1V6EA

Solution structure of a n-terminal ubiquitin-like domain in mouse tubulin-specific chaperone b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGVMVFISSSLNSFRSEKRYSRSLTIAEFKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a N-terminal Ubiquitin-like Domain in Mouse Tubulin-specific Chaperone B
rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords cytoskeleton-associated protein 1
total genus 10
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v6eA01
4NQKE 2KWCA 4JGHB 3WA0A 4GDKA 5JZEB 4CHKA 2PJHA 3KUZA 5DCNA 2L00B 1GC6A 2DZMA 2MBQA 1MG8A 2N9XA 4FHJA 1I42A 1UZXB 2CHWA 5LXHA 1ISNA 2KFKB 3NZSA 4I6PA 2IY1B 3H7PA 5CHWA 4A3OA 2GBMA 4BBNF 4TKNA 1WIAA 3SD5A 2UWQA 3DOWA 4BKTA 4EZJA 2CKHB 2JZZA 2RSUA 1V80A 4J6IA 4W9KA 2KZRA 3A1QB 2XEWA 3DVNU 3EHVA 4K1RB 3A1QA 1V2YA 3VUXA 2KDIA 3VTUA 3CSFA 4BFRA 4LDTB 4RM9A 3R66C 4DWFA 3ONSA 3AI5A 2C9WB 4HK2A 2GBRA 3DPDA 2BWFA 2LZ6A 2V3SA 2Z0DB 2KK8A 1YX6B 5KHQA 2G3QB 2MCNB 1IYFA 4W9CA 4ZRIA 4DHJB 4G3XB 3PSEB 1ZW7A 4NPNA 4ANXA 2K6DB 1R4NI 3JSVA 2QHOA 1YX5B 1J19A 3N30A 4BVUC 3SU8X 4EEWA 1WM2A 2NS5A 3QX1A 3RCZA 3CF6E 1KJTA 3NY5A 2D07B 1LXDA 2MBEA 1RFAA 3DCGA 2NCNA 3MJWA 3O65B 4MM3A 3TCAA 2ZJDA 1C3TA 3K9OB 3M3JA 5DPRA 3TJPA 3DQVA 4EFOA 3ALBA 2AL3A 3T9LA 1AARA 1UBQA 4HDOA 1WX8A 3U8ZA 1ZGUB 3ZDMC 3APCA 4BKGA 3IBEA 4CO7A 3KH0A 4HDQA 3DVGX 5JHAA 1E7VA 1Z2MA 2KD0A 2BF8B 2ZNVC 3KYCD 1KLVA 3WANA 3HM6X 4MGYE 1S3SG 2BKFA 1Y8RC 4OVVA 5L95C 4LJPB 3PZDA 2JT4B 3B08A 2JPHA 4W9FA 3RYTA 2NBVB 4EZLA 5D94A 1WM3A 3ZTDA 3HHMA 3PLVA 2FIFA 4DHJD 3GOEA 3LJ3A 5G55A 2KOXA 3ZIMA 5EDSA 2PEAA 2HJ8A 3VDZA 1WR6E 4W9IA 4NY0A 2K6QA 3NHEB 1YQBA 4GXBA 3WALA 2NBUA 4AWJA 4BKSA 1WX7A 4FBJB 1G6JA 2FCMA 2I1KA 2LUEA 3H7SA 4IM3A 3WAMA 4EZKA 4ZDVA 4KDIC 3L0WB 4K7UA 4ANUA 2MLBA 4XX5A 3DBLI 1WH3A 3A9JA 2DZJA 4TUUA 1WR1A 4BKSD 2RPQA 3DBRI 2LVPA 3ML8A 3PHXB 1J8CA 2BKRB 2MQJA 1GNUA 2LRUA 1E90A 1E8YA 2JVCA 3SHQA 2LXCA 4F1SA 4FN2A 4AP4C 2JF5A 1TTNA 2G4SA 4II3B 2KMCA 3UINB 4HCPB 4MGZE 3IHPC 2DAFA 4AJYB 3OJ3A 3UGBB 2KDEB 2WYQA 2M8SA 1WYWB 2N7EA 3U7DA 2O2VB 4JQWC 4PS3A 3TL5A 5FR6A 1V6EA 2JRIB 2KWVB 2AEHA 2NPTB 3A4SC 1A5RA 3RT3B 4EUTA 3QARA 4HLEA 3U30A 1Q0WB 3A33B 2PE9A 1NDDA 2GBJA 2N4FA 3V62A 4EKUA 3H9DA 3QQ8B 2V4LA 4HXDA 4ZYNA 5LLIA 4DHZE 4GOCA 5J17A 2R2OA 2WX0A 4LDTD 2KANA 4ICVA 1WXAA 1QZEA 3V61A 2D10A 4NJ7A 3ZW3A 2KKCA 4MJSB 2JWZA 4AOFA 1P0RA 4A3PA 3L54A 1EUVB 1WJUA 1H4RA 2AL6A 3JVZX 4GU2A 4AUQC 4DBGA 2LASA 3MHSD 2LGDA 3RD2A 2KNBA 4BBNC 2KTRB 4KZCA 4F8CB 4KIKB 4W9EA 4TQ0A 2N1WA 4GB9A 3APFA 1FXTB 2M1MA 1WF9A 3K9PB 5E6OA 4E74A 4ZRJA 4N9F4 1XD3B 2CHXA 2MW5A 1GC7A 2ZZPB 2ZCCA 1RAXA 1OEYJ 4GDLB 1F9JA 2KJHB 2KTFA 3AXCA 4FHKA 5E6NA 2HTHA 3H7PB 4IM2A 3PTFC 3VAWA 3W1SA 4TV3A 2CR5A 3QAQA 2DX5B 4IWOA 5IAAC 2G45B 3P2BA 4HVBA 3KYDD 3UF8A 4MGKE 1L2NA 2KX0A 1IP9A 1JRUA 2W9NA 3IVFA 1OTRB 1WJ6A 2DAJA 1LM8B 3R7QA 2KLCA 2HD5B 4JL9A 2GMIC 2V1YA 3KVFB 1YD8U 2KX3A 2L76A 4XC2A 2MP2A 1OQYA 1NBFC 2KVRA 2DYMA 4AJWA 1V5TA 4K7WA 1UBIA 3M95A 1VCBA 1V5OA 3NZUA 2C7HA 3PGEA 3NOBA 4ANVA 2NPTA 4K7SA 1R4MI 3D32A 3VH4B 2KDFB 1E8XA 5IA7A 1UGMA 2KO3A 1WGYA 2OJRA 3VUYA 3ZNZB 1WJNA 4W9GA 2I1JA 2KFJA 2ZCBA 2MWSB 2MRPA 4G0NB 3VTVA 2GBKA 3EECA 4I6LB 2N1VA 3S2AA 3ZDTA 3CSTA 1UD7A 1WI0A 1M94A 1WGHA 1WZ0A 2DENB 2ZNVB 4LJOB 4F7ZA 3L08A 2J7QB 2MP2B 2O6VB 2K1FA 1EF1A 1OEYA 1OGWA 4FLHA 2ASQA 5AZFA 3ZRFA 1E8WA 4RMAA 3PHWB 2NVUI 2K39A 2L0TA 3ZO5B 4PYUA 1Z5SB 1WX9A 2LRWA 3V6CB 3AU5A 2AWTA 4PS8A 4URKA 4WWOA 4MSMB 4DDID 2BGFA 1IPGA 3QJZA 1WJ4A 4FULA 1V9JA 2ZEQA 1XQQA 2BPSA 2M4NA 3TBLD 4WJOA 1GJZA 3LDZE 5D2MB 1I35A 3B1LX 5HKHA 3R3MA 4GDLA 4E3CA 2KC2A 3HIZA 5G2NA 3MTNB 4MGIE 4FJYA 1NI2A 4PS7A 3W1YA 2K8CA 2R2QA 2UYZB 4W9HA 2J0MA 2FAZA 1WE7A 3SDLC 4XZ4A 1WXVA 1E5WA 2AYOB 2ZPYA 3PLUA 4FJVB 2GOWA 2L3ZA 3KUDB 3WAPA 1XT9B 3RZWC 3PREA 2IY0B 2KTRA 2FNJB 2MBOA 3EC8A 3JW0X 3QC8B 4I6NB 1X1MA 2NR2A 2IYDB 3VUWA 3NS8A 4BOZB 3DBHI 3JYUA 4W9LA 2MBBB 4BOSC 5AZHA 5D7GA 3OAWA 3RULA 3ZUNA 4FJZA 5DPWA 4WQOB 3ML9A 4WJNA 2LI5A 2K25A 4B95A 2XK5B 1WMHB 2IO0B 2KQSA 2DZIA 2BYEA 2JUOA 4IUMB 4KV2A 4FADA 1WFYA 3ZRCA 3Q3JA 3V6EB 1Q5WB 3GZNI 5C23A 1V49A 5D6JB 3QA8A 2C5LC 2G4DB 3UQBA 1J0GA 1LFDA 2CHZA 2JZ3B 3AULA 3ZKJC 4EOYA 2LD9A 2LWPA 2N7DA 4GDKB 3VFKA 4E71A 2WWZA 4MJSA 2O6VD 3PT2B 4IC7B 1TZ1A 4GN1A 2XK5A 3ZNHB 1GG3A 5DPSA 2KQ7A 4NNJB 2O6VA 2OOBB 5DPTA 3ZNID 2Z59B 3PRZA 3N32A 3JSVB 1KOTA 3WIMA 1RLFA 2B3AA 1EF5A 3QWZB 3ZLZA 3VTWA 2L0FA 3ZNGC 2FCNA 5E6PA 4DDGD 1H8CA 1P3QU 3OLMD 4M8MA 2YVCA 3APDA 3PRMB 4NQLB 5J2RA 4W9DA 2DYOA 1SE9A 4GGQA 3DVNV 1P1AA 2BYVE 1YJ1A 3PV1A 2IBIB 5C1ZA 1WXSA 3TMPB 3A9KA 4B9KA 2C7MB 2FCQA 1PQSA 3BINA 3PPAA 2WDTB 3H6NA 3QK0A 4JIOU 2LVOA 2IZVB 5AEKB 4IWQA 3ENEA 4KVGB 1L7YA 1D3ZA 4HJKA 1S1QB 4ICUA 3A4RA 4DK5A 1V81A 1LQBA 1T0YA 2MBHA 4PYZA 1E7UA 2M17A 2MX2A 4GIVA 2C7NB 4DHZB 3A9JB 2PPHA 3DBSA 2KFKA 3KW5B 3VVWB 2J0JA 1P98A 2XBBC 4KIKA 2EMSA 4KDLB 4GMVA 2IO3B 1TGZB 2J0KA 3UQAA 3OJ4B 2IO1B 4OVUA 3T8MA 1RRBA 4G11A 4NAWA 2D11A 5KHOA 1GUAB 1WMHA 4IWPA 3N3KB 1SIFA 2EMTA 1WRDB 4II2B 3TIXA 2KHWB 4ASWC 2KXJA 4NAWB 1SGHA 2DYBA 1BT0A 4MSQB 2YLMA 4GSWA 4A20A 2M0XA 5J18A 2FCSA 2IO2B 2N9EB 2LJ5A 4LCDE 4P7IA 3VH3B 2L7RA 4HCNB 2BWES 4WJQA 2Y5BB 4NJ6A 4X57B 4DXAB 5JHBA 1CMXB 3ZVVA 3VQIA 1KM7A 5CHVC 3DDCB 2RGFA 3V60A 2MSED 3ZTCA 3WAOA 1WGGA 2JXXA 5GMVA 5L83A 1Q1OA 2CS4A 2DHZA 2REXA 4HPLB 4HPMB 1WXMA 2LGXA 4M8NA 1E8ZA 1YIWA 2KDBA 3I3TB 3PVLA 2KMAA 3M62B 3HM3A 2KWUB 2VRRB 2Z0EB 4K81A 1EO6A 2JY6A 2ZVNA 4WWNA 4B6WA 3Q3FA 3QCAA 2CU1A 4ANWA 2LXAA 2N9PC 3VHTC 2L8JA 3IG3A 4JLCA 1WGDA 4KSLC 1UH6A 4CYEA 4MH0E 5BO4B 2ZPNA 2KJRA 3B0AA 3ECIA 2C60A 3QIJA 1ZKHA 1TBEA 4G50A 1K8RB 4WJPA 2A5UA 3AU4A 5AZGA 2O2VA 2KLGA 5JH5C 2EKEC 3M63B 2HE7A 3VXWA 3C0RB 5CTRC 2D2QA 3BY4B 4KSKC 4FA6A 3X0WA 2RR9A 2GBNA 1WGRA 1VD2A 3RZFA 2K8HA 3X23A 4RM8A 2FUHB 2BYFA 2L05A 3W1SC 1C1YB 2PE6B 5CX3A 4YL8A 1UELA 2JRHA 3IFWB 3L13A 2WX1A 3L10B 2LGYA 3L16A 2ZVOA 4HWIB 1V86A 2KN5A 2LVQA 3RUIB 1WZ3A 2K8BA 4WWPA 4TQ1A 4ZRKA 2A4ZA 3L17A 1P9DU 4W9JA 1WE6A 3UIPB 2DZKA 4WAAA 1U4AA 3KUCB 3PS6A 2RD0A 5CHFA 4IW0A 4KZ0A 3EFUA 3CMMB 1WY8A 2MA9B 4M0WB 5TR5A 3UIOB 2FIDA 3H1UA 3A9KB 5LXIB 3HK0A 2D3GA 3DVGY 4IM0A 3QHTA 4MELA 4MDKE 4MEMA 2NBWB 4IG7B 3R7RA 3PRPB 1HE8A 2KJ6A 2KC1A
chains in the Genus database with same CATH superfamily
1JQ4A 2KWCA 3WA0A 1J7CA 2MBQA 1GC6A 2DZMA 1KFYB 2N9XA 4FHJA 3TUOA 1UZXB 4I6PA 4BBNF 2H88B 3DOWA 1YN3A 3R8BA 1V80A 2GB1A 1KH0A 3EHVA 2J4XA 2PVGC 3VUXA 2KDIA 4BFRA 3DBLB 2WXMA 4RGOS 2GBRA 2KDMA 2Z0DB 1JWSD 2H89B 1YX6B 2G3QB 3OWEB 3PSEB 1ZW7A 4NPNA 4ANXA 1R4NI 2MEKA 4ZHPA 4C7ZA 4BVUC 3QX1A 3RCZA 1FMAD 2D07B 1LXDA 2KT7A 2MBEA 3WCQA 1C3TA 4C80A 2W3RA 3IAS1 1D4BA 3TJPA 4EFOA 2HDEA 2WXPA 4BKGA 3APCA 5JHAA 1E7VA 2ZNVC 3PO0A 5L95C 1Q10A 3PZDA 2JT4B 3ZTDA 1EU4A 4KGSA 2IPKD 3GOEA 3Q14C 5G55A 4W9IA 4NY0A 4HRSA 3AE1B 3WALA 4BKSA 1WX7A 1G6JA 2I1KA 2MLBA 4BKSD 4WQMA 2MQJA 2LRUA 1E90A 1E8YA 1V1PB 4WH4A 3SHQA 4II3B 3VRBB 4MGZE 3RNCC 4AJYB 3OJ3A 3UGBB 2KDEB 2WYQA 2M8SA 3IAM1 3AEDB 4JQWC 2KWVB 1ENFA 4EUTA 4HLEA 1Q0WB 1L6VA 2WXQA 3BK1A 3HUIA 3V62A 4EKUA 2WP9B 3QQ8B 4HXDA 1TS2A 1F77A 1CZPA 3GS2A 4GOCA 2R2OA 4LDTD 2KANA 1N62A 4NJ7A 1IBXB 4A3PA 4GU2A 4C7YA 2LASA 2LGDA 1ZE3D 4KZCA 4F8CB 4W9EA 3N20C 2M1MA 3K9PB 4PT5A 1C4CA 5E6OA 5C2TB 1XD3B 2CHXA 4NZLB 2ZCCA 2IGHA 4GDLB 4FHKA 4AQ7A 3VR9B 3EFCA 1L0YB 4MGKE 3IVFA 2WNMA 1LM8B 2BB6A 4OZCA 1FCLA 5IN7A 1SF0A 2V1YA 5HFYA 2L76A 4XC2A 2N0SB 1OQYA 1NBFC 4DQOC 3AN1A 2KVRA 4OVZA 2GI9A 1UBIA 3M95A 1TS4A 3PGEA 2G9HD 3D32A 1KLGD 2RMMA 1E8XA 1WGYA 2OJRA 4IDIA 4P16A 3ZNZB 2HTME 1I4HA 1YJJA 3TEXA 2I1JA 2MWSB 2N1VA 1UD7A 2ZNVB 3BWUD 4LJOB 4F7ZA 3P42A 2J7QB 3PHWB 2NVUI 1AWDA 2QSDA 2D5GA 3V6CB 3DHIC 2NTTA 2ZEQA 1GJZA 2BPSA 4WJOA 3LDZE 3R3MA 4E3CA 4MACA 3MTNB 4PS7A 1VDVA 2K8CA 2J0MA 4HKZE 1QOBA 3SDLC 4YWGG 3U2SC 1WXVA 3FILB 1ZOYB 2ZPYA 3R2IA 2L3ZA 3WAPA 1MHXA 4OW0A 1I4QA 5AZHA 3AB5A 4NAMA 3ZUNA 2PVOD 4WQOB 3ML9A 4WJNA 2LI5A 3AE6B 1TT5B 2XK5B 1YJIA 1BXTA 4YSZB 2MJ3A 2IO0B 2BYEA 4KV2A 1WFYA 3ZRCA 2WXHA 5HG2A 5C23A 5D6JB 1DYQA 2CHZA 5JXVA 3ZGZA 3VFKA 4E71A 4IC7B 1N5WA 2XK5A 3ZNHB 2AQ2B 4NNJB 2OOBB 4HPPA 4WWMA 3ZNID 2Z59B 2CU3A 2WXRA 3N32A 3TSSA 3B9JA 5MPOA 4NQLB 2DYOA 1SBBB 1P1AA 1YJ1A 4N58A 1WXSA 1F1HA 2VH1A 4TMAB 2L32A 2FE8A 4KVGB 1L7YA 3T3NA 2M17A 1GPXA 4DHZB 3A9JB 1T3QA 1KRHA 2KFKA 3VVWB 2Y5CA 4KIKA 4N6EB 1XLNA 2IO3B 2IO1B 4L2YA 2D11A 1WMHA 5EE1A 3URYA 3N3KB 3AE8B 1SIFA 3NZ3A 4P6VF 2PLPA 1ACCA 3IT6B 4M0WA 2KAJA 2ZW1A 3RFZB 5BYRA 2L7RA 4HCNB 4YTNB 1D6EC 3VQIA 2WDRB 5CHVC 2RGFA 3Q8FA 3V60A 3BYTB 1C9FA 2JXXA 1V1PA 1WXMA 4M8NA 3DWMA 2KMAA 4K81A 1E9MA 1KLUD 3RN9C 1EO6A 4WWNA 4B6WA 3VHTC 4O1NA 4KSLC 4CYEA 3ECIA 1QOFA 2C60A 1VZ6A 4WJPA 5AZGA 5C3JB 2KLGA 2D3BA 2BQQA 5CTRC 2XNAC 1WSPA 2GBNA 4RM8A 2OHFA 2PE6B 1UELA 1UWXA 4HWIB 3ZJTA 4P1BC 5E6JA 2SEBD 1FRDA 1U4AA 3PS6A 2DLBA 5CHFA 4KZ0A 3EFUA 3UIOB 4YSYB 4CQNA 4MEMA 1R4NB 4IG7B 3RPFC 2KJ6A 1XLQA 4NQKE 5JZEB 4CHKA 3ZXVA 2PJHA 3KUZA 2WXLA 2N9LA 3LYYA 4C4VB 4B0MA 1FFVA 2KFKB 1EWCA 5CHWA 1MI0A 2IY1B 4TKNA 4EZJA 4W9KA 1PDXA 3A1QA 2E6XA 1V2YA 3VTUA 1D5XC 4LDTB 4DWFA 3AI5A 4HK2A 4S0RA 2KK8A 1AN8A 1IYFA 4DHJB 4RH6A 4G3XB 2BS2B 2ZW0A 3N30A 3AE3B 4EEWA 1WM2A 3MJWA 2M19A 3TCAA 3M3JA 5DPRA 1IUEA 1B1ZA 1UBQA 2CJOA 4US8A 3MP9A 4JX1C 1C79A 4NJCA 2PW9A 1VR9A 3IBEA 4HDQA 1R4MB 2KD0A 2BF8B 1KLVA 1FCCC 4MGYE 4OVVA 4LJPB 2WXOA 4OHJA 2JPHA 3HVDA 3PZ8A 3PLVA 4DHJD 1L0VB 3NHEB 1YQBA 2QMTA 1ZPSA 4ZDVA 3H7SA 4ANUA 3DBLI 1WH3A 3A9JA 4TUUA 1SJED 4M01A 4XDDA 2JVCA 4ARCA 2LXCA 2I38A 4F1SA 4AP4C 2G4SA 2KMCA 4JWUC 4HCPB 2BVCA 2CJNA 4IKGA 1F0ZA 2JRIB 1L5PA 3AV8A 3A4SC 3QARA 1GB1A 4D2KA 1DGJA 3H9DA 4ZYNA 2V4LA 2INPE 1JALA 1DOXA 4ICVA 4EE2A 2D10A 2FBWB 4MJSB 4AOFA 2JXTA 3ZYYX 3W5UB 1P0RA 3L54A 3JVZX 4AUQC 4DBGA 3MHSD 4ARIA 2KNBA 4BBNC 2KTRB 4TQ0A 4GB9A 3BVZA 5TSSA 3APFA 1FXTB 1GOZA 4ZRJA 4ACFA 3MC9A 5T8IA 2MW5A 1GC7A 2ZZPB 5BMIA 1XCQL 1F9JA 1IGDA 5E6NA 2BT6A 2B76B 2HTHA 4IM2A 4JE3B 1TY2A 2CR5A 2DX5B 5HI1A 3W5VB 3P2BA 4XWWA 1L2NA 4PK1A 2KX0A 1IP9A 2W9NA 1SE4A 2WU5B 4JL9A 5HHDG 5D3DA 1YD8U 2KX3A 2GLSA 2HJ1A 1STEA 5BYSA 4M02A 2X38A 1V5TA 2WDVB 1VCBA 3NZUA 3KLSX 1YMHE 4K3CA 1HZ5A 1R4MI 3VH4B 1NI3A 1UGMA 2KO3A 3BIID 1NENB 2KFJA 2MRPA 4G0NB 3ZDTA 2QILA 4B0EA 2WS3B 1M94A 1WZ0A 2MP2B 2O6VB 4WURA 5AZFA 1E8WA 4RMAA 2WLBA 3ZO5B 4PYUA 2LRWA 3AU5A 3VRAB 2AWTA 4PS8A 3FILA 4DDID 2M0AA 3QJZA 1V9JA 4WIPA 2M4NA 3TBLD 5D2MB 3B1LX 5HKHA 2KC2A 3HIZA 1NI2A 1TIFA 4W9HA 3Q8AA 2FAZA 3B2GA 2PIAA 2WXFA 3RZWC 3Q2AC 3PREA 2IY0B 2FNJB 3RMKC 2IYDB 4DXGA 3JYUA 4W9LA 1SSNA 3CIRB 1HXYD 1DOIA 5D7GA 3OAWA 3KQ4A 1RM6C 4WAFA 2INCC 2Y5PA 4FJZA 1MHHE 1KF6B 3CWIA 3GE3C 4B95A 2IJ0A 3AE4B 1WMHB 1T0RC 2DZIA 4IUMB 4YTMB 4FADA 5LNK1 3Q3JA 3NG0A 3BK2A 1V49A 3HRDD 2C5LC 1J0GA 1GAQB 3GZNB 1JWAD 2JZ3B 3ZKJC 4EOYA 2LD9A 2LWPA 2N7DA 4GDKB 1ESFA 2WWZA 4MJSA 2MJDA 2O6VD 1YQ4B 3DWGC 4GN1A 1HEZE 1K53A 5DPSA 2KQ7A 1SB3C 2O6VA 1HA5A 1E10A 1FXIA 1T0QC 3JSVB 4XWTA 2DWQA 4RF1A 2L0FA 2V3PA 4DDGD 1H8CA 1P3QU 2YVCA 3PRMB 5J2RA 1SE9A 2BYVE 3PV1A 2IBIB 2ON8A 5C1ZA 2MJEA 3TMPB 1NYQA 3BINA 3PPAA 3H6NA 5AEKB 2IZVB 2TSSA 3ENEA 4HJKA 4ICUA 4DK5A 1LQBA 2MBHA 2YEPB 1UNSA 4PYZA 2MX2A 2C7NB 1ZXHA 3DBSA 1P98A 3BVGA 1T6BX 2W54A 1RRBA 4G11A 1K50A 1GUAB 4YXDB 1QT9A 4IWPA 1MG4A 1N63A 2KXJA 3NVVA 1JRPA 1BT0A 1SJHD 2YLMA 4GSWA 4A20A 2M0XA 2N9EB 3VH3B 3O13A 3TEWA 4DXAB 4ZYSA 5JHBA 1CMXB 3GP7A 1WGGA 3MC8A 3EGRA 1D5ZC 3Q8CA 3PVLA 2KDBA 2NMQA 2RDHA 3M62B 3HM3A 2VRRB 1AW7A 2Z0EB 1MJDA 1FXAA 2ZVNA 2JY6A 3Q3FA 3QCAA 4ANWA 2N9PC 2L8JA 1WGDA 1YNTE 2ZPNA 1TBEA 2A5UA 3C0RB 4IOIE 2D2QA 4XGAB 4KSKC 4FA6A 3X0WA 4RGTA 1TYGB 1WGRA 3RNFC 3RZFA 3X23A 3BVMA 1A70A 3W1SC 1VJKA 4USAA 4YL8A 2JRHA 5G5HA 2J52A 3L10B 2ZVOA 4K3BA 3HVZA 1V86A 2EELA 3RUIB 2K8BA 4ITKA 4ZRKA 2A4ZA 2PTLA 4W9JA 4A9AA 3CMMB 1WY8A 2MA9B 4M0WB 3A9KB 3SFEB 4XDCA 2YEPF 3DVGY 4MDKE 1B9RA 1L0XB 2KC1A 4JGHB 3N1ZC 1TS5A 3P1MA 5DCNA 4LNNA 1MG8A 1V97A 1I42A 2CHWA 5LXHA 1ISNA 3NZSA 1ET6A 2GBMA 1WIAA 4BKTA 1QILA 2RSUA 4J6IA 3B2FA 2XEWA 3CSFA 4KGTA 4KGRA 3ZXRA 1FIQA 3C19A 3IT4B 2JWUA 2XN9C 5KHQA 4LNIA 1F52A 2MCNB 4W9CA 4ZRIA 4OZAA 2K6DB 3JSVA 2QHOA 1YX5B 1J19A 3SU8X 3E56A 1E7PB 2NS5A 1QF6A 4BZAA 5J18A 1RFAA 3TEYA 2NCNA 1BUIC 4MH8A 3K9OB 2VZKD 1ZDXA 3DQVA 3ALBA 1PGAA 3T9LA 1AARA 4HDOA 1ZGUB 3Q8BA 3ZDMC 4MT5A 4CO7A 3KH0A 3N1YC 1GB4A 5AUKA 1Z2MA 3KYCD 3WANA 3HM6X 1QQRA 1J7BA 1Y56A 5D94A 1WM3A 3HHMA 2FIFA 1XCTL 3GB1A 1ZP0B 3LJ3A 1YOVB 4GLSC 2HJ8A 5H92C 1WR6E 3VDZA 2K6QA 1N60A 4AWJA 2FCMA 3WAMA 4IM3A 4EZKA 4KDIC 4XX5A 2DZJA 3N1XC 1WR1A 2RPQA 3DBRI 3ML8A 4FXCA 1GNUA 4FN2A 2JF5A 1CJEA 2N7EA 2O2VB 4PS3A 4ZRQA 2JSVX 1SEBD 3RT3B 4XYCA 3NVYA 3U30A 1DOYA 5FR3A 3A33B 2PE9A 1MVKA 1JMLA 2GBJA 2N4FA 1XEEA 2JYEA 4DHZE 2X8XX 3AH7A 3V61A 4A55A 3ZW3A 1NVID 1MPEA 1H4RA 1JW9D 4L23A 5IP4D 3RD2A 1QLBB 4ZRPA 2WHIA 1TKGA 1I4GA 4C00A 4E74A 4DXFA 3NRZA 1OEYJ 1J7AA 2KJHB 1FNVA 1L4DB 1T5XD 3PTFC 3VAWA 3W1SA 1E6EB 4TV3A 3QAQA 4TSSA 4IWOA 1HTQA 2G45B 4A90A 3KYDD 1PUTA 3UF8A 1BMLC 1WJ6A 2HD5B 2INDC 3KVFB 3ABVB 1NEKB 2LUMA 4AJWA 2DBYA 1V5OA 3NUHB 4H2AA 4ANVA 2NPTA 4HKQA 2KDFB 4S17A 1SE2A 1I4PA 2L83A 4W9GA 1C4AA 1V8CA 2ZCBA 1YQ3B 5EE9A 3VTVA 1JWUD 3S2AA 1N61A 4HROA 3CSTA 1TJEA 2SAKA 1WI0A 2Q5WD 1WGHA 2DENB 1QOGA 2V0GA 3L08A 2K1FA 2JZPA 4XE0A 1VZ8A 2LHEA 2L0TA 1RWSA 1Z5SB 1WX9A 3DBRB 2KYWA 2Z8LA 4URKA 3BYYB 2BGFA 1IPGA 2QC8A 1WJ4A 4FULA 3P4SB 1XQQA 1I35A 2OJWA 2GRIA 5FKAC 2QCZA 3AM9A 5G2NA 4FJYA 4A6QA 3W1YA 4XZ4A 1JROA 1HZ6A 3U7ZA 3PLUA 2AYOB 4FJVB 1WYGA 2GOWA 3KUDB 1HQRD 1HTOA 3QC8B 3EC8A 3JW0X 2NR2A 3NVWA 3VUWA 3NS8A 2K9XA 3DBHI 1I4RA 1UF0A 2EKIA 2L1AA 2LGSA 3RULA 1AYFA 3U4EG 4MM3B 2LMCA 5EE3A 2WXNA 2WQYB 1XLOA 2UU7A 1XO3A 2BYTA 2V3NA 2KQSA 2JUOA 2V4IB 1XXGA 1Q5WB 3GZNI 1TKYA 3UQBA 1LFDA 2D3CA 3AULA 2E3TA 2WXJA 1TZ1A 4JPSA 2K5PA 1GG3A 3NVZA 3AE9B 1KOTA 3WIMA 4RF0A 2AQ3B 3RI7C 3QWZB 3ZLZA 3R2TA 2FCNA 3OLMD 4M8MA 3GE8C 4W9DA 1FNWA 3DVNV 2WXKA 1PGBA 2W82A 2FCQA 2WDTB 3QK0A 2LVOA 1D3ZA 4KKIA 1K52A 3A4RA 1T0YA 1E7UA 4C4VA 1V1OA 4YT0B 3RNEC 2PPHA 3KW5B 3RNBC 1I4XA 3KWVA 2EMSA 4KDLB 4GMVA 2J0KA 5FK9C 3T8MA 4NAWA 5GXGB 5KHOA 1FO4A 2EMTA 5IO9A 2KHWB 1ET9A 4ASWC 2ONQA 4MSQB 2KVZA 2FCSA 2IO2B 1YN5A 4LCDE 4JWSC 4P7IA 3Q69A 2BWES 2G1EA 4WJQA 2W55A 2NTSA 4RFBA 4OZBA 3ZVVA 1KM7A 3ZTCA 3WAOA 4REZA 2WXIA 5GMVA 5I4DA 5L83A 1Q1OA 2LFIA 2REXA 4HPLB 1FD6A 4HPMB 2LGXA 1E8ZA 1YIWA 3I3TB 2KWUB 2PKOA 1RYJA 4JLCA 3H8HA 3AEGB 3B0AA 3QIJA 2D3AA 3AU4A 4L1BA 1R7SA 3RNAC 2EKEC 3VXWA 4LTUA 2K8HA 3Q3NC 2BYFA 2L05A 2N9KA 1C1YB 5CX3A 2BS4B 4J3OD 5EE0A 2LGYA 2LVQA 2M56B 1WZ3A 4TQ1A 1P9DU 2VH2A 2DZKA 2WXGA 3UIPB 4C56C 2RD0A 1IBXA 2W3SA 3UI3A 3IXSA 3ZJVA 5LXIB 2MHJA 2D3GA 4IM0A 1N5XA 3AECB 1PFDA 1FPYA 4GDKA 2L00B 1FNUA 3I57A 4A3OA 3H7PA 3DHGC 3SD5A 2UWQA 2CKHB 2JZZA 2BS3B 2KZRA 3A1QB 4K1RB 3DVNU 3FAHA 4RM9A 3R66C 3ONSA 2C9WB 3DPDA 2BWFA 2LZ6A 2V3SA 1C4PA 1EWYC 1IGCA 3Q6BA 3AMZA 1FFUA 2BW2A 2J42A 3I63C 3CF6E 1KJTA 3N9YC 3NY5A 3DCGA 4MM3A 1OFFA 3O65B 2WGSA 2ZJDA 3SR6A 2AL3A 1WX8A 3U8ZA 3L4PA 2JX5A 3DVGX 3VR8B 2QIEB 1S3SG 2BKFA 1Y8RC 3FC4A 3AE7B 3B08A 4W9FA 2ICIA 3RYTA 2NBVB 4EZLA 3AEFB 2VZKB 2KOXA 3ZIMA 5EDSA 2PEAA 1NYRA 2LEKA 2N7JA 4GXBA 2NBUA 4FBJB 3DBHB 2L52A 2LUEA 3L0WB 4K7UA 1J8CA 2LVPA 3PHXB 1L4ZB 3EUB2 2BKRB 1L6UA 1TTNA 3AEAB 1C78A 1CQVA 3UINB 2IGGA 2INNE 3IHPC 2DAFA 5BMGA 4ZHOA 1VRAB 1EM7A 2KN4A 1WYWB 3U7DA 3TL5A 5FR6A 1UWMA 1V6EA 2IDYA 2AEHA 4BAXA 2NPTB 1A5RA 1FRRA 1QKZA 1NDDA 3MHZA 5D3IB 1XLPA 3V3XA 5LLIA 2BTEA 3NS1A 5J17A 2WX0A 3MJ5A 1WXAA 1QZEA 4LK0M 4LNKA 1VLBA 2KMMA 1FEHA 3ETRA 2KKCA 2JWZA 4HEA1 1EUVB 1WJUA 2AL6A 4KIKB 2N1WA 1WF9A 1C76A 4N9F4 2Y3AA 1OQQA 1RFKA 1TS3A 3E9SA 1RAXA 1OQRA 2KTFA 3AXCA 1FM0D 5BMHA 3H7PB 3P63A 1K51A 5IAAC 5IOIA 3SEBA 4HVBA 1ROEA 2JQRB 5AUIA 1JRUA 1OTRB 2DAJA 3R7QA 2KLCA 3AE5B 1XF5L 2GMIC 1WXQA 2MP2A 4N59A 2DYMA 3P4RB 4M00A 3AE2B 3J9CA 4K7WA 2C7HA 3T3OA 3NOBA 4K7SA 1MFWA 5IA7A 3FKYA 2KACA 4Q2JA 3VUYA 1WJNA 2BBCA 2ACZB 3NJTA 2GBKA 3EECA 4I6LB 2QDFA 1TZOA 1UGJA 2RDGA 1EF1A 1OEYA 1OGWA 4FLHA 2ASQA 3ZRFA 2FUG1 2K39A 3LXFA 2AQ1B 4WWOA 4MSMB 1WWTA 3ZJUA 4GDLA 4MGIE 2PMVA 3W2DA 2R2QA 2UYZB 4AS1A 2WDQB 1TY0A 1WE7A 4HJGE 1E5WA 4LNFA 1XT9B 2KTRA 2K0PA 2MBOA 4I6NB 1X1MA 4RGNA 4BOZB 2MBBB 4BOSC 2K22A 4A8XC 3DHHC 5DPWA 2K25A 3SFDB 3U52E 2V9HA 1PGXA 1PYWD 3V6EB 3P4QB 2BB5A 1ZXIA 3QA8A 2G4DB 4QAYA 1YN4A 1VZ7A 3PT2B 2MH7A 5BYQA 1JWBD 3PZ7A 3MFGA 5DPTA 4YSXB 1CK1A 3PRZA 2DNFA 2JYTA 3AEEB 1RLFA 2B3AA 1EF5A 3ZNGC 3VTWA 5E6PA 3APDA 3LB8C 4GGQA 3BZDB 1C77A 4LLGM 3A9KA 4B9KA 2C7MB 1PQSA 1EU3A 2JU6X 4JIOU 4IWQA 3MC0B 1P7EA 1S1QB 2QJLA 1V81A 1M4VA 3KWLA 4GIVA 3OG5A 4ZOHC 2LGIA 2J0JA 4RGMA 2XBBC 1TKEA 3Q3OC 2AX5A 1TGZB 2K3UA 3UQAA 3OJ4B 4OVUA 1D5MC 5IKCM 4RNAA 4KX6B 1JCKB 1SIJA 1WRDB 4II2B 3TIXA 4KKJA 4NAWB 2J53A 1QOAA 1ZDVA 3V05A 1SGHA 3RNGC 2DYBA 3Q3MC 1LO5D 2LJ5A 1I7HA 3P4PB 1P7FA 1T0SC 2Y5BB 4NJ6A 3C8YA 4X57B 2KQ4X 1WGKA 3DDCB 1JWMD 2MSED 2CS4A 4UDUC 1WRIA 2DHZA 1SXTA 4LNOA 2KWDA 1SE3A 2IGDA 1UUPA 3Q8EA 2CU1A 1ZUD2 2LXAA 2RDBC 3IG3A 3I9V1 3AEBB 4RCOA 1UH6A 4MH0E 5BO4B 2KJRA 1ZKHA 4G50A 1K8RB 1KTKA 3EA6A 2O2VA 5JH5C 3M63B 2HE7A 2WU2B 2LJIA 3BY4B 3ZQ4A 2RR9A 5G5GA 1VD2A 2FUHB 2I2YA 4YTPB 1F2RC 4R3DA 3IFWB 1F2RI 3L13A 2WX1A 3L16A 2KN5A 1N6ZA 4WWPA 4P1CC 2QEJC 3L17A 1WE6A 4WAAA 2OEDA 1E0ZA 3KUCB 4IW0A 2RPVA 2LHDA 5TR5A 5H8YE 2FIDA 3H1UA 4US9A 3HK0A 4MELA 3I5JC 3QHTA 3W9CB 1LGRA 2NBWB 3R7RA 3PRPB 2R61A 1HE8A 3TEZA
chains in the Genus database with same CATH topology
4NQKE 2KWCA 4JGHB 3WA0A 4GDKA 5JZEB 4CHKA 2PJHA 3KUZA 5DCNA 2L00B 1GC6A 2DZMA 2MBQA 1MG8A 2N9XA 4FHJA 1I42A 1UZXB 2CHWA 5LXHA 1ISNA 2KFKB 3NZSA 4I6PA 2IY1B 3H7PA 5CHWA 4A3OA 2GBMA 4BBNF 4TKNA 1WIAA 3SD5A 2UWQA 3DOWA 4BKTA 4EZJA 2CKHB 2JZZA 2RSUA 1V80A 4J6IA 4W9KA 2KZRA 3A1QB 2XEWA 3DVNU 3EHVA 4K1RB 3A1QA 1V2YA 3VUXA 2KDIA 3VTUA 3CSFA 4BFRA 4LDTB 4RM9A 3R66C 4DWFA 3ONSA 3AI5A 2C9WB 4HK2A 2GBRA 3DPDA 2BWFA 2LZ6A 2V3SA 2Z0DB 2KK8A 1YX6B 5KHQA 2G3QB 2MCNB 1IYFA 4W9CA 4ZRIA 4DHJB 4G3XB 3PSEB 1ZW7A 4NPNA 4ANXA 2K6DB 1R4NI 3JSVA 2QHOA 1YX5B 1J19A 3N30A 4BVUC 3SU8X 4EEWA 1WM2A 2NS5A 3QX1A 3RCZA 3CF6E 1KJTA 3NY5A 2D07B 1LXDA 2MBEA 1RFAA 3DCGA 2NCNA 3MJWA 3O65B 4MM3A 3TCAA 2ZJDA 1C3TA 3K9OB 3M3JA 5DPRA 3TJPA 3DQVA 4EFOA 3ALBA 2AL3A 3T9LA 1AARA 1UBQA 4HDOA 1WX8A 3U8ZA 1ZGUB 3ZDMC 3APCA 4BKGA 3IBEA 4CO7A 3KH0A 4HDQA 3DVGX 5JHAA 1E7VA 1Z2MA 2KD0A 2BF8B 2ZNVC 3KYCD 1KLVA 3WANA 3HM6X 4MGYE 1S3SG 2BKFA 1Y8RC 4OVVA 5L95C 4LJPB 3PZDA 2JT4B 3B08A 2JPHA 4W9FA 3RYTA 2NBVB 4EZLA 5D94A 1WM3A 3ZTDA 3HHMA 3PLVA 2FIFA 4DHJD 3GOEA 3LJ3A 5G55A 2KOXA 3ZIMA 5EDSA 2PEAA 2HJ8A 3VDZA 1WR6E 4W9IA 4NY0A 2K6QA 3NHEB 1YQBA 4GXBA 3WALA 2NBUA 4AWJA 4BKSA 1WX7A 4FBJB 1G6JA 2FCMA 2I1KA 2LUEA 3H7SA 4IM3A 3WAMA 4EZKA 4ZDVA 4KDIC 3L0WB 4K7UA 4ANUA 2MLBA 4XX5A 3DBLI 1WH3A 3A9JA 2DZJA 4TUUA 1WR1A 4BKSD 2RPQA 3DBRI 2LVPA 3ML8A 3PHXB 1J8CA 2BKRB 2MQJA 1GNUA 2LRUA 1E90A 1E8YA 2JVCA 3SHQA 2LXCA 4F1SA 4FN2A 4AP4C 2JF5A 1TTNA 2G4SA 4II3B 2KMCA 3UINB 4HCPB 4MGZE 3IHPC 2DAFA 4AJYB 3OJ3A 3UGBB 2KDEB 2WYQA 2M8SA 1WYWB 2N7EA 3U7DA 2O2VB 4JQWC 4PS3A 3TL5A 5FR6A 1V6EA 2JRIB 2KWVB 2AEHA 2NPTB 3A4SC 1A5RA 3RT3B 4EUTA 3QARA 4HLEA 3U30A 1Q0WB 3A33B 2PE9A 1NDDA 2GBJA 2N4FA 3V62A 4EKUA 3H9DA 3QQ8B 2V4LA 4HXDA 4ZYNA 5LLIA 4DHZE 4GOCA 5J17A 2R2OA 2WX0A 4LDTD 2KANA 4ICVA 1WXAA 1QZEA 3V61A 2D10A 4NJ7A 3ZW3A 2KKCA 4MJSB 2JWZA 4AOFA 1P0RA 4A3PA 3L54A 1EUVB 1WJUA 1H4RA 2AL6A 3JVZX 4GU2A 4AUQC 4DBGA 2LASA 3MHSD 2LGDA 3RD2A 2KNBA 4BBNC 2KTRB 4KZCA 4F8CB 4KIKB 4W9EA 4TQ0A 2N1WA 4GB9A 3APFA 1FXTB 2M1MA 1WF9A 3K9PB 5E6OA 4E74A 4ZRJA 4N9F4 1XD3B 2CHXA 2MW5A 1GC7A 2ZZPB 2ZCCA 1RAXA 1OEYJ 4GDLB 1F9JA 2KJHB 2KTFA 3AXCA 4FHKA 5E6NA 2HTHA 3H7PB 4IM2A 3PTFC 3VAWA 3W1SA 4TV3A 2CR5A 3QAQA 2DX5B 4IWOA 5IAAC 2G45B 3P2BA 4HVBA 3KYDD 3UF8A 4MGKE 1L2NA 2KX0A 1IP9A 1JRUA 2W9NA 3IVFA 1OTRB 1WJ6A 2DAJA 1LM8B 3R7QA 2KLCA 2HD5B 4JL9A 2GMIC 2V1YA 3KVFB 1YD8U 2KX3A 2L76A 4XC2A 2MP2A 1OQYA 1NBFC 2KVRA 2DYMA 4AJWA 1V5TA 4K7WA 1UBIA 3M95A 1VCBA 1V5OA 3NZUA 2C7HA 3PGEA 3NOBA 4ANVA 2NPTA 4K7SA 1R4MI 3D32A 3VH4B 2KDFB 1E8XA 5IA7A 1UGMA 2KO3A 1WGYA 2OJRA 3VUYA 3ZNZB 1WJNA 4W9GA 2I1JA 2KFJA 2ZCBA 2MWSB 2MRPA 4G0NB 3VTVA 2GBKA 3EECA 4I6LB 2N1VA 3S2AA 3ZDTA 3CSTA 1UD7A 1WI0A 1M94A 1WGHA 1WZ0A 2DENB 2ZNVB 4LJOB 4F7ZA 3L08A 2J7QB 2MP2B 2O6VB 2K1FA 1EF1A 1OEYA 1OGWA 4FLHA 2ASQA 5AZFA 3ZRFA 1E8WA 4RMAA 3PHWB 2NVUI 2K39A 2L0TA 3ZO5B 4PYUA 1Z5SB 1WX9A 2LRWA 3V6CB 3AU5A 2AWTA 4PS8A 4URKA 4WWOA 4MSMB 4DDID 2BGFA 1IPGA 3QJZA 1WJ4A 4FULA 1V9JA 2ZEQA 1XQQA 2BPSA 2M4NA 3TBLD 4WJOA 1GJZA 3LDZE 5D2MB 1I35A 3B1LX 5HKHA 3R3MA 4GDLA 4E3CA 2KC2A 3HIZA 5G2NA 3MTNB 4MGIE 4FJYA 1NI2A 4PS7A 3W1YA 2K8CA 2R2QA 2UYZB 4W9HA 2J0MA 2FAZA 1WE7A 3SDLC 4XZ4A 1WXVA 1E5WA 2AYOB 2ZPYA 3PLUA 4FJVB 2GOWA 2L3ZA 3KUDB 3WAPA 1XT9B 3RZWC 3PREA 2IY0B 2KTRA 2FNJB 2MBOA 3EC8A 3JW0X 3QC8B 4I6NB 1X1MA 2NR2A 2IYDB 3VUWA 3NS8A 4BOZB 3DBHI 3JYUA 4W9LA 2MBBB 4BOSC 5AZHA 5D7GA 3OAWA 3RULA 3ZUNA 4FJZA 5DPWA 4WQOB 3ML9A 4WJNA 2LI5A 2K25A 4B95A 2XK5B 1WMHB 2IO0B 2KQSA 2DZIA 2BYEA 2JUOA 4IUMB 4KV2A 4FADA 1WFYA 3ZRCA 3Q3JA 3V6EB 1Q5WB 3GZNI 5C23A 1V49A 5D6JB 3QA8A 2C5LC 2G4DB 3UQBA 1J0GA 1LFDA 2CHZA 2JZ3B 3AULA 3ZKJC 4EOYA 2LD9A 2LWPA 2N7DA 4GDKB 3VFKA 4E71A 2WWZA 4MJSA 2O6VD 3PT2B 4IC7B 1TZ1A 4GN1A 2XK5A 3ZNHB 1GG3A 5DPSA 2KQ7A 4NNJB 2O6VA 2OOBB 5DPTA 3ZNID 2Z59B 3PRZA 3N32A 3JSVB 1KOTA 3WIMA 1RLFA 2B3AA 1EF5A 3QWZB 3ZLZA 3VTWA 2L0FA 3ZNGC 2FCNA 5E6PA 4DDGD 1H8CA 1P3QU 3OLMD 4M8MA 2YVCA 3APDA 3PRMB 4NQLB 5J2RA 4W9DA 2DYOA 1SE9A 4GGQA 3DVNV 1P1AA 2BYVE 1YJ1A 3PV1A 2IBIB 5C1ZA 1WXSA 3TMPB 3A9KA 4B9KA 2C7MB 2FCQA 1PQSA 3BINA 3PPAA 2WDTB 3H6NA 3QK0A 4JIOU 2LVOA 2IZVB 5AEKB 4IWQA 3ENEA 4KVGB 1L7YA 1D3ZA 4HJKA 1S1QB 4ICUA 3A4RA 4DK5A 1V81A 1LQBA 1T0YA 2MBHA 4PYZA 1E7UA 2M17A 2MX2A 4GIVA 2C7NB 4DHZB 3A9JB 2PPHA 3DBSA 2KFKA 3KW5B 3VVWB 2J0JA 1P98A 2XBBC 4KIKA 2EMSA 4KDLB 4GMVA 2IO3B 1TGZB 2J0KA 3UQAA 3OJ4B 2IO1B 4OVUA 3T8MA 1RRBA 4G11A 4NAWA 2D11A 5KHOA 1GUAB 1WMHA 4IWPA 3N3KB 1SIFA 2EMTA 1WRDB 4II2B 3TIXA 2KHWB 4ASWC 2KXJA 4NAWB 1SGHA 2DYBA 1BT0A 4MSQB 2YLMA 4GSWA 4A20A 2M0XA 5J18A 2FCSA 2IO2B 2N9EB 2LJ5A 4LCDE 4P7IA 3VH3B 2L7RA 4HCNB 2BWES 4WJQA 2Y5BB 4NJ6A 4X57B 4DXAB 5JHBA 1CMXB 3ZVVA 3VQIA 1KM7A 5CHVC 3DDCB 2RGFA 3V60A 2MSED 3ZTCA 3WAOA 1WGGA 2JXXA 5GMVA 5L83A 1Q1OA 2CS4A 2DHZA 2REXA 4HPLB 4HPMB 1WXMA 2LGXA 4M8NA 1E8ZA 1YIWA 2KDBA 3I3TB 3PVLA 2KMAA 3M62B 3HM3A 2KWUB 2VRRB 2Z0EB 4K81A 1EO6A 2JY6A 2ZVNA 4WWNA 4B6WA 3Q3FA 3QCAA 2CU1A 4ANWA 2LXAA 2N9PC 3VHTC 2L8JA 3IG3A 4JLCA 1WGDA 4KSLC 1UH6A 4CYEA 4MH0E 5BO4B 2ZPNA 2KJRA 3B0AA 3ECIA 2C60A 3QIJA 1ZKHA 1TBEA 4G50A 1K8RB 4WJPA 2A5UA 3AU4A 5AZGA 2O2VA 2KLGA 5JH5C 2EKEC 3M63B 2HE7A 3VXWA 3C0RB 5CTRC 2D2QA 3BY4B 4KSKC 4FA6A 3X0WA 2RR9A 2GBNA 1WGRA 1VD2A 3RZFA 2K8HA 3X23A 4RM8A 2FUHB 2BYFA 2L05A 3W1SC 1C1YB 2PE6B 5CX3A 4YL8A 1UELA 2JRHA 3IFWB 3L13A 2WX1A 3L10B 2LGYA 3L16A 2ZVOA 4HWIB 1V86A 2KN5A 2LVQA 3RUIB 1WZ3A 2K8BA 4WWPA 4TQ1A 4ZRKA 2A4ZA 3L17A 1P9DU 4W9JA 1WE6A 3UIPB 2DZKA 4WAAA 1U4AA 3KUCB 3PS6A 2RD0A 5CHFA 4IW0A 4KZ0A 3EFUA 3CMMB 1WY8A 2MA9B 4M0WB 5TR5A 3UIOB 2FIDA 3H1UA 3A9KB 5LXIB 3HK0A 2D3GA 3DVGY 4IM0A 3QHTA 4MELA 4MDKE 4MEMA 2NBWB 4IG7B 3R7RA 3PRPB 1HE8A 2KJ6A 2KC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQK E;  2KWC A;  4JGH B;  3WA0 A;  4GDK A;  5JZE B;  4CHK A;  2PJH A;  3KUZ A;  5DCN A;  2L00 B;  1GC6 A;  2DZM A;  2MBQ A;  1MG8 A;  2N9X A;  4FHJ A;  1I42 A;  1UZX B;  2CHW A;  5LXH A;  1ISN A;  2KFK B;  3NZS A;  4I6P A;  2IY1 B;  3H7P A;  5CHW A;  4A3O A;  2GBM A;  4BBN F;  4TKN A;  1WIA A;  3SD5 A;  2UWQ A;  3DOW A;  4BKT A;  4EZJ A;  2CKH B;  2JZZ A;  2RSU A;  1V80 A;  4J6I A;  4W9K A;  2KZR A;  3A1Q B;  2XEW A;  3DVN U;  3EHV A;  4K1R B;  3A1Q A;  1V2Y A;  3VUX A;  2KDI A;  3VTU A;  3CSF A;  4BFR A;  4LDT B;  4RM9 A;  3R66 C;  4DWF A;  3ONS A;  3AI5 A;  2C9W B;  4HK2 A;  2GBR A;  3DPD A;  2BWF A;  2LZ6 A;  2V3S A;  2Z0D B;  2KK8 A;  1YX6 B;  5KHQ A;  2G3Q B;  2MCN B;  1IYF A;  4W9C A;  4ZRI A;  4DHJ B;  4G3X B;  3PSE B;  1ZW7 A;  4NPN A;  4ANX A;  2K6D B;  1R4N I;  3JSV A;  2QHO A;  1YX5 B;  1J19 A;  3N30 A;  4BVU C;  3SU8 X;  4EEW A;  1WM2 A;  2NS5 A;  3QX1 A;  3RCZ A;  3CF6 E;  1KJT A;  3NY5 A;  2D07 B;  1LXD A;  2MBE A;  1RFA A;  3DCG A;  2NCN A;  3MJW A;  3O65 B;  4MM3 A;  3TCA A;  2ZJD A;  1C3T A;  3K9O B;  3M3J A;  5DPR A;  3TJP A;  3DQV A;  4EFO A;  3ALB A;  2AL3 A;  3T9L A;  1AAR A;  1UBQ A;  4HDO A;  1WX8 A;  3U8Z A;  1ZGU B;  3ZDM C;  3APC A;  4BKG A;  3IBE A;  4CO7 A;  3KH0 A;  4HDQ A;  3DVG X;  5JHA A;  1E7V A;  1Z2M A;  2KD0 A;  2BF8 B;  2ZNV C;  3KYC D;  1KLV A;  3WAN A;  3HM6 X;  4MGY E;  1S3S G;  2BKF A;  1Y8R C;  4OVV A;  5L95 C;  4LJP B;  3PZD A;  2JT4 B;  3B08 A;  2JPH A;  4W9F A;  3RYT A;  2NBV B;  4EZL A;  5D94 A;  1WM3 A;  3ZTD A;  3HHM A;  3PLV A;  2FIF A;  4DHJ D;  3GOE A;  3LJ3 A;  5G55 A;  2KOX A;  3ZIM A;  5EDS A;  2PEA A;  2HJ8 A;  3VDZ A;  1WR6 E;  4W9I A;  4NY0 A;  2K6Q A;  3NHE B;  1YQB A;  4GXB A;  3WAL A;  2NBU A;  4AWJ A;  4BKS A;  1WX7 A;  4FBJ B;  1G6J A;  2FCM A;  2I1K A;  2LUE A;  3H7S A;  4IM3 A;  3WAM A;  4EZK A;  4ZDV A;  4KDI C;  3L0W B;  4K7U A;  4ANU A;  2MLB A;  4XX5 A;  3DBL I;  1WH3 A;  3A9J A;  2DZJ A;  4TUU A;  1WR1 A;  4BKS D;  2RPQ A;  3DBR I;  2LVP A;  3ML8 A;  3PHX B;  1J8C A;  2BKR B;  2MQJ A;  1GNU A;  2LRU A;  1E90 A;  1E8Y A;  2JVC A;  3SHQ A;  2LXC A;  4F1S A;  4FN2 A;  4AP4 C;  2JF5 A;  1TTN A;  2G4S A;  4II3 B;  2KMC A;  3UIN B;  4HCP B;  4MGZ E;  3IHP C;  2DAF A;  4AJY B;  3OJ3 A;  3UGB B;  2KDE B;  2WYQ A;  2M8S A;  1WYW B;  2N7E A;  3U7D A;  2O2V B;  4JQW C;  4PS3 A;  3TL5 A;  5FR6 A;  1V6E A;  2JRI B;  2KWV B;  2AEH A;  2NPT B;  3A4S C;  1A5R A;  3RT3 B;  4EUT A;  3QAR A;  4HLE A;  3U30 A;  1Q0W B;  3A33 B;  2PE9 A;  1NDD A;  2GBJ A;  2N4F A;  3V62 A;  4EKU A;  3H9D A;  3QQ8 B;  2V4L A;  4HXD A;  4ZYN A;  5LLI A;  4DHZ E;  4GOC A;  5J17 A;  2R2O A;  2WX0 A;  4LDT D;  2KAN A;  4ICV A;  1WXA A;  1QZE A;  3V61 A;  2D10 A;  4NJ7 A;  3ZW3 A;  2KKC A;  4MJS B;  2JWZ A;  4AOF A;  1P0R A;  4A3P A;  3L54 A;  1EUV B;  1WJU A;  1H4R A;  2AL6 A;  3JVZ X;  4GU2 A;  4AUQ C;  4DBG A;  2LAS A;  3MHS D;  2LGD A;  3RD2 A;  2KNB A;  4BBN C;  2KTR B;  4KZC A;  4F8C B;  4KIK B;  4W9E A;  4TQ0 A;  2N1W A;  4GB9 A;  3APF A;  1FXT B;  2M1M A;  1WF9 A;  3K9P B;  5E6O A;  4E74 A;  4ZRJ A;  4N9F 4;  1XD3 B;  2CHX A;  2MW5 A;  1GC7 A;  2ZZP B;  2ZCC A;  1RAX A;  1OEY J;  4GDL B;  1F9J A;  2KJH B;  2KTF A;  3AXC A;  4FHK A;  5E6N A;  2HTH A;  3H7P B;  4IM2 A;  3PTF C;  3VAW A;  3W1S A;  4TV3 A;  2CR5 A;  3QAQ A;  2DX5 B;  4IWO A;  5IAA C;  2G45 B;  3P2B A;  4HVB A;  3KYD D;  3UF8 A;  4MGK E;  1L2N A;  2KX0 A;  1IP9 A;  1JRU A;  2W9N A;  3IVF A;  1OTR B;  1WJ6 A;  2DAJ A;  1LM8 B;  3R7Q A;  2KLC A;  2HD5 B;  4JL9 A;  2GMI C;  2V1Y A;  3KVF B;  1YD8 U;  2KX3 A;  2L76 A;  4XC2 A;  2MP2 A;  1OQY A;  1NBF C;  2KVR A;  2DYM A;  4AJW A;  1V5T A;  4K7W A;  1UBI A;  3M95 A;  1VCB A;  1V5O A;  3NZU A;  2C7H A;  3PGE A;  3NOB A;  4ANV A;  2NPT A;  4K7S A;  1R4M I;  3D32 A;  3VH4 B;  2KDF B;  1E8X A;  5IA7 A;  1UGM A;  2KO3 A;  1WGY A;  2OJR A;  3VUY A;  3ZNZ B;  1WJN A;  4W9G A;  2I1J A;  2KFJ A;  2ZCB A;  2MWS B;  2MRP A;  4G0N B;  3VTV A;  2GBK A;  3EEC A;  4I6L B;  2N1V A;  3S2A A;  3ZDT A;  3CST A;  1UD7 A;  1WI0 A;  1M94 A;  1WGH A;  1WZ0 A;  2DEN B;  2ZNV B;  4LJO B;  4F7Z A;  3L08 A;  2J7Q B;  2MP2 B;  2O6V B;  2K1F A;  1EF1 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  5AZF A;  3ZRF A;  1E8W A;  4RMA A;  3PHW B;  2NVU I;  2K39 A;  2L0T A;  3ZO5 B;  4PYU A;  1Z5S B;  1WX9 A;  2LRW A;  3V6C B;  3AU5 A;  2AWT A;  4PS8 A;  4URK A;  4WWO A;  4MSM B;  4DDI D;  2BGF A;  1IPG A;  3QJZ A;  1WJ4 A;  4FUL A;  1V9J A;  2ZEQ A;  1XQQ A;  2BPS A;  2M4N A;  3TBL D;  4WJO A;  1GJZ A;  3LDZ E;  5D2M B;  1I35 A;  3B1L X;  5HKH A;  3R3M A;  4GDL A;  4E3C A;  2KC2 A;  3HIZ A;  5G2N A;  3MTN B;  4MGI E;  4FJY A;  1NI2 A;  4PS7 A;  3W1Y A;  2K8C A;  2R2Q A;  2UYZ B;  4W9H A;  2J0M A;  2FAZ A;  1WE7 A;  3SDL C;  4XZ4 A;  1WXV A;  1E5W A;  2AYO B;  2ZPY A;  3PLU A;  4FJV B;  2GOW A;  2L3Z A;  3KUD B;  3WAP A;  1XT9 B;  3RZW C;  3PRE A;  2IY0 B;  2KTR A;  2FNJ B;  2MBO A;  3EC8 A;  3JW0 X;  3QC8 B;  4I6N B;  1X1M A;  2NR2 A;  2IYD B;  3VUW A;  3NS8 A;  4BOZ B;  3DBH I;  3JYU A;  4W9L A;  2MBB B;  4BOS C;  5AZH A;  5D7G A;  3OAW A;  3RUL A;  3ZUN A;  4FJZ A;  5DPW A;  4WQO B;  3ML9 A;  4WJN A;  2LI5 A;  2K25 A;  4B95 A;  2XK5 B;  1WMH B;  2IO0 B;  2KQS A;  2DZI A;  2BYE A;  2JUO A;  4IUM B;  4KV2 A;  4FAD A;  1WFY A;  3ZRC A;  3Q3J A;  3V6E B;  1Q5W B;  3GZN I;  5C23 A;  1V49 A;  5D6J B;  3QA8 A;  2C5L C;  2G4D B;  3UQB A;  1J0G A;  1LFD A;  2CHZ A;  2JZ3 B;  3AUL A;  3ZKJ C;  4EOY A;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  3VFK A;  4E71 A;  2WWZ A;  4MJS A;  2O6V D;  3PT2 B;  4IC7 B;  1TZ1 A;  4GN1 A;  2XK5 A;  3ZNH B;  1GG3 A;  5DPS A;  2KQ7 A;  4NNJ B;  2O6V A;  2OOB B;  5DPT A;  3ZNI D;  2Z59 B;  3PRZ A;  3N32 A;  3JSV B;  1KOT A;  3WIM A;  1RLF A;  2B3A A;  1EF5 A;  3QWZ B;  3ZLZ A;  3VTW A;  2L0F A;  3ZNG C;  2FCN A;  5E6P A;  4DDG D;  1H8C A;  1P3Q U;  3OLM D;  4M8M A;  2YVC A;  3APD A;  3PRM B;  4NQL B;  5J2R A;  4W9D A;  2DYO A;  1SE9 A;  4GGQ A;  3DVN V;  1P1A A;  2BYV E;  1YJ1 A;  3PV1 A;  2IBI B;  5C1Z A;  1WXS A;  3TMP B;  3A9K A;  4B9K A;  2C7M B;  2FCQ A;  1PQS A;  3BIN A;  3PPA A;  2WDT B;  3H6N A;  3QK0 A;  4JIO U;  2LVO A;  2IZV B;  5AEK B;  4IWQ A;  3ENE A;  4KVG B;  1L7Y A;  1D3Z A;  4HJK A;  1S1Q B;  4ICU A;  3A4R A;  4DK5 A;  1V81 A;  1LQB A;  1T0Y A;  2MBH A;  4PYZ A;  1E7U A;  2M17 A;  2MX2 A;  4GIV A;  2C7N B;  4DHZ B;  3A9J B;  2PPH A;  3DBS A;  2KFK A;  3KW5 B;  3VVW B;  2J0J A;  1P98 A;  2XBB C;  4KIK A;  2EMS A;  4KDL B;  4GMV A;  2IO3 B;  1TGZ B;  2J0K A;  3UQA A;  3OJ4 B;  2IO1 B;  4OVU A;  3T8M A;  1RRB A;  4G11 A;  4NAW A;  2D11 A;  5KHO A;  1GUA B;  1WMH A;  4IWP A;  3N3K B;  1SIF A;  2EMT A;  1WRD B;  4II2 B;  3TIX A;  2KHW B;  4ASW C;  2KXJ A;  4NAW B;  1SGH A;  2DYB A;  1BT0 A;  4MSQ B;  2YLM A;  4GSW A;  4A20 A;  2M0X A;  5J18 A;  2FCS A;  2IO2 B;  2N9E B;  2LJ5 A;  4LCD E;  4P7I A;  3VH3 B;  2L7R A;  4HCN B;  2BWE S;  4WJQ A;  2Y5B B;  4NJ6 A;  4X57 B;  4DXA B;  5JHB A;  1CMX B;  3ZVV A;  3VQI A;  1KM7 A;  5CHV C;  3DDC B;  2RGF A;  3V60 A;  2MSE D;  3ZTC A;  3WAO A;  1WGG A;  2JXX A;  5GMV A;  5L83 A;  1Q1O A;  2CS4 A;  2DHZ A;  2REX A;  4HPL B;  4HPM B;  1WXM A;  2LGX A;  4M8N A;  1E8Z A;  1YIW A;  2KDB A;  3I3T B;  3PVL A;  2KMA A;  3M62 B;  3HM3 A;  2KWU B;  2VRR B;  2Z0E B;  4K81 A;  1EO6 A;  2JY6 A;  2ZVN A;  4WWN A;  4B6W A;  3Q3F A;  3QCA A;  2CU1 A;  4ANW A;  2LXA A;  2N9P C;  3VHT C;  2L8J A;  3IG3 A;  4JLC A;  1WGD A;  4KSL C;  1UH6 A;  4CYE A;  4MH0 E;  5BO4 B;  2ZPN A;  2KJR A;  3B0A A;  3ECI A;  2C60 A;  3QIJ A;  1ZKH A;  1TBE A;  4G50 A;  1K8R B;  4WJP A;  2A5U A;  3AU4 A;  5AZG A;  2O2V A;  2KLG A;  5JH5 C;  2EKE C;  3M63 B;  2HE7 A;  3VXW A;  3C0R B;  5CTR C;  2D2Q A;  3BY4 B;  4KSK C;  4FA6 A;  3X0W A;  2RR9 A;  2GBN A;  1WGR A;  1VD2 A;  3RZF A;  2K8H A;  3X23 A;  4RM8 A;  2FUH B;  2BYF A;  2L05 A;  3W1S C;  1C1Y B;  2PE6 B;  5CX3 A;  4YL8 A;  1UEL A;  2JRH A;  3IFW B;  3L13 A;  2WX1 A;  3L10 B;  2LGY A;  3L16 A;  2ZVO A;  4HWI B;  1V86 A;  2KN5 A;  2LVQ A;  3RUI B;  1WZ3 A;  2K8B A;  4WWP A;  4TQ1 A;  4ZRK A;  2A4Z A;  3L17 A;  1P9D U;  4W9J A;  1WE6 A;  3UIP B;  2DZK A;  4WAA A;  1U4A A;  3KUC B;  3PS6 A;  2RD0 A;  5CHF A;  4IW0 A;  4KZ0 A;  3EFU A;  3CMM B;  1WY8 A;  2MA9 B;  4M0W B;  5TR5 A;  3UIO B;  2FID A;  3H1U A;  3A9K B;  5LXI B;  3HK0 A;  2D3G A;  3DVG Y;  4IM0 A;  3QHT A;  4MEL A;  4MDK E;  4MEM A;  2NBW B;  4IG7 B;  3R7R A;  3PRP B;  1HE8 A;  2KJ6 A;  2KC1 A; 
#chains in the Genus database with same CATH topology
 1JQ4 A;  2KWC A;  3WA0 A;  1J7C A;  2MBQ A;  1GC6 A;  2DZM A;  1KFY B;  2N9X A;  4FHJ A;  3TUO A;  1UZX B;  4I6P A;  4BBN F;  2H88 B;  3DOW A;  1YN3 A;  3R8B A;  1V80 A;  2GB1 A;  1KH0 A;  3EHV A;  2J4X A;  2PVG C;  3VUX A;  2KDI A;  4BFR A;  3DBL B;  2WXM A;  4RGO S;  2GBR A;  2KDM A;  2Z0D B;  1JWS D;  2H89 B;  1YX6 B;  2G3Q B;  3OWE B;  3PSE B;  1ZW7 A;  4NPN A;  4ANX A;  1R4N I;  2MEK A;  4ZHP A;  4C7Z A;  4BVU C;  3QX1 A;  3RCZ A;  1FMA D;  2D07 B;  1LXD A;  2KT7 A;  2MBE A;  3WCQ A;  1C3T A;  4C80 A;  2W3R A;  3IAS 1;  1D4B A;  3TJP A;  4EFO A;  2HDE A;  2WXP A;  4BKG A;  3APC A;  5JHA A;  1E7V A;  2ZNV C;  3PO0 A;  5L95 C;  1Q10 A;  3PZD A;  2JT4 B;  3ZTD A;  1EU4 A;  4KGS A;  2IPK D;  3GOE A;  3Q14 C;  5G55 A;  4W9I A;  4NY0 A;  4HRS A;  3AE1 B;  3WAL A;  4BKS A;  1WX7 A;  1G6J A;  2I1K A;  2MLB A;  4BKS D;  4WQM A;  2MQJ A;  2LRU A;  1E90 A;  1E8Y A;  1V1P B;  4WH4 A;  3SHQ A;  4II3 B;  3VRB B;  4MGZ E;  3RNC C;  4AJY B;  3OJ3 A;  3UGB B;  2KDE B;  2WYQ A;  2M8S A;  3IAM 1;  3AED B;  4JQW C;  2KWV B;  1ENF A;  4EUT A;  4HLE A;  1Q0W B;  1L6V A;  2WXQ A;  3BK1 A;  3HUI A;  3V62 A;  4EKU A;  2WP9 B;  3QQ8 B;  4HXD A;  1TS2 A;  1F77 A;  1CZP A;  3GS2 A;  4GOC A;  2R2O A;  4LDT D;  2KAN A;  1N62 A;  4NJ7 A;  1IBX B;  4A3P A;  4GU2 A;  4C7Y A;  2LAS A;  2LGD A;  1ZE3 D;  4KZC A;  4F8C B;  4W9E A;  3N20 C;  2M1M A;  3K9P B;  4PT5 A;  1C4C A;  5E6O A;  5C2T B;  1XD3 B;  2CHX A;  4NZL B;  2ZCC A;  2IGH A;  4GDL B;  4FHK A;  4AQ7 A;  3VR9 B;  3EFC A;  1L0Y B;  4MGK E;  3IVF A;  2WNM A;  1LM8 B;  2BB6 A;  4OZC A;  1FCL A;  5IN7 A;  1SF0 A;  2V1Y A;  5HFY A;  2L76 A;  4XC2 A;  2N0S B;  1OQY A;  1NBF C;  4DQO C;  3AN1 A;  2KVR A;  4OVZ A;  2GI9 A;  1UBI A;  3M95 A;  1TS4 A;  3PGE A;  2G9H D;  3D32 A;  1KLG D;  2RMM A;  1E8X A;  1WGY A;  2OJR A;  4IDI A;  4P16 A;  3ZNZ B;  2HTM E;  1I4H A;  1YJJ A;  3TEX A;  2I1J A;  2MWS B;  2N1V A;  1UD7 A;  2ZNV B;  3BWU D;  4LJO B;  4F7Z A;  3P42 A;  2J7Q B;  3PHW B;  2NVU I;  1AWD A;  2QSD A;  2D5G A;  3V6C B;  3DHI C;  2NTT A;  2ZEQ A;  1GJZ A;  2BPS A;  4WJO A;  3LDZ E;  3R3M A;  4E3C A;  4MAC A;  3MTN B;  4PS7 A;  1VDV A;  2K8C A;  2J0M A;  4HKZ E;  1QOB A;  3SDL C;  4YWG G;  3U2S C;  1WXV A;  3FIL B;  1ZOY B;  2ZPY A;  3R2I A;  2L3Z A;  3WAP A;  1MHX A;  4OW0 A;  1I4Q A;  5AZH A;  3AB5 A;  4NAM A;  3ZUN A;  2PVO D;  4WQO B;  3ML9 A;  4WJN A;  2LI5 A;  3AE6 B;  1TT5 B;  2XK5 B;  1YJI A;  1BXT A;  4YSZ B;  2MJ3 A;  2IO0 B;  2BYE A;  4KV2 A;  1WFY A;  3ZRC A;  2WXH A;  5HG2 A;  5C23 A;  5D6J B;  1DYQ A;  2CHZ A;  5JXV A;  3ZGZ A;  3VFK A;  4E71 A;  4IC7 B;  1N5W A;  2XK5 A;  3ZNH B;  2AQ2 B;  4NNJ B;  2OOB B;  4HPP A;  4WWM A;  3ZNI D;  2Z59 B;  2CU3 A;  2WXR A;  3N32 A;  3TSS A;  3B9J A;  5MPO A;  4NQL B;  2DYO A;  1SBB B;  1P1A A;  1YJ1 A;  4N58 A;  1WXS A;  1F1H A;  2VH1 A;  4TMA B;  2L32 A;  2FE8 A;  4KVG B;  1L7Y A;  3T3N A;  2M17 A;  1GPX A;  4DHZ B;  3A9J B;  1T3Q A;  1KRH A;  2KFK A;  3VVW B;  2Y5C A;  4KIK A;  4N6E B;  1XLN A;  2IO3 B;  2IO1 B;  4L2Y A;  2D11 A;  1WMH A;  5EE1 A;  3URY A;  3N3K B;  3AE8 B;  1SIF A;  3NZ3 A;  4P6V F;  2PLP A;  1ACC A;  3IT6 B;  4M0W A;  2KAJ A;  2ZW1 A;  3RFZ B;  5BYR A;  2L7R A;  4HCN B;  4YTN B;  1D6E C;  3VQI A;  2WDR B;  5CHV C;  2RGF A;  3Q8F A;  3V60 A;  3BYT B;  1C9F A;  2JXX A;  1V1P A;  1WXM A;  4M8N A;  3DWM A;  2KMA A;  4K81 A;  1E9M A;  1KLU D;  3RN9 C;  1EO6 A;  4WWN A;  4B6W A;  3VHT C;  4O1N A;  4KSL C;  4CYE A;  3ECI A;  1QOF A;  2C60 A;  1VZ6 A;  4WJP A;  5AZG A;  5C3J B;  2KLG A;  2D3B A;  2BQQ A;  5CTR C;  2XNA C;  1WSP A;  2GBN A;  4RM8 A;  2OHF A;  2PE6 B;  1UEL A;  1UWX A;  4HWI B;  3ZJT A;  4P1B C;  5E6J A;  2SEB D;  1FRD A;  1U4A A;  3PS6 A;  2DLB A;  5CHF A;  4KZ0 A;  3EFU A;  3UIO B;  4YSY B;  4CQN A;  4MEM A;  1R4N B;  4IG7 B;  3RPF C;  2KJ6 A;  1XLQ A;  4NQK E;  5JZE B;  4CHK A;  3ZXV A;  2PJH A;  3KUZ A;  2WXL A;  2N9L A;  3LYY A;  4C4V B;  4B0M A;  1FFV A;  2KFK B;  1EWC A;  5CHW A;  1MI0 A;  2IY1 B;  4TKN A;  4EZJ A;  4W9K A;  1PDX A;  3A1Q A;  2E6X A;  1V2Y A;  3VTU A;  1D5X C;  4LDT B;  4DWF A;  3AI5 A;  4HK2 A;  4S0R A;  2KK8 A;  1AN8 A;  1IYF A;  4DHJ B;  4RH6 A;  4G3X B;  2BS2 B;  2ZW0 A;  3N30 A;  3AE3 B;  4EEW A;  1WM2 A;  3MJW A;  2M19 A;  3TCA A;  3M3J A;  5DPR A;  1IUE A;  1B1Z A;  1UBQ A;  2CJO A;  4US8 A;  3MP9 A;  4JX1 C;  1C79 A;  4NJC A;  2PW9 A;  1VR9 A;  3IBE A;  4HDQ A;  1R4M B;  2KD0 A;  2BF8 B;  1KLV A;  1FCC C;  4MGY E;  4OVV A;  4LJP B;  2WXO A;  4OHJ A;  2JPH A;  3HVD A;  3PZ8 A;  3PLV A;  4DHJ D;  1L0V B;  3NHE B;  1YQB A;  2QMT A;  1ZPS A;  4ZDV A;  3H7S A;  4ANU A;  3DBL I;  1WH3 A;  3A9J A;  4TUU A;  1SJE D;  4M01 A;  4XDD A;  2JVC A;  4ARC A;  2LXC A;  2I38 A;  4F1S A;  4AP4 C;  2G4S A;  2KMC A;  4JWU C;  4HCP B;  2BVC A;  2CJN A;  4IKG A;  1F0Z A;  2JRI B;  1L5P A;  3AV8 A;  3A4S C;  3QAR A;  1GB1 A;  4D2K A;  1DGJ A;  3H9D A;  4ZYN A;  2V4L A;  2INP E;  1JAL A;  1DOX A;  4ICV A;  4EE2 A;  2D10 A;  2FBW B;  4MJS B;  4AOF A;  2JXT A;  3ZYY X;  3W5U B;  1P0R A;  3L54 A;  3JVZ X;  4AUQ C;  4DBG A;  3MHS D;  4ARI A;  2KNB A;  4BBN C;  2KTR B;  4TQ0 A;  4GB9 A;  3BVZ A;  5TSS A;  3APF A;  1FXT B;  1GOZ A;  4ZRJ A;  4ACF A;  3MC9 A;  5T8I A;  2MW5 A;  1GC7 A;  2ZZP B;  5BMI A;  1XCQ L;  1F9J A;  1IGD A;  5E6N A;  2BT6 A;  2B76 B;  2HTH A;  4IM2 A;  4JE3 B;  1TY2 A;  2CR5 A;  2DX5 B;  5HI1 A;  3W5V B;  3P2B A;  4XWW A;  1L2N A;  4PK1 A;  2KX0 A;  1IP9 A;  2W9N A;  1SE4 A;  2WU5 B;  4JL9 A;  5HHD G;  5D3D A;  1YD8 U;  2KX3 A;  2GLS A;  2HJ1 A;  1STE A;  5BYS A;  4M02 A;  2X38 A;  1V5T A;  2WDV B;  1VCB A;  3NZU A;  3KLS X;  1YMH E;  4K3C A;  1HZ5 A;  1R4M I;  3VH4 B;  1NI3 A;  1UGM A;  2KO3 A;  3BII D;  1NEN B;  2KFJ A;  2MRP A;  4G0N B;  3ZDT A;  2QIL A;  4B0E A;  2WS3 B;  1M94 A;  1WZ0 A;  2MP2 B;  2O6V B;  4WUR A;  5AZF A;  1E8W A;  4RMA A;  2WLB A;  3ZO5 B;  4PYU A;  2LRW A;  3AU5 A;  3VRA B;  2AWT A;  4PS8 A;  3FIL A;  4DDI D;  2M0A A;  3QJZ A;  1V9J A;  4WIP A;  2M4N A;  3TBL D;  5D2M B;  3B1L X;  5HKH A;  2KC2 A;  3HIZ A;  1NI2 A;  1TIF A;  4W9H A;  3Q8A A;  2FAZ A;  3B2G A;  2PIA A;  2WXF A;  3RZW C;  3Q2A C;  3PRE A;  2IY0 B;  2FNJ B;  3RMK C;  2IYD B;  4DXG A;  3JYU A;  4W9L A;  1SSN A;  3CIR B;  1HXY D;  1DOI A;  5D7G A;  3OAW A;  3KQ4 A;  1RM6 C;  4WAF A;  2INC C;  2Y5P A;  4FJZ A;  1MHH E;  1KF6 B;  3CWI A;  3GE3 C;  4B95 A;  2IJ0 A;  3AE4 B;  1WMH B;  1T0R C;  2DZI A;  4IUM B;  4YTM B;  4FAD A;  5LNK 1;  3Q3J A;  3NG0 A;  3BK2 A;  1V49 A;  3HRD D;  2C5L C;  1J0G A;  1GAQ B;  3GZN B;  1JWA D;  2JZ3 B;  3ZKJ C;  4EOY A;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  1ESF A;  2WWZ A;  4MJS A;  2MJD A;  2O6V D;  1YQ4 B;  3DWG C;  4GN1 A;  1HEZ E;  1K53 A;  5DPS A;  2KQ7 A;  1SB3 C;  2O6V A;  1HA5 A;  1E10 A;  1FXI A;  1T0Q C;  3JSV B;  4XWT A;  2DWQ A;  4RF1 A;  2L0F A;  2V3P A;  4DDG D;  1H8C A;  1P3Q U;  2YVC A;  3PRM B;  5J2R A;  1SE9 A;  2BYV E;  3PV1 A;  2IBI B;  2ON8 A;  5C1Z A;  2MJE A;  3TMP B;  1NYQ A;  3BIN A;  3PPA A;  3H6N A;  5AEK B;  2IZV B;  2TSS A;  3ENE A;  4HJK A;  4ICU A;  4DK5 A;  1LQB A;  2MBH A;  2YEP B;  1UNS A;  4PYZ A;  2MX2 A;  2C7N B;  1ZXH A;  3DBS A;  1P98 A;  3BVG A;  1T6B X;  2W54 A;  1RRB A;  4G11 A;  1K50 A;  1GUA B;  4YXD B;  1QT9 A;  4IWP A;  1MG4 A;  1N63 A;  2KXJ A;  3NVV A;  1JRP A;  1BT0 A;  1SJH D;  2YLM A;  4GSW A;  4A20 A;  2M0X A;  2N9E B;  3VH3 B;  3O13 A;  3TEW A;  4DXA B;  4ZYS A;  5JHB A;  1CMX B;  3GP7 A;  1WGG A;  3MC8 A;  3EGR A;  1D5Z C;  3Q8C A;  3PVL A;  2KDB A;  2NMQ A;  2RDH A;  3M62 B;  3HM3 A;  2VRR B;  1AW7 A;  2Z0E B;  1MJD A;  1FXA A;  2ZVN A;  2JY6 A;  3Q3F A;  3QCA A;  4ANW A;  2N9P C;  2L8J A;  1WGD A;  1YNT E;  2ZPN A;  1TBE A;  2A5U A;  3C0R B;  4IOI E;  2D2Q A;  4XGA B;  4KSK C;  4FA6 A;  3X0W A;  4RGT A;  1TYG B;  1WGR A;  3RNF C;  3RZF A;  3X23 A;  3BVM A;  1A70 A;  3W1S C;  1VJK A;  4USA A;  4YL8 A;  2JRH A;  5G5H A;  2J52 A;  3L10 B;  2ZVO A;  4K3B A;  3HVZ A;  1V86 A;  2EEL A;  3RUI B;  2K8B A;  4ITK A;  4ZRK A;  2A4Z A;  2PTL A;  4W9J A;  4A9A A;  3CMM B;  1WY8 A;  2MA9 B;  4M0W B;  3A9K B;  3SFE B;  4XDC A;  2YEP F;  3DVG Y;  4MDK E;  1B9R A;  1L0X B;  2KC1 A;  4JGH B;  3N1Z C;  1TS5 A;  3P1M A;  5DCN A;  4LNN A;  1MG8 A;  1V97 A;  1I42 A;  2CHW A;  5LXH A;  1ISN A;  3NZS A;  1ET6 A;  2GBM A;  1WIA A;  4BKT A;  1QIL A;  2RSU A;  4J6I A;  3B2F A;  2XEW A;  3CSF A;  4KGT A;  4KGR A;  3ZXR A;  1FIQ A;  3C19 A;  3IT4 B;  2JWU A;  2XN9 C;  5KHQ A;  4LNI A;  1F52 A;  2MCN B;  4W9C A;  4ZRI A;  4OZA A;  2K6D B;  3JSV A;  2QHO A;  1YX5 B;  1J19 A;  3SU8 X;  3E56 A;  1E7P B;  2NS5 A;  1QF6 A;  4BZA A;  5J18 A;  1RFA A;  3TEY A;  2NCN A;  1BUI C;  4MH8 A;  3K9O B;  2VZK D;  1ZDX A;  3DQV A;  3ALB A;  1PGA A;  3T9L A;  1AAR A;  4HDO A;  1ZGU B;  3Q8B A;  3ZDM C;  4MT5 A;  4CO7 A;  3KH0 A;  3N1Y C;  1GB4 A;  5AUK A;  1Z2M A;  3KYC D;  3WAN A;  3HM6 X;  1QQR A;  1J7B A;  1Y56 A;  5D94 A;  1WM3 A;  3HHM A;  2FIF A;  1XCT L;  3GB1 A;  1ZP0 B;  3LJ3 A;  1YOV B;  4GLS C;  2HJ8 A;  5H92 C;  1WR6 E;  3VDZ A;  2K6Q A;  1N60 A;  4AWJ A;  2FCM A;  3WAM A;  4IM3 A;  4EZK A;  4KDI C;  4XX5 A;  2DZJ A;  3N1X C;  1WR1 A;  2RPQ A;  3DBR I;  3ML8 A;  4FXC A;  1GNU A;  4FN2 A;  2JF5 A;  1CJE A;  2N7E A;  2O2V B;  4PS3 A;  4ZRQ A;  2JSV X;  1SEB D;  3RT3 B;  4XYC A;  3NVY A;  3U30 A;  1DOY A;  5FR3 A;  3A33 B;  2PE9 A;  1MVK A;  1JML A;  2GBJ A;  2N4F A;  1XEE A;  2JYE A;  4DHZ E;  2X8X X;  3AH7 A;  3V61 A;  4A55 A;  3ZW3 A;  1NVI D;  1MPE A;  1H4R A;  1JW9 D;  4L23 A;  5IP4 D;  3RD2 A;  1QLB B;  4ZRP A;  2WHI A;  1TKG A;  1I4G A;  4C00 A;  4E74 A;  4DXF A;  3NRZ A;  1OEY J;  1J7A A;  2KJH B;  1FNV A;  1L4D B;  1T5X D;  3PTF C;  3VAW A;  3W1S A;  1E6E B;  4TV3 A;  3QAQ A;  4TSS A;  4IWO A;  1HTQ A;  2G45 B;  4A90 A;  3KYD D;  1PUT A;  3UF8 A;  1BML C;  1WJ6 A;  2HD5 B;  2IND C;  3KVF B;  3ABV B;  1NEK B;  2LUM A;  4AJW A;  2DBY A;  1V5O A;  3NUH B;  4H2A A;  4ANV A;  2NPT A;  4HKQ A;  2KDF B;  4S17 A;  1SE2 A;  1I4P A;  2L83 A;  4W9G A;  1C4A A;  1V8C A;  2ZCB A;  1YQ3 B;  5EE9 A;  3VTV A;  1JWU D;  3S2A A;  1N61 A;  4HRO A;  3CST A;  1TJE A;  2SAK A;  1WI0 A;  2Q5W D;  1WGH A;  2DEN B;  1QOG A;  2V0G A;  3L08 A;  2K1F A;  2JZP A;  4XE0 A;  1VZ8 A;  2LHE A;  2L0T A;  1RWS A;  1Z5S B;  1WX9 A;  3DBR B;  2KYW A;  2Z8L A;  4URK A;  3BYY B;  2BGF A;  1IPG A;  2QC8 A;  1WJ4 A;  4FUL A;  3P4S B;  1XQQ A;  1I35 A;  2OJW A;  2GRI A;  5FKA C;  2QCZ A;  3AM9 A;  5G2N A;  4FJY A;  4A6Q A;  3W1Y A;  4XZ4 A;  1JRO A;  1HZ6 A;  3U7Z A;  3PLU A;  2AYO B;  4FJV B;  1WYG A;  2GOW A;  3KUD B;  1HQR D;  1HTO A;  3QC8 B;  3EC8 A;  3JW0 X;  2NR2 A;  3NVW A;  3VUW A;  3NS8 A;  2K9X A;  3DBH I;  1I4R A;  1UF0 A;  2EKI A;  2L1A A;  2LGS A;  3RUL A;  1AYF A;  3U4E G;  4MM3 B;  2LMC A;  5EE3 A;  2WXN A;  2WQY B;  1XLO A;  2UU7 A;  1XO3 A;  2BYT A;  2V3N A;  2KQS A;  2JUO A;  2V4I B;  1XXG A;  1Q5W B;  3GZN I;  1TKY A;  3UQB A;  1LFD A;  2D3C A;  3AUL A;  2E3T A;  2WXJ A;  1TZ1 A;  4JPS A;  2K5P A;  1GG3 A;  3NVZ A;  3AE9 B;  1KOT A;  3WIM A;  4RF0 A;  2AQ3 B;  3RI7 C;  3QWZ B;  3ZLZ A;  3R2T A;  2FCN A;  3OLM D;  4M8M A;  3GE8 C;  4W9D A;  1FNW A;  3DVN V;  2WXK A;  1PGB A;  2W82 A;  2FCQ A;  2WDT B;  3QK0 A;  2LVO A;  1D3Z A;  4KKI A;  1K52 A;  3A4R A;  1T0Y A;  1E7U A;  4C4V A;  1V1O A;  4YT0 B;  3RNE C;  2PPH A;  3KW5 B;  3RNB C;  1I4X A;  3KWV A;  2EMS A;  4KDL B;  4GMV A;  2J0K A;  5FK9 C;  3T8M A;  4NAW A;  5GXG B;  5KHO A;  1FO4 A;  2EMT A;  5IO9 A;  2KHW B;  1ET9 A;  4ASW C;  2ONQ A;  4MSQ B;  2KVZ A;  2FCS A;  2IO2 B;  1YN5 A;  4LCD E;  4JWS C;  4P7I A;  3Q69 A;  2BWE S;  2G1E A;  4WJQ A;  2W55 A;  2NTS A;  4RFB A;  4OZB A;  3ZVV A;  1KM7 A;  3ZTC A;  3WAO A;  4REZ A;  2WXI A;  5GMV A;  5I4D A;  5L83 A;  1Q1O A;  2LFI A;  2REX A;  4HPL B;  1FD6 A;  4HPM B;  2LGX A;  1E8Z A;  1YIW A;  3I3T B;  2KWU B;  2PKO A;  1RYJ A;  4JLC A;  3H8H A;  3AEG B;  3B0A A;  3QIJ A;  2D3A A;  3AU4 A;  4L1B A;  1R7S A;  3RNA C;  2EKE C;  3VXW A;  4LTU A;  2K8H A;  3Q3N C;  2BYF A;  2L05 A;  2N9K A;  1C1Y B;  5CX3 A;  2BS4 B;  4J3O D;  5EE0 A;  2LGY A;  2LVQ A;  2M56 B;  1WZ3 A;  4TQ1 A;  1P9D U;  2VH2 A;  2DZK A;  2WXG A;  3UIP B;  4C56 C;  2RD0 A;  1IBX A;  2W3S A;  3UI3 A;  3IXS A;  3ZJV A;  5LXI B;  2MHJ A;  2D3G A;  4IM0 A;  1N5X A;  3AEC B;  1PFD A;  1FPY A;  4GDK A;  2L00 B;  1FNU A;  3I57 A;  4A3O A;  3H7P A;  3DHG C;  3SD5 A;  2UWQ A;  2CKH B;  2JZZ A;  2BS3 B;  2KZR A;  3A1Q B;  4K1R B;  3DVN U;  3FAH A;  4RM9 A;  3R66 C;  3ONS A;  2C9W B;  3DPD A;  2BWF A;  2LZ6 A;  2V3S A;  1C4P A;  1EWY C;  1IGC A;  3Q6B A;  3AMZ A;  1FFU A;  2BW2 A;  2J42 A;  3I63 C;  3CF6 E;  1KJT A;  3N9Y C;  3NY5 A;  3DCG A;  4MM3 A;  1OFF A;  3O65 B;  2WGS A;  2ZJD A;  3SR6 A;  2AL3 A;  1WX8 A;  3U8Z A;  3L4P A;  2JX5 A;  3DVG X;  3VR8 B;  2QIE B;  1S3S G;  2BKF A;  1Y8R C;  3FC4 A;  3AE7 B;  3B08 A;  4W9F A;  2ICI A;  3RYT A;  2NBV B;  4EZL A;  3AEF B;  2VZK B;  2KOX A;  3ZIM A;  5EDS A;  2PEA A;  1NYR A;  2LEK A;  2N7J A;  4GXB A;  2NBU A;  4FBJ B;  3DBH B;  2L52 A;  2LUE A;  3L0W B;  4K7U A;  1J8C A;  2LVP A;  3PHX B;  1L4Z B;  3EUB 2;  2BKR B;  1L6U A;  1TTN A;  3AEA B;  1C78 A;  1CQV A;  3UIN B;  2IGG A;  2INN E;  3IHP C;  2DAF A;  5BMG A;  4ZHO A;  1VRA B;  1EM7 A;  2KN4 A;  1WYW B;  3U7D A;  3TL5 A;  5FR6 A;  1UWM A;  1V6E A;  2IDY A;  2AEH A;  4BAX A;  2NPT B;  1A5R A;  1FRR A;  1QKZ A;  1NDD A;  3MHZ A;  5D3I B;  1XLP A;  3V3X A;  5LLI A;  2BTE A;  3NS1 A;  5J17 A;  2WX0 A;  3MJ5 A;  1WXA A;  1QZE A;  4LK0 M;  4LNK A;  1VLB A;  2KMM A;  1FEH A;  3ETR A;  2KKC A;  2JWZ A;  4HEA 1;  1EUV B;  1WJU A;  2AL6 A;  4KIK B;  2N1W A;  1WF9 A;  1C76 A;  4N9F 4;  2Y3A A;  1OQQ A;  1RFK A;  1TS3 A;  3E9S A;  1RAX A;  1OQR A;  2KTF A;  3AXC A;  1FM0 D;  5BMH A;  3H7P B;  3P63 A;  1K51 A;  5IAA C;  5IOI A;  3SEB A;  4HVB A;  1ROE A;  2JQR B;  5AUI A;  1JRU A;  1OTR B;  2DAJ A;  3R7Q A;  2KLC A;  3AE5 B;  1XF5 L;  2GMI C;  1WXQ A;  2MP2 A;  4N59 A;  2DYM A;  3P4R B;  4M00 A;  3AE2 B;  3J9C A;  4K7W A;  2C7H A;  3T3O A;  3NOB A;  4K7S A;  1MFW A;  5IA7 A;  3FKY A;  2KAC A;  4Q2J A;  3VUY A;  1WJN A;  2BBC A;  2ACZ B;  3NJT A;  2GBK A;  3EEC A;  4I6L B;  2QDF A;  1TZO A;  1UGJ A;  2RDG A;  1EF1 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  3ZRF A;  2FUG 1;  2K39 A;  3LXF A;  2AQ1 B;  4WWO A;  4MSM B;  1WWT A;  3ZJU A;  4GDL A;  4MGI E;  2PMV A;  3W2D A;  2R2Q A;  2UYZ B;  4AS1 A;  2WDQ B;  1TY0 A;  1WE7 A;  4HJG E;  1E5W A;  4LNF A;  1XT9 B;  2KTR A;  2K0P A;  2MBO A;  4I6N B;  1X1M A;  4RGN A;  4BOZ B;  2MBB B;  4BOS C;  2K22 A;  4A8X C;  3DHH C;  5DPW A;  2K25 A;  3SFD B;  3U52 E;  2V9H A;  1PGX A;  1PYW D;  3V6E B;  3P4Q B;  2BB5 A;  1ZXI A;  3QA8 A;  2G4D B;  4QAY A;  1YN4 A;  1VZ7 A;  3PT2 B;  2MH7 A;  5BYQ A;  1JWB D;  3PZ7 A;  3MFG A;  5DPT A;  4YSX B;  1CK1 A;  3PRZ A;  2DNF A;  2JYT A;  3AEE B;  1RLF A;  2B3A A;  1EF5 A;  3ZNG C;  3VTW A;  5E6P A;  3APD A;  3LB8 C;  4GGQ A;  3BZD B;  1C77 A;  4LLG M;  3A9K A;  4B9K A;  2C7M B;  1PQS A;  1EU3 A;  2JU6 X;  4JIO U;  4IWQ A;  3MC0 B;  1P7E A;  1S1Q B;  2QJL A;  1V81 A;  1M4V A;  3KWL A;  4GIV A;  3OG5 A;  4ZOH C;  2LGI A;  2J0J A;  4RGM A;  2XBB C;  1TKE A;  3Q3O C;  2AX5 A;  1TGZ B;  2K3U A;  3UQA A;  3OJ4 B;  4OVU A;  1D5M C;  5IKC M;  4RNA A;  4KX6 B;  1JCK B;  1SIJ A;  1WRD B;  4II2 B;  3TIX A;  4KKJ A;  4NAW B;  2J53 A;  1QOA A;  1ZDV A;  3V05 A;  1SGH A;  3RNG C;  2DYB A;  3Q3M C;  1LO5 D;  2LJ5 A;  1I7H A;  3P4P B;  1P7F A;  1T0S C;  2Y5B B;  4NJ6 A;  3C8Y A;  4X57 B;  2KQ4 X;  1WGK A;  3DDC B;  1JWM D;  2MSE D;  2CS4 A;  4UDU C;  1WRI A;  2DHZ A;  1SXT A;  4LNO A;  2KWD A;  1SE3 A;  2IGD A;  1UUP A;  3Q8E A;  2CU1 A;  1ZUD 2;  2LXA A;  2RDB C;  3IG3 A;  3I9V 1;  3AEB B;  4RCO A;  1UH6 A;  4MH0 E;  5BO4 B;  2KJR A;  1ZKH A;  4G50 A;  1K8R B;  1KTK A;  3EA6 A;  2O2V A;  5JH5 C;  3M63 B;  2HE7 A;  2WU2 B;  2LJI A;  3BY4 B;  3ZQ4 A;  2RR9 A;  5G5G A;  1VD2 A;  2FUH B;  2I2Y A;  4YTP B;  1F2R C;  4R3D A;  3IFW B;  1F2R I;  3L13 A;  2WX1 A;  3L16 A;  2KN5 A;  1N6Z A;  4WWP A;  4P1C C;  2QEJ C;  3L17 A;  1WE6 A;  4WAA A;  2OED A;  1E0Z A;  3KUC B;  4IW0 A;  2RPV A;  2LHD A;  5TR5 A;  5H8Y E;  2FID A;  3H1U A;  4US9 A;  3HK0 A;  4MEL A;  3I5J C;  3QHT A;  3W9C B;  1LGR A;  2NBW B;  3R7R A;  3PRP B;  2R61 A;  1HE8 A;  3TEZ A; 
#chains in the Genus database with same CATH homology
 4NQK E;  2KWC A;  4JGH B;  3WA0 A;  4GDK A;  5JZE B;  4CHK A;  2PJH A;  3KUZ A;  5DCN A;  2L00 B;  1GC6 A;  2DZM A;  2MBQ A;  1MG8 A;  2N9X A;  4FHJ A;  1I42 A;  1UZX B;  2CHW A;  5LXH A;  1ISN A;  2KFK B;  3NZS A;  4I6P A;  2IY1 B;  3H7P A;  5CHW A;  4A3O A;  2GBM A;  4BBN F;  4TKN A;  1WIA A;  3SD5 A;  2UWQ A;  3DOW A;  4BKT A;  4EZJ A;  2CKH B;  2JZZ A;  2RSU A;  1V80 A;  4J6I A;  4W9K A;  2KZR A;  3A1Q B;  2XEW A;  3DVN U;  3EHV A;  4K1R B;  3A1Q A;  1V2Y A;  3VUX A;  2KDI A;  3VTU A;  3CSF A;  4BFR A;  4LDT B;  4RM9 A;  3R66 C;  4DWF A;  3ONS A;  3AI5 A;  2C9W B;  4HK2 A;  2GBR A;  3DPD A;  2BWF A;  2LZ6 A;  2V3S A;  2Z0D B;  2KK8 A;  1YX6 B;  5KHQ A;  2G3Q B;  2MCN B;  1IYF A;  4W9C A;  4ZRI A;  4DHJ B;  4G3X B;  3PSE B;  1ZW7 A;  4NPN A;  4ANX A;  2K6D B;  1R4N I;  3JSV A;  2QHO A;  1YX5 B;  1J19 A;  3N30 A;  4BVU C;  3SU8 X;  4EEW A;  1WM2 A;  2NS5 A;  3QX1 A;  3RCZ A;  3CF6 E;  1KJT A;  3NY5 A;  2D07 B;  1LXD A;  2MBE A;  1RFA A;  3DCG A;  2NCN A;  3MJW A;  3O65 B;  4MM3 A;  3TCA A;  2ZJD A;  1C3T A;  3K9O B;  3M3J A;  5DPR A;  3TJP A;  3DQV A;  4EFO A;  3ALB A;  2AL3 A;  3T9L A;  1AAR A;  1UBQ A;  4HDO A;  1WX8 A;  3U8Z A;  1ZGU B;  3ZDM C;  3APC A;  4BKG A;  3IBE A;  4CO7 A;  3KH0 A;  4HDQ A;  3DVG X;  5JHA A;  1E7V A;  1Z2M A;  2KD0 A;  2BF8 B;  2ZNV C;  3KYC D;  1KLV A;  3WAN A;  3HM6 X;  4MGY E;  1S3S G;  2BKF A;  1Y8R C;  4OVV A;  5L95 C;  4LJP B;  3PZD A;  2JT4 B;  3B08 A;  2JPH A;  4W9F A;  3RYT A;  2NBV B;  4EZL A;  5D94 A;  1WM3 A;  3ZTD A;  3HHM A;  3PLV A;  2FIF A;  4DHJ D;  3GOE A;  3LJ3 A;  5G55 A;  2KOX A;  3ZIM A;  5EDS A;  2PEA A;  2HJ8 A;  3VDZ A;  1WR6 E;  4W9I A;  4NY0 A;  2K6Q A;  3NHE B;  1YQB A;  4GXB A;  3WAL A;  2NBU A;  4AWJ A;  4BKS A;  1WX7 A;  4FBJ B;  1G6J A;  2FCM A;  2I1K A;  2LUE A;  3H7S A;  4IM3 A;  3WAM A;  4EZK A;  4ZDV A;  4KDI C;  3L0W B;  4K7U A;  4ANU A;  2MLB A;  4XX5 A;  3DBL I;  1WH3 A;  3A9J A;  2DZJ A;  4TUU A;  1WR1 A;  4BKS D;  2RPQ A;  3DBR I;  2LVP A;  3ML8 A;  3PHX B;  1J8C A;  2BKR B;  2MQJ A;  1GNU A;  2LRU A;  1E90 A;  1E8Y A;  2JVC A;  3SHQ A;  2LXC A;  4F1S A;  4FN2 A;  4AP4 C;  2JF5 A;  1TTN A;  2G4S A;  4II3 B;  2KMC A;  3UIN B;  4HCP B;  4MGZ E;  3IHP C;  2DAF A;  4AJY B;  3OJ3 A;  3UGB B;  2KDE B;  2WYQ A;  2M8S A;  1WYW B;  2N7E A;  3U7D A;  2O2V B;  4JQW C;  4PS3 A;  3TL5 A;  5FR6 A;  1V6E A;  2JRI B;  2KWV B;  2AEH A;  2NPT B;  3A4S C;  1A5R A;  3RT3 B;  4EUT A;  3QAR A;  4HLE A;  3U30 A;  1Q0W B;  3A33 B;  2PE9 A;  1NDD A;  2GBJ A;  2N4F A;  3V62 A;  4EKU A;  3H9D A;  3QQ8 B;  2V4L A;  4HXD A;  4ZYN A;  5LLI A;  4DHZ E;  4GOC A;  5J17 A;  2R2O A;  2WX0 A;  4LDT D;  2KAN A;  4ICV A;  1WXA A;  1QZE A;  3V61 A;  2D10 A;  4NJ7 A;  3ZW3 A;  2KKC A;  4MJS B;  2JWZ A;  4AOF A;  1P0R A;  4A3P A;  3L54 A;  1EUV B;  1WJU A;  1H4R A;  2AL6 A;  3JVZ X;  4GU2 A;  4AUQ C;  4DBG A;  2LAS A;  3MHS D;  2LGD A;  3RD2 A;  2KNB A;  4BBN C;  2KTR B;  4KZC A;  4F8C B;  4KIK B;  4W9E A;  4TQ0 A;  2N1W A;  4GB9 A;  3APF A;  1FXT B;  2M1M A;  1WF9 A;  3K9P B;  5E6O A;  4E74 A;  4ZRJ A;  4N9F 4;  1XD3 B;  2CHX A;  2MW5 A;  1GC7 A;  2ZZP B;  2ZCC A;  1RAX A;  1OEY J;  4GDL B;  1F9J A;  2KJH B;  2KTF A;  3AXC A;  4FHK A;  5E6N A;  2HTH A;  3H7P B;  4IM2 A;  3PTF C;  3VAW A;  3W1S A;  4TV3 A;  2CR5 A;  3QAQ A;  2DX5 B;  4IWO A;  5IAA C;  2G45 B;  3P2B A;  4HVB A;  3KYD D;  3UF8 A;  4MGK E;  1L2N A;  2KX0 A;  1IP9 A;  1JRU A;  2W9N A;  3IVF A;  1OTR B;  1WJ6 A;  2DAJ A;  1LM8 B;  3R7Q A;  2KLC A;  2HD5 B;  4JL9 A;  2GMI C;  2V1Y A;  3KVF B;  1YD8 U;  2KX3 A;  2L76 A;  4XC2 A;  2MP2 A;  1OQY A;  1NBF C;  2KVR A;  2DYM A;  4AJW A;  1V5T A;  4K7W A;  1UBI A;  3M95 A;  1VCB A;  1V5O A;  3NZU A;  2C7H A;  3PGE A;  3NOB A;  4ANV A;  2NPT A;  4K7S A;  1R4M I;  3D32 A;  3VH4 B;  2KDF B;  1E8X A;  5IA7 A;  1UGM A;  2KO3 A;  1WGY A;  2OJR A;  3VUY A;  3ZNZ B;  1WJN A;  4W9G A;  2I1J A;  2KFJ A;  2ZCB A;  2MWS B;  2MRP A;  4G0N B;  3VTV A;  2GBK A;  3EEC A;  4I6L B;  2N1V A;  3S2A A;  3ZDT A;  3CST A;  1UD7 A;  1WI0 A;  1M94 A;  1WGH A;  1WZ0 A;  2DEN B;  2ZNV B;  4LJO B;  4F7Z A;  3L08 A;  2J7Q B;  2MP2 B;  2O6V B;  2K1F A;  1EF1 A;  1OEY A;  1OGW A;  4FLH A;  2ASQ A;  5AZF A;  3ZRF A;  1E8W A;  4RMA A;  3PHW B;  2NVU I;  2K39 A;  2L0T A;  3ZO5 B;  4PYU A;  1Z5S B;  1WX9 A;  2LRW A;  3V6C B;  3AU5 A;  2AWT A;  4PS8 A;  4URK A;  4WWO A;  4MSM B;  4DDI D;  2BGF A;  1IPG A;  3QJZ A;  1WJ4 A;  4FUL A;  1V9J A;  2ZEQ A;  1XQQ A;  2BPS A;  2M4N A;  3TBL D;  4WJO A;  1GJZ A;  3LDZ E;  5D2M B;  1I35 A;  3B1L X;  5HKH A;  3R3M A;  4GDL A;  4E3C A;  2KC2 A;  3HIZ A;  5G2N A;  3MTN B;  4MGI E;  4FJY A;  1NI2 A;  4PS7 A;  3W1Y A;  2K8C A;  2R2Q A;  2UYZ B;  4W9H A;  2J0M A;  2FAZ A;  1WE7 A;  3SDL C;  4XZ4 A;  1WXV A;  1E5W A;  2AYO B;  2ZPY A;  3PLU A;  4FJV B;  2GOW A;  2L3Z A;  3KUD B;  3WAP A;  1XT9 B;  3RZW C;  3PRE A;  2IY0 B;  2KTR A;  2FNJ B;  2MBO A;  3EC8 A;  3JW0 X;  3QC8 B;  4I6N B;  1X1M A;  2NR2 A;  2IYD B;  3VUW A;  3NS8 A;  4BOZ B;  3DBH I;  3JYU A;  4W9L A;  2MBB B;  4BOS C;  5AZH A;  5D7G A;  3OAW A;  3RUL A;  3ZUN A;  4FJZ A;  5DPW A;  4WQO B;  3ML9 A;  4WJN A;  2LI5 A;  2K25 A;  4B95 A;  2XK5 B;  1WMH B;  2IO0 B;  2KQS A;  2DZI A;  2BYE A;  2JUO A;  4IUM B;  4KV2 A;  4FAD A;  1WFY A;  3ZRC A;  3Q3J A;  3V6E B;  1Q5W B;  3GZN I;  5C23 A;  1V49 A;  5D6J B;  3QA8 A;  2C5L C;  2G4D B;  3UQB A;  1J0G A;  1LFD A;  2CHZ A;  2JZ3 B;  3AUL A;  3ZKJ C;  4EOY A;  2LD9 A;  2LWP A;  2N7D A;  4GDK B;  3VFK A;  4E71 A;  2WWZ A;  4MJS A;  2O6V D;  3PT2 B;  4IC7 B;  1TZ1 A;  4GN1 A;  2XK5 A;  3ZNH B;  1GG3 A;  5DPS A;  2KQ7 A;  4NNJ B;  2O6V A;  2OOB B;  5DPT A;  3ZNI D;  2Z59 B;  3PRZ A;  3N32 A;  3JSV B;  1KOT A;  3WIM A;  1RLF A;  2B3A A;  1EF5 A;  3QWZ B;  3ZLZ A;  3VTW A;  2L0F A;  3ZNG C;  2FCN A;  5E6P A;  4DDG D;  1H8C A;  1P3Q U;  3OLM D;  4M8M A;  2YVC A;  3APD A;  3PRM B;  4NQL B;  5J2R A;  4W9D A;  2DYO A;  1SE9 A;  4GGQ A;  3DVN V;  1P1A A;  2BYV E;  1YJ1 A;  3PV1 A;  2IBI B;  5C1Z A;  1WXS A;  3TMP B;  3A9K A;  4B9K A;  2C7M B;  2FCQ A;  1PQS A;  3BIN A;  3PPA A;  2WDT B;  3H6N A;  3QK0 A;  4JIO U;  2LVO A;  2IZV B;  5AEK B;  4IWQ A;  3ENE A;  4KVG B;  1L7Y A;  1D3Z A;  4HJK A;  1S1Q B;  4ICU A;  3A4R A;  4DK5 A;  1V81 A;  1LQB A;  1T0Y A;  2MBH A;  4PYZ A;  1E7U A;  2M17 A;  2MX2 A;  4GIV A;  2C7N B;  4DHZ B;  3A9J B;  2PPH A;  3DBS A;  2KFK A;  3KW5 B;  3VVW B;  2J0J A;  1P98 A;  2XBB C;  4KIK A;  2EMS A;  4KDL B;  4GMV A;  2IO3 B;  1TGZ B;  2J0K A;  3UQA A;  3OJ4 B;  2IO1 B;  4OVU A;  3T8M A;  1RRB A;  4G11 A;  4NAW A;  2D11 A;  5KHO A;  1GUA B;  1WMH A;  4IWP A;  3N3K B;  1SIF A;  2EMT A;  1WRD B;  4II2 B;  3TIX A;  2KHW B;  4ASW C;  2KXJ A;  4NAW B;  1SGH A;  2DYB A;  1BT0 A;  4MSQ B;  2YLM A;  4GSW A;  4A20 A;  2M0X A;  5J18 A;  2FCS A;  2IO2 B;  2N9E B;  2LJ5 A;  4LCD E;  4P7I A;  3VH3 B;  2L7R A;  4HCN B;  2BWE S;  4WJQ A;  2Y5B B;  4NJ6 A;  4X57 B;  4DXA B;  5JHB A;  1CMX B;  3ZVV A;  3VQI A;  1KM7 A;  5CHV C;  3DDC B;  2RGF A;  3V60 A;  2MSE D;  3ZTC A;  3WAO A;  1WGG A;  2JXX A;  5GMV A;  5L83 A;  1Q1O A;  2CS4 A;  2DHZ A;  2REX A;  4HPL B;  4HPM B;  1WXM A;  2LGX A;  4M8N A;  1E8Z A;  1YIW A;  2KDB A;  3I3T B;  3PVL A;  2KMA A;  3M62 B;  3HM3 A;  2KWU B;  2VRR B;  2Z0E B;  4K81 A;  1EO6 A;  2JY6 A;  2ZVN A;  4WWN A;  4B6W A;  3Q3F A;  3QCA A;  2CU1 A;  4ANW A;  2LXA A;  2N9P C;  3VHT C;  2L8J A;  3IG3 A;  4JLC A;  1WGD A;  4KSL C;  1UH6 A;  4CYE A;  4MH0 E;  5BO4 B;  2ZPN A;  2KJR A;  3B0A A;  3ECI A;  2C60 A;  3QIJ A;  1ZKH A;  1TBE A;  4G50 A;  1K8R B;  4WJP A;  2A5U A;  3AU4 A;  5AZG A;  2O2V A;  2KLG A;  5JH5 C;  2EKE C;  3M63 B;  2HE7 A;  3VXW A;  3C0R B;  5CTR C;  2D2Q A;  3BY4 B;  4KSK C;  4FA6 A;  3X0W A;  2RR9 A;  2GBN A;  1WGR A;  1VD2 A;  3RZF A;  2K8H A;  3X23 A;  4RM8 A;  2FUH B;  2BYF A;  2L05 A;  3W1S C;  1C1Y B;  2PE6 B;  5CX3 A;  4YL8 A;  1UEL A;  2JRH A;  3IFW B;  3L13 A;  2WX1 A;  3L10 B;  2LGY A;  3L16 A;  2ZVO A;  4HWI B;  1V86 A;  2KN5 A;  2LVQ A;  3RUI B;  1WZ3 A;  2K8B A;  4WWP A;  4TQ1 A;  4ZRK A;  2A4Z A;  3L17 A;  1P9D U;  4W9J A;  1WE6 A;  3UIP B;  2DZK A;  4WAA A;  1U4A A;  3KUC B;  3PS6 A;  2RD0 A;  5CHF A;  4IW0 A;  4KZ0 A;  3EFU A;  3CMM B;  1WY8 A;  2MA9 B;  4M0W B;  5TR5 A;  3UIO B;  2FID A;  3H1U A;  3A9K B;  5LXI B;  3HK0 A;  2D3G A;  3DVG Y;  4IM0 A;  3QHT A;  4MEL A;  4MDK E;  4MEM A;  2NBW B;  4IG7 B;  3R7R A;  3PRP B;  1HE8 A;  2KJ6 A;  2KC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...