;  4K1R B;  1Y56 A;  2AL6 A;  2N4F A;  2J0K A;  5HHD G;  1IYF A;  4YWG G;  2IND C;  3V05 A;  1RLF A;  1ESF A;  2BF8 B;  3RNC C;  4PYZ A;  1ZXI A;  4WJO A;  1WXS A;  4M8N A;  4WWP A;  3DBH B;  2NS5 A;  3NZU A;  3QCA A;  3PV1 A;  1KLU D;  1YMH E;  3E56 A;  3C0R B;  2BYV E;  2LGD A;  3B9J A;  3KYC D;  2BPS A;  2GBJ A;  1JCK B;  5FKA C;  3HHM A;  2M4N A;  1JRU A;  4K7S A;  4XYC A;  3UQB A;  4W9G A;  3RCZ A;  2ZNV C;  1JWU D;  1HA5 A;  2KWV B;  4LTU A;  2ZVN A;  4FJY A;  4A20 A;  1Q5W B;  3ABV B;  2PLP A;  4US9 A;  1WGR A;  4MJS A;  2KFJ A;  4XGA B;  3KWV A;  2CR5 A;  2Z8L A;  5HI1 A;  1XD3 B;  3O65 B;  4LNO A;  2JT4 B;  2KQ7 A;  1F2R I;  2BKF A;  2KDE B;  2KYW A;  2NBU A;  2IGD A;  1KJT A;  5H8Y E;  5JH5 C;  1VZ8 A;  1VDV A;  2QEJ C;  2L52 A;  2KWD A;  3PZD A;  4NNJ B;  1P0R A;  2IDY A;  3C8Y A;  1QT9 A;  3Q3O C;  1EU3 A;  3GOE A;  1N60 A;  1VD2 A;  1NEK B;  3L54 A;  2MP2 A;  3NG0 A;  1E8Z A;  2PE9 A;  1H8C A;  4I6P A;  3DPD A;  1Q1O A;  1D5X C;  3TJP A;  2K8C A;  3QHT A;  4DXG A;  3QA8 A;  1HE8 A;  1KM7 A;  1SE2 A;  1VZ6 A;  2MWS B;  4LDT D;  1L6U A;  4C00 A;  2L1A A;  3DCG A;  1WY8 A;  2KN5 A;  3VRA B;  2D3C A;  3O13 A;  2CHX A;  2ZPN A;  1UUP A;  3EGR A;  3AM9 A;  2M8S A;  3A1Q B;  2AWT A;  4GMV A;  1EF5 A;  2EMS A;  4L1B A;  1AAR A;  4RFB A;  1XT9 B;  2FNJ B;  2LD9 A;  1V1O A;  4KSL C;  2W82 A;  1QF6 A;  2KC1 A;  3U8Z A;  1F52 A;  2WX1 A;  2KAJ A;  2Z59 B;  2RD0 A;  3PRP B;  5G2N A;  4NAW B;  3VR8 B;  2CU1 A;  3QQ8 B;  1K8R B;  1ZOY B;  4KIK A;  1L5P A;  4KZ0 A;  4OZB A;  4FHJ A;  1I7H A;  2JZZ A;  2MEK A;  1NVI D;  1F9J A;  3ZXR A;  1JWS D;  4GIV A;  5G55 A;  4IOI E;  4MM3 B;  4PK1 A;  1R4M B;  3VTW A;  3KUZ A;  2LUM A;  4I6L B;  3B2F A;  2MBQ A;  5DPT A;  4A8X C;  2R61 A;  5CTR C;  2N9P C;  3RFZ B;  1SSN A;  2MBE A;  4ANV A;  2L0T A;  1JAL A;  2KWC A;  4K81 A;  4HRO A;  2V4L A;  3N1X C;  2INN E;  4C4V A;  2JYE A;  3P4P B;  3GB1 A;  5LLI A;  3QK0 A;  2XEW A;  1IP9 A;  4GB9 A;  2BYE A;  1C3T A;  3P1M A;  1PGB A;  2PJH A;  2FCQ A;  3W5U B;  5JZE B;  2LXC A;  1IBX B;  2HTM E;  4JE3 B;  4GDL B;  3WA0 A;  1IGD A;  5C1Z A;  4OZC A;  4KGR A;  2WP9 B;  1BXT A;  2K5P A;  3Q3J A;  4NJ7 A;  4A3O A;  3Q3F A;  5AEK B;  4REZ A;  2D2Q A;  4WWN A;  5MPO A;  2D07 B;  4LNF A;  2BB5 A;  4FHK A;  2KQS A;  4RGO S;  2WXL A;  1EU4 A;  2KAC A;  1CMX B;  2PKO A;  2YEP F;  4ZRP A;  2K8B A;  1BUI C;  2CJO A;  4N58 A;  3OJ4 B;  4ANW A;  3DBL I;  4KSK C;  4FUL A;  5AZG A;  2L0F A;  4DWF A;  1ISN A;  2I1J A;  4A3P A;  3AN1 A;  1MPE A;  4GGQ A;  1MJD A;  2KDI A;  2R2Q A;  4HRS A;  2KDM A;  4EUT A;  2IO0 B;  5HFY A;  1TS5 A;  1TYG B;  3TCA A;  1PGX A;  4EZL A;  1V5O A;  3LJ3 A;  2V4I B;  4P1B C;  2PVG C;  3WIM A;  1ENF A;  1FXT B;  2RSU A;  3AEG B;  2FUG 1;  3MC8 A;  4YTM B;  3K9P B;  5E6N A;  1WXM A;  4M02 A;  3BYY B;  4J6I A;  4BZA A;  2KDF B;  3SD5 A;  4JIO U;  2JRI B;  1RFA A;  3JSV A;  3KYD D;  2LGY A;  2LMC A;  2BWE S;  5IP4 D;  3PRM B;  1K52 A;  3CST A;  1UD7 A;  1TS2 A;  2NVU I;  3R66 C;  4ZDV A;  1UNS A;  3W2D A;  5E6P A;  2JSV X;  2WXN A;  4TSS A;  2XBB C;  1TKE A;  2KVZ A;  2O2V B;  4AJY B;  3M95 A;  3NS8 A;  3NOB A;  2C7M B;  1F1H A;  3WAP A;  2OJW A;  4GU2 A;  3DBR I;  2M56 B;  2I1K A;  2JU6 X;  2WU5 B;  1D5M C;  2KXJ A;  1AWD A;  1N5W A;  3DBL B;  4R3D A;  1WX9 A;  1E7P B;  4IWQ A;  4MEM A;  4TQ0 A;  3B2G A;  4B0E A;  4LJP B;  1C4C A;  3P63 A;  1GJZ A;  3AE6 B;  3VH4 B;  4Q2J A;  3AE4 B;  4FLH A;  1EUV B;  2RPV A;  1T3Q A;  5D94 A;  2GBM A;  1TGZ B;  2XK5 A;  1LM8 B;  2N1V A;  1N5X A;  1J7C A;  4W9H A;  1STE A;  4W9I A;  5D3D A;  3IG3 A;  1V8C A;  3NVY A;  1PUT A;  4MEL A;  2C7H A;  1CQV A;  3R3M A;  2ON8 A;  3HK0 A;  1HZ5 A;  4JX1 C;  2XN9 C;  3ZRF A;  4KVG B;  2AQ3 B;  4TMA B;  2ZPY A;  3ZNI D;  1V81 A;  1P7E A;  4MM3 A;  2SAK A;  3ZRC A;  2LGX A;  4HKQ A;  1N61 A;  1Q10 A;  2D5G A;  2RPQ A;  5J2R A;  3AV8 A;  2LVQ A;  4J3O D;  2N0S B;  1P3Q U;  3PLV A;  2WYQ A;  3Q6B A;  4LJO B;  5KHO A;  3DHG C;  5E6O A;  2BVC A;  1N62 A;  2K9X A;  1OFF A;  4IM0 A;  4NJC A;  4KDL B;  2KT7 A;  3AE2 B;  2PMV A;  3A9J B;  3RMK C;  1QLB B;  1JML A;  4W9F A;  1UGJ A;  4UDU C;  3DBR B;  2JUO A;  3PT2 B;  3BVG A;  1P98 A;  1FRD A;  2NR2 A;  3ZNZ B;  1IBX A;  2BWF A;  4GDL A;  1L0X B;  1TKY A;  2WDV B;  4MGZ E;  2V3N A;  4GDK B;  2BYT A;  3DHI C;  4IKG A;  2KD0 A;  4CO7 A;  1QKZ A;  1F2R C;  2V3P A;  3ZYY X;  2W9N A;  4HCN B;  2GMI C;  3AEC B;  3TUO A;  4XC2 A;  2XNA C;  1KLG D;  4TKN A;  1EO6 A;  1SBB B;  3ZJT A;  1RAX A;  2JWU A;  5FK9 C;  2AYO B;  3MHS D;  2DYM A;  4DXA B;  2IO3 B;  1BML C;  5G5H A;  2K3U A;  2QIE B;  1SJH D;  3DQV A;  1YQB A;  3TL5 A;  3UGB B;  4DDG D;  2HTH A;  2L8J A;  4FJZ A;  1HEZ E;  2GLS A;  1UEL A;  3DBH I;  2WXK A;  2UYZ B;  2PW9 A;  1V80 A;  1WX7 A;  3AE7 B;  4A6Q A;  3M62 B;  2WXG A;  2IGG A;  2C5L C;  2NCN A;  4NPN A;  1NDD A;  3EA6 A;  5DPW A;  4PT5 A;  1SIJ A;  1UWM A;  2ZCB A;  5G5G A;  3ZQ4 A;  1NI3 A;  3PSE B;  4RF1 A;  3EHV A;  4G3X B;  1AN8 A;  3LB8 C;  3M63 B;  4W9J A;  1WXA A;  4HCP B;  2D3A A;  3VUY A;  4N59 A;  2BB6 A;  2G9H D;  4BOS C;  3NZS A;  4JWS C;  2HDE A;  5LXI B;  4LCD E;  1V49 A;  4NJ6 A;  1YJI A;  1E10 A;  3BK2 A;  2FID A;  1WXV A;  1WX8 A;  2LGS A;  3VTV A;  3VR9 B;  4IWP A;  5L83 A;  4BOZ B;  2G45 B;  3AE1 B;  4ARC A;  2PE6 B;  3IAM 1;  1T6B X;  5I4D A;  2IZV B;  2WXO A;  3U52 E;  1JRO A;  3MC0 B;  1AW7 A;  4LLG M;  3PLU A;  3WAM A;  1ZKH A;  3IBE A;  1K50 A;  4B95 A;  3NY5 A;  1L2N A;  2GBK A;  3W9C B;  2C7N B;  1MI0 A;  1XCQ L;  2J42 A;  1LGR A;  1TZ1 A;  5BMG A;  3PTF C;  3WAO A;  2N9E B;  2REX A;  1WWT A;  3H6N A;  2KDB A;  2ZZP B;  3UIN B;  5CX3 A;  4ANX A;  1GUA B;  2K0P A;  2W3R A;  4II2 B;  2IY0 B;  1PDX A;  4ZYS A;  1KFY B;  2LFI A;  1ZXH A;  2Z0E B;  1QOG A;  5J18 A;  2MSE D;  2GI9 A;  4EE2 A;  1LFD A;  4II3 B;  2MX2 A;  4GN1 A;  3PHW B;  3R7Q A;  1D3Z A;  1M4V A;  2DX5 B;  4MT5 A;  2CU3 A;  4RCO A;  4LDT B;  3HM6 X;  3P2B A;  4KX6 B;  1YOV B;  4KGS A;  1FPY A;  1PQS A;  5KHQ A;  3HVZ A;  2UU7 A;  3EC8 A;  2JVC A;  2WGS A;  3A9J A;  3VXW A;  2MJE A;  3L0W B;  3RYT A;  3KUC B;  2CHZ A;  2VRR B;  4S17 A;  2PEA A;  1R4M I;  5TSS A;  3H7P B;  3DDC B;  4OHJ A;  3ZTC A;  4QAY A;  1YD8 U;  5EE1 A;  4KKJ A;  1CJE A;  4RGN A;  3APD A;  1WRD B;  3JYU A;  4DDI D;  3PRZ A;  2QIL A;  2HE7 A;  3SR6 A;  2Y5C A;  4N6E B;  3MTN B;  3RN9 C;  3P42 A;  3N30 A;  1WRI A;  1MG8 A;  4E3C A;  3MJ5 A;  1ET9 A;  2GBN A;  3MFG A;  3ZDM C;  3DOW A;  3I57 A;  2AQ2 B;  2M1M A;  2WXP A;  2JZP A;  3KW5 B;  4GXB A;  3KWL A;  1XF5 L;  3RZW C;  5EE3 A;  4NQL B;  3J9C A;  1CZP A;  1WF9 A;  3L10 B;  5CHV C;  5AUI A;  1OQY A;  1TBE A;  1ZP0 B;  5AZH A;  4DHZ E;  1ZGU B;  3R2T A;  3ZXV A;  3FC4 A;  2KX0 A;  3EFU A;  4IC7 B;  3HM3 A;  2QDF A;  1OQQ A;  2D11 A;  3SFD B;  3TEW A;  4OVZ A;  2K1F A;  1FEH A;  3HIZ A;  1SF0 A;  4F8C B;  3NVW A;  1XLQ A;  4USA A;  4BKS D;  2NBV B;  3AB5 A;  3APF A;  2FCN A;  4WQO B;  1WI0 A;  1QZE A;  1VCB A;  2VH2 A;  2IPK D;  2EEL A;  2NPT B;  3L4P A;  3BY4 B;  2X8X X;  3X23 A;  2G3Q B;  1V1P B;  4HPP A;  3VUX A;  4PS7 A;  1J8C A;  2KJ6 A;  3BWU D;  3BYT B;  1NYQ A;  4HEA 1;  5IKC M;  4HDQ A;  2DYO A;  1LQB A;  3RNF C;  4BBN F;  4W9D A;  3ZNH B;  4YSX B;  3AH7 A;  1TZO A;  3VH3 B;  4WWM A;  4GOC A;  3ZO5 B;  4ZRI A;  4FA6 A;  1E8Y A;  1WJU A;  4US8 A;  1GC6 A;  3RNA C;  1WZ3 A;  2W55 A;  1JQ4 A;  2KQ4 X;  4JWU C;  2AL3 A;  1E7V A;  2M0A A;  2E6X A;  2KLC A;  3X0W A;  4PYU A;  3R2I A;  1WGD A;  4RM9 A;  3ETR A;  2WHI A;  3W1Y A;  1ZPS A;  3L08 A;  1HTO A;  1Y8R C;  4P16 A;  3ZW3 A;  1DGJ A;  3R7R A;  4KKI A;  2A5U A;  2AEH A;  1MFW A;  3A4R A;  5J17 A;  3DBS A;  3PRE A;  3A9K B;  4TQ1 A;  3UF8 A;  3HVD A;  1F77 A;  2VZK B;  1SE9 A;  2O6V B;  1YN5 A;  5AUK A;  3L16 A;  2BS3 B;  2DHZ A;  3MC9 A;  4P1C C;  1I42 A;  1GB4 A;  2L83 A;  2YEP B;  4GLS C;  1XXG A;  4FJV B;  1S3S G;  3IXS A;  3AED B;  2MHJ A;  2KFK B;  4RGM A;  5DCN A;  2MA9 B;  2QC8 A;  5LXH A;  3Q3N C;  3AXC A;  4A55 A;  4AOF A;  2IBI B;  3CIR B;  2KWU B;  1D6E C;  1GAQ B;  3ZTD A;  2LEK A;  3AI5 A;  4IUM B;  5IO9 A;  2KMC A;  2LVO A;  1Z5S B;  1HQR D;  3U7Z A;  2WX0 A;  4RM8 A;  2VZK D;  3AU5 A;  3MP9 A;  2O6V D;  3Q14 C;  2JXT A;  3VFK A;  1JWB D;  2GOW A;  3BVM A;  3H7P A;  2M17 A;  3VUW A;  2NMQ A;  1FRR A;  5BYS A;  1LXD A;  3SHQ A;  2ZW1 A;  4EOY A;  2RR9 A;  3AE9 B;  3BII D;  2KTF A;  3NHE B;  1FO4 A;  2KMA A;  4BKG A;  3N9Y C;  3FAH A;  2W54 A;  3E9S A;  2SEB D;  3PHX B;  4CYE A;  5JHA A;  1KLV A;  1FXI A;  2PIA A;  2DEN B;  3A1Q A;  3PO0 A;  2MQJ A;  3TMP B;  5T8I A;  2FIF A;  2KKC A;  3IHP C;  2K8H A;  1I35 A;  4MSM B;  1OQR A;  3OAW A;  2MBB B;  2J53 A;  3VHT C;  1TT5 B;  3NZ3 A;  4L2Y A;  4WJN A;  4EKU A;  4MGY E;  4NAW A;  1A70 A;  3AE8 B;  4ZYN A;  2KMM A;  3QC8 B;  1H4R A;  3KLS X;  2DZM A;  3KVF B;  3CF6 E;  4IW0 A;  1JW9 D;  4TUU A;  1YIW A;  4EZK A;  4WIP A;  4RH6 A;  3OWE B;  4JGH B;  4ZOH C;  3RUL A;  4ACF A;  2V1Y A;  3AEF B;  2EKE C;  2G4S A;  5D7G A;  5EE0 A;  5E6J A;  4YL8 A;  4HK2 A;  2FUH B;  3GS2 A;  1E90 A;  1J0G A;  2J0M A;  3ZUN A;  2B76 B;  2L3Z A;  4XWW A;  2GB1 A;  2MJ3 A;  1GB1 A;  3RNG C;  2FE8 A;  4OVV A;  4CQN A;  1EM7 A;  3V60 A;  2MJD A;  1L0V B;  1NBF C;  2HD5 B;  4DK5 A;  1IPG A;  2RDB C;  3IAS 1;  2N7J A;  3ZLZ A;  1KTK A;  1FMA D;  1YN3 A;  3OG5 A;  1MG4 A;  1AYF A;  1R4N I;  1KH0 A;  1WGK A;  1ACC A;  2QMT A;  3W1S A;  2JYT A;  2G4D B;  1V5T A;  4ZRJ A;  2V3S A;  1E8W A;  2BT6 A;  4MDK E;  5TR5 A;  3RT3 B;  1E5W A;  1TY0 A;  2DNF A;  2MBH A;  2QHO A;  3KQ4 A;  1JRP A; 
#chains in the Genus database with same CATH homology
 2MP2 B;  1E8X A;  3H6N A;  2D3G A;  2KTR A;  2KDB A;  2LXA A;  2ZZP B;  3UIN B;  1F9J A;  5CX3 A;  4WJQ A;  4ANX A;  4GIV A;  1GUA B;  3H9D A;  5G55 A;  1SGH A;  4II2 B;  4KDI C;  5EDS A;  1V6E A;  2IY0 B;  2ZNV B;  5DPS A;  3VTW A;  3KUZ A;  1P9D U;  4M0W B;  4I6L B;  2C60 A;  4BKS A;  1A5R A;  1NI2 A;  2MBQ A;  5DPT A;  2Z0E B;  3MJW A;  3K9O B;  5J18 A;  2MSE D;  1YX6 B;  3U30 A;  4NY0 A;  5CTR C;  2LZ6 A;  2N9P C;  1LFD A;  3DVN V;  4II3 B;  2MX2 A;  2MBE A;  4GN1 A;  4ANV A;  2L0T A;  5HKH A;  2IO1 B;  2KWC A;  2LRW A;  4K81 A;  4AP4 C;  2ZJD A;  3PS6 A;  3PHW B;  3VVW B;  2V4L A;  3R7Q A;  3KH0 A;  1L7Y A;  5C23 A;  1D3Z A;  1WMH A;  2DX5 B;  2D10 A;  2N1W A;  4F1S A;  4LDT B;  3HM6 X;  3P2B A;  5LLI A;  3QK0 A;  2XEW A;  3IVF A;  1WGY A;  1IP9 A;  1WM2 A;  4GB9 A;  2GBR A;  3ZVV A;  3UIP B;  1WR6 E;  1PQS A;  5KHQ A;  2BYE A;  1C3T A;  2PJH A;  3EC8 A;  1GG3 A;  2FCQ A;  2JVC A;  3A9J A;  3V61 A;  2KAN A;  3VXW A;  2L00 B;  4B6W A;  3L0W B;  1KOT A;  3RYT A;  5JZE B;  3KUC B;  3OLM D;  2LXC A;  4FAD A;  3QWZ B;  2CHZ A;  4GDL B;  3W1S C;  4G11 A;  3WA0 A;  1UBI A;  2VRR B;  2PEA A;  1R4M I;  5C1Z A;  3H7P B;  3DDC B;  3RUI B;  2IY1 B;  3Q3J A;  1SIF A;  4NJ7 A;  3ZTC A;  1YD8 U;  3Q3F A;  4A3O A;  3LDZ E;  5AEK B;  3ML8 A;  4E74 A;  2D2Q A;  3AU4 A;  2WWZ A;  3APD A;  4WWN A;  1WRD B;  3JYU A;  3BIN A;  2D07 B;  5L95 C;  2B3A A;  3JW0 X;  4DDI D;  2NPT A;  2KOX A;  2L76 A;  3PRZ A;  4FHK A;  3JVZ X;  2JY6 A;  2HE7 A;  2KQS A;  2KC2 A;  5CHF A;  3MTN B;  1YJ1 A;  4WAA A;  1CMX B;  3V6C B;  2K8B A;  3SU8 X;  1WE6 A;  3CSF A;  3N30 A;  3OJ4 B;  1MG8 A;  4ANW A;  4E3C A;  3DVG X;  2GBN A;  3DBL I;  3ZDM C;  3DOW A;  3OJ3 A;  4KSK C;  4FUL A;  2O2V A;  1C1Y B;  5AZG A;  2M1M A;  2L0F A;  4DWF A;  3H7S A;  4PS8 A;  1G6J A;  1ISN A;  3KW5 B;  2I1J A;  3ZNG C;  4A3P A;  4GXB A;  1X1M A;  2RGF A;  4HLE A;  1EF1 A;  4GGQ A;  4MJS B;  3RZF A;  3N32 A;  4K7W A;  5JHB A;  3VTU A;  4G50 A;  2DZI A;  2ZCC A;  4ICV A;  3RZW C;  4NQL B;  2LUE A;  3U7D A;  2KDI A;  1WF9 A;  3UIO B;  3L10 B;  3AUL A;  5CHV C;  2R2Q A;  3VQI A;  1OQY A;  1TBE A;  5AZH A;  4DHZ E;  4EUT A;  1ZGU B;  2IO0 B;  5CHW A;  2KX0 A;  1WFY A;  4AJW A;  4EEW A;  3EFU A;  4IC7 B;  3HM3 A;  3TCA A;  1BT0 A;  4RMA A;  2D11 A;  2EMT A;  3ZDT A;  4EZL A;  1V5O A;  1OTR B;  3LJ3 A;  2BGF A;  4KZC A;  2K1F A;  3HIZ A;  4IG7 B;  1ZW7 A;  3I3T B;  2DZJ A;  1OEY J;  3WIM A;  4F8C B;  3TIX A;  4MSQ B;  2ZEQ A;  1FXT B;  2RSU A;  4BKS D;  2NBV B;  2DZK A;  3APF A;  2FCN A;  4WQO B;  2KNB A;  1WI0 A;  3K9P B;  5E6N A;  1WXM A;  1QZE A;  2MBO A;  3GZN I;  4J6I A;  2KDF B;  1VCB A;  3SD5 A;  4JIO U;  2JRI B;  1RFA A;  2N7E A;  1OEY A;  4WWO A;  3JSV A;  2IYD B;  3KYD D;  1RRB A;  2LGY A;  2NPT B;  2Y5B B;  4TV3 A;  2R2O A;  2BWE S;  4N9F 4;  3A9K A;  3BY4 B;  3PRM B;  2NBW B;  3X23 A;  2KJH B;  3CST A;  2G3Q B;  1UD7 A;  3QX1 A;  2O6V A;  2IO2 B;  2NVU I;  3R66 C;  4ZDV A;  3VUX A;  2KLG A;  4PS7 A;  5E6P A;  1WJN A;  1J8C A;  2L05 A;  2KJ6 A;  2CHW A;  2J0J A;  4W9K A;  3A33 B;  2XBB C;  3S2A A;  4JQW C;  4FN2 A;  4ZRK A;  4HDQ A;  2O2V B;  4WJP A;  5DPR A;  4AJY B;  4DBG A;  2DYO A;  3M95 A;  2KFK A;  1LQB A;  3NOB A;  3NS8 A;  2C7M B;  3DVN U;  4JLC A;  3WAP A;  2KHW B;  2KK8 A;  1WYW B;  4DHJ B;  1OGW A;  4BBN F;  4GU2 A;  4W9D A;  2J7Q B;  2FAZ A;  2I1K A;  2A4Z A;  3DBR I;  5D2M B;  3V6E B;  3ZNH B;  4ASW C;  3A4S C;  3EEC A;  3VDZ A;  3N3K B;  2KXJ A;  2DYB A;  4W9E A;  3VH3 B;  1WGG A;  1U4A A;  1WX9 A;  4IWQ A;  4GOC A;  4MEM A;  5FR6 A;  4TQ0 A;  1GC7 A;  3ZO5 B;  4LJP B;  3UQA A;  4ZRI A;  4FA6 A;  3M3J A;  1E8Y A;  1WJU A;  3VH4 B;  3ZIM A;  1GJZ A;  4FLH A;  4EFO A;  1GC6 A;  1EUV B;  2LRU A;  1WZ3 A;  3H1U A;  4ANU A;  2AL3 A;  4BBN C;  1E7V A;  5D94 A;  2GBM A;  4PS3 A;  5IA7 A;  1WGH A;  2KLC A;  1TGZ B;  3X0W A;  2ZVO A;  3B1L X;  2XK5 A;  5IAA C;  1LM8 B;  2N1V A;  3KUD B;  2PPH A;  2MW5 A;  4W9H A;  4GDK A;  4MGK E;  4PYU A;  4KIK B;  1WGD A;  4M8M A;  2JWZ A;  4W9I A;  4RM9 A;  3APC A;  4X57 B;  4AUQ C;  1V86 A;  3L17 A;  3IG3 A;  3W1Y A;  3L08 A;  2ASQ A;  4HPL B;  1Y8R C;  4MEL A;  2C7H A;  4IM2 A;  3ZW3 A;  3B0A A;  3R3M A;  2KTR B;  3R7R A;  4DHJ D;  4HWI B;  3ALB A;  3HK0 A;  2A5U A;  2AEH A;  3V62 A;  3ZRF A;  3A4R A;  1V2Y A;  3JSV B;  3ONS A;  2KX3 A;  4KVG B;  3TBL D;  3DBS A;  2LJ5 A;  2ZPY A;  3L13 A;  3ZNI D;  3PRE A;  1V81 A;  5J17 A;  3A9K B;  4TQ1 A;  4W9C A;  3UF8 A;  4BFR A;  2MRP A;  1SE9 A;  4MM3 A;  4BKT A;  2O6V B;  1TTN A;  3ZRC A;  2LGX A;  3L16 A;  2DHZ A;  2LVP A;  4EZJ A;  1I42 A;  2RPQ A;  5J2R A;  2JRH A;  1XQQ A;  4FJV B;  1S3S G;  2LVQ A;  2M0X A;  1P3Q U;  3PLV A;  2WYQ A;  4I6N B;  4LJO B;  5KHO A;  3RD2 A;  4FBJ B;  1WMH B;  2KFK B;  4KV2 A;  5E6O A;  3ZKJ C;  4XZ4 A;  2MA9 B;  5DCN A;  4K7U A;  2MCN B;  5BO4 B;  5LXH A;  4IM0 A;  1V9J A;  2WDT B;  1WJ6 A;  3ENE A;  4KDL B;  2OJR A;  4GSW A;  3AXC A;  4AOF A;  2IBI B;  2JZ3 B;  2KWU B;  3A9J B;  3QAR A;  4HJK A;  3ZTD A;  3AI5 A;  1M94 A;  4IUM B;  4W9F A;  2KMC A;  2LVO A;  4K1R B;  2AL6 A;  1Z5S B;  2JUO A;  1S1Q B;  2J0K A;  2N4F A;  3PT2 B;  2WX0 A;  1P98 A;  4RM8 A;  1IYF A;  3ZNZ B;  2NR2 A;  2K25 A;  2LAS A;  1RLF A;  2BWF A;  3AU5 A;  2BF8 B;  4GDL A;  2O6V D;  3VFK A;  2XK5 B;  1J19 A;  4MGZ E;  4PYZ A;  2GOW A;  2CKH B;  3H7P A;  2KJR A;  4GDK B;  2M17 A;  4WJO A;  1WXS A;  1YX5 B;  3ECI A;  4M8N A;  4WWP A;  3VUW A;  2NS5 A;  3NZU A;  4CO7 A;  1LXD A;  2KD0 A;  3QCA A;  3SHQ A;  3CMM B;  3PV1 A;  3C0R B;  2W9N A;  2BYV E;  4HCN B;  4EOY A;  2GMI C;  2LGD A;  4URK A;  2RR9 A;  3KYC D;  2BYF A;  4XC2 A;  4E71 A;  2BPS A;  2GBJ A;  4TKN A;  1EO6 A;  3HHM A;  4IWO A;  1RAX A;  4HPM B;  2M4N A;  1JRU A;  2AYO B;  3MHS D;  2KTF A;  2DYM A;  2OOB B;  4K7S A;  2DAF A;  3NHE B;  4DXA B;  3UQB A;  2K6Q A;  4W9G A;  2IO3 B;  4HDO A;  2KMA A;  4BKG A;  3RCZ A;  2ZNV C;  4NQK E;  2LI5 A;  5GMV A;  2K6D B;  3WAN A;  2KWV B;  2FCM A;  2K39 A;  3PHX B;  4CYE A;  5JHA A;  1KLV A;  3DQV A;  2JPH A;  1YQB A;  2ZVN A;  4FJY A;  4A20 A;  4F7Z A;  4DHZ B;  1Q5W B;  2DEN B;  3A1Q A;  3T9L A;  3TL5 A;  2MQJ A;  3UGB B;  3TMP B;  3PVL A;  4DDG D;  2HTH A;  1WGR A;  2L8J A;  3ML9 A;  4MJS A;  2KFJ A;  2FIF A;  2KKC A;  3IHP C;  4FJZ A;  2CR5 A;  1UEL A;  1XD3 B;  3DBH I;  3O65 B;  2K8H A;  2FCS A;  1GNU A;  1I35 A;  2JT4 B;  2KQ7 A;  2UYZ B;  4MSM B;  3OAW A;  1V80 A;  2BKF A;  2MBB B;  1WX7 A;  2LWP A;  3PPA A;  3VHT C;  3M62 B;  2KDE B;  2NBU A;  2KZR A;  4P7I A;  2C5L C;  2NCN A;  4NPN A;  4WJN A;  4EKU A;  4CHK A;  1NDD A;  4MGY E;  1WH3 A;  5DPW A;  4NAW A;  4ZYN A;  1KJT A;  2ZCB A;  5JH5 C;  3PSE B;  1UZX B;  2BKR B;  3QC8 B;  4JL9 A;  1H4R A;  1Q0W B;  1WE7 A;  4MH0 E;  2DZM A;  3EHV A;  2CS4 A;  3PZD A;  3SDL C;  3KVF B;  1P0R A;  2L7R A;  3CF6 E;  4IW0 A;  4G3X B;  4NNJ B;  4TUU A;  1YIW A;  4W9L A;  3QJZ A;  1UBQ A;  4EZK A;  3GOE A;  1E7U A;  3M63 B;  1VD2 A;  1Z2M A;  4JGH B;  4W9J A;  1WXA A;  3RUL A;  3L54 A;  4HCP B;  1UH6 A;  3VUY A;  2MP2 A;  1E8Z A;  2PE9 A;  1H8C A;  4I6P A;  2V1Y A;  3DPD A;  1Q1O A;  4BOS C;  3NZS A;  5LXI B;  3TJP A;  2K8C A;  4LCD E;  3QHT A;  4XX5 A;  2EKE C;  2G4S A;  3QA8 A;  3VAW A;  5D7G A;  3D32 A;  1HE8 A;  1V49 A;  4YL8 A;  4HK2 A;  1KM7 A;  4NJ6 A;  2Z0D B;  4IM3 A;  4AWJ A;  2FUH B;  2MWS B;  2FID A;  2DAJ A;  1E90 A;  1WXV A;  2KO3 A;  4LDT D;  1WJ4 A;  2C9W B;  5AZF A;  1J0G A;  1WX8 A;  2J0M A;  3DCG A;  3VTV A;  1WY8 A;  2N7D A;  3PGE A;  3ZUN A;  2KN5 A;  4BVU C;  2L3Z A;  1WR1 A;  2JXX A;  4IWP A;  2YVC A;  2YLM A;  2CHX A;  2ZPN A;  1P1A A;  1WM3 A;  4HXD A;  5L83 A;  4BOZ B;  2HJ8 A;  1WZ0 A;  4OVV A;  3B08 A;  3WAL A;  2G45 B;  2PE6 B;  2M8S A;  5D6J B;  3V60 A;  2IZV B;  1UGM A;  1NBF C;  2HD5 B;  3A1Q B;  2AWT A;  4GMV A;  1EF5 A;  2EMS A;  4DK5 A;  1AAR A;  1IPG A;  1XT9 B;  2FNJ B;  2LD9 A;  3ZLZ A;  2N9X A;  3T8M A;  1R4N I;  4KSL C;  4HVB A;  2UWQ A;  4B9K A;  2KC1 A;  3U8Z A;  3IFW B;  3PLU A;  2WX1 A;  1T0Y A;  3WAM A;  3W1S A;  1ZKH A;  1WIA A;  4ICU A;  2G4D B;  1V5T A;  3IBE A;  2KVR A;  2RD0 A;  2Z59 B;  3PRP B;  4ZRJ A;  5G2N A;  2V3S A;  4NAW B;  4B95 A;  3NY5 A;  1L2N A;  2CU1 A;  3QQ8 B;  1K8R B;  1E8W A;  2GBK A;  4G0N B;  2C7N B;  4MDK E;  5TR5 A;  3QIJ A;  3DVG Y;  4OVU A;  3RT3 B;  1E5W A;  4KIK A;  2MBH A;  3QAQ A;  4KZ0 A;  4FHJ A;  1TZ1 A;  2QHO A;  2MLB A;  3PTF C;  2JZZ A;  3WAO A;  2JF5 A;  2N9E B;  2REX A;  4MGI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...