1V6KA

Peanut lectin-lactose complex in the presence of peptide(iwssagnva)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 55
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6kA00
4FQZA 3H0OA 3O12A 4Y26A 1LEMA 3W59A 3NV4A 4Y1XA 2I2SA 1DQ5A 5JLVA 1AJOA 1W6OB 2GNTA 2VXRA 2TEPA 3RQ0A 1J1TA 1F5FA 1G9FA 1C1LA 2PHWA 4XMIA 1YO8A 4LBNA 3RRDA 4BM8A 1SCSA 2W68A 1LENA 2P3IA 2Z42A 2P3JA 3PMEA 1FX5A 5T5LA 4C1XA 3OYWB 3MPPG 4YW2A 3I8TA 4FVVA 4FPGA 3ZXKA 3OGGA 1W6MB 2OVUA 4Y20B 1FYUA 2Q5TA 1O4YA 2ARXA 4AGVA 3O0VA 1S0FA 3AXEA 3RMXA 5T5PA 3FUQA 2GNDA 4LBOA 4PCRA 4BLIA 2D3PA 1QGLA 4JRAA 1KJLA 2ZGLA 2WLQA 5GM0A 2NZ9A 3V0AA 4Y24A 1MS8A 3VV1A 4GWMA 1MVEA 2ZACA 3AYDA 4JCKA 5IT6A 4FPHA 4Y22B 1FV2A 1DFQA 3WG2A 3R4SA 3WHUA 1DQ0A 3M3EA 4AGGA 2ZGOA 4GWNA 5DUXA 2DTYA 4UW4A 3AP4A 4PBPA 4AWDA 4R9AA 4CZSA 1DLLA 1LTEA 4FPCA 3ZYRA 1V6LA 2A3YA 2BQPA 3VKNA 1YI7A 1S0CA 4Y1UA 4K20A 3OY8A 4M01A 1LOBA 1AX2A 1H9WA 2DVFA 2XB6C 1ULEA 5E8AA 3L2YA 4FPFA 3ZYPA 4XJUA 4FPLA 1WBLA 4WZFA 3VKOA 3FLTA 2ZABA 2DYCA 2AREA 1IOAA 2NMNA 5HCFA 1S0BA 4YM2A 4M3CA 5AVAA 2ZBJA 3IPVA 3WLUA 1G7YA 1GICA 2JE9A 1SACA 1QNWA 4XTPA 1GLHA 2DUOA 4K1ZA 5H9RA 3T1LA 4GA9A 3WDVA 1G9CA 4HL0A 4AVVA 4XIKA 1BXHA 1LESA 1DBNA 2ZMNA 1GYKA 2H0BA 3AZZA 4YZ4A 3C2UA 5GZFA 3I4IA 2A6ZA 5LK5A 1JHNA 1N1YA 1WD3A 4XMAA 3SH4A 4ITCA 3U4XA 2D43A 1GZWB 2E7TA 1MZ5A 4YM3A 2CY6A 2R49A 1I3HA 2D6MA 2C9AA 2D6PA 2YROA 1D0HA 1SLLA 4R9CA 4XJAA 1EPWA 1G9BA 4MYEA 1QDCA 2A70A 2AR6A 4ZKTB 3IM0A 1CVNA 4F83A 1DQ1A 1KJRA 1CQ9A 1PZ9A 1LOGA 5HCAA 3OPZA 4M3CE 1FAYA 1WCSA 1ONAA 2ZMLA 2D6KA 3LCPA 4XZPA 4JC1A 4DRVA 1ENRA 1IS4A 1W6MA 1SLBA 3AX4A 4Y20A 2PELA 3OBRA 4FOWA 2WT0A 1UN1A 1UPSA 1Q8OA 2OW4A 3CNAA 3SISA 1V6JA 3VKLA 3WCSA 1C57A 2YZ4A 1LU1A 3D5OA 3LSEA 4XXPA 5IK5A 2GALA 5GJ6A 5IK4A 1V6IA 2EXJA 1WW7A 3KM5A 3ZSKA 1DYKA 1ULDA 1RINA 3DGTA 1A78A 4FPEA 1KDMA 2KM2A 1CR7A 5H9SA 1YYNA 2ZZJA 1MS9A 2DTWA 4AVSA 1FNYA 3PVNA 4XHBA 5KXEA 3UL2A 4YG6A 2W52A 4P9XA 2CTVA 1WBFA 1GV9A 1VALA 4NOTA 2P34A 2ZKNA 4DPNA 1G9DA 1CJPA 1SCRA 4YM0A 1Q56A 3IMNA 3HN1A 2ZMKA 2D3RA 3ZPYA 4H55A 2GMMA 5EYXA 1VAMA 2W08A 2XG3A 2JECA 2ZHMA 1A8DA 1W6QA 5DG1A 4RA0A 1UL9A 4I30A 1JUIA 3VUOA 3MW2A 1HKDA 5T52A 3AYAA 3WNXA 1B09A 2WQZC 4XBNA 4Y1ZA 5GLTA 1FV3A 2AGSA 1JW6A 4SLIA 5F5QA 1SLAA 5CNAA 1N3QA 3RSJA 4BPZA 3IN9A 2UURA 3AZWA 5GLWA 4LBKA 1WLCA 2A7AA 5GLVA 5DZGA 1WW4A 5F9TA 1Q8QA 3BODA 2EXHA 2UWAA 3R05A 3ZXEA 1AZDA 2EXKA 3ZXJA 2DU1A 3JU9A 4XTMA 1R1ZA 4LBLA 1MVQA 4U2AA 4Y1VA 5GALA 2DVBA 4BQ1A 2ZGQA 3ILNA 5KXDA 5IK7A 1UZYA 2A5ZA 2ZGKA 4GXLA 2D6NA 3AP7A 5GZCA 1AX1A 2E7QA 3NV1A 4GKYA 3SITA 3WG3A 4AGRA 3WUDA 2P2KA 3AP5A 1MS4A 3ILFA 1DZQA 2GNBA 4Z8BA 3AZYA 3GNEA 5GLZA 4FPJA 3AP6A 2WSVA 1PZ8A 5DZFA 4LBJA 5HCBA 2GN3A 4YZ2A 4DFSA 1MS5A 3V0BA 4FOVA 1ZA4A 4FP2A 1GNHA 1QMJA 2EIGA 1JXNA 4LBQB 2AENA 4DS0A 2VW1A 3IKWA 1AJKA 1GZ9A 4Q8KA 1ULGA 4IQPA 1WUVA 3MW3A 3WUCA 1CPMA 1H9PA 3T2TA 1GZCA 1APNA 2ZGUA 3ASIA 1BKZA 1S0EA 3ZSMA 3N7KA 2JKBA 1W6PB 1CONA 5EYYA 4YW4A 3N35A 4U36A 1S0IA 1JYIA 3ZXLA 3USUA 1S1AA 2W39A 5DUWA 3N3HA 2RHPA 1KDKA 5CB7A 1A3KA 2PHFA 1W0OA 3R4UA 1SLIA 4XBQA 1DHKB 1UZZA 1RIRA 2WKKA 3B3QE 5DXDA 5KXCA 3ATGA 2NP0A 1UKGA 2D6OX 2R1DA 1F9KA 2DVDA 3BTAA 2ZA9A 2WT2A 3M2MA 4ATFA 1UMZA 1QOOA 1CESA 5JOYA 2VY0A 2AYHA 2VW0A 1N1TA 3BOPA 2G4IA 4YGEA 3OJBA 4YGCA 1IKQA 3MEPA 4P14A 1G8WA 2GMPA 3W58A 4CRQA 2E51A 4YGBA 3O0WA 3KQRA 4R9DA 3B69A 4BMEA 1C4RA 1S0JA 5EXOA 3SH3A 1BYHA 2A3XA 5JOXA 1NXD1 3AYEA 2ZGPA 4FPYA 4AYUA 1JOJA 1ULFA 1YIFA 4L8QA 1WW6A 1W6OA 2SBAA 4M00A 3V0AB 2A6VA 3VKMA 4ASMB 3FUOA 1GANA 1F31A 3FLRA 1KQRA 2P3KA 3WDTA 1DQ4A 2A71A 3OYWA 3WVJA 3WDUA 1LOAA 1LCLA 2FHRA 3FLPA 3WZ1A 1BQPA 1OKQA 1LGBA 1C1FA 2PHTA 2PHRA 1IS3A 2ZGRA 3NV2A 4XHXA 3WDXA 1JBCA 1OQ1A 2WT1A 4WVVA 3BIWE 1LGNA 1IS6A 4BLJA 1UX6A 2A6YA 4YZ1A 1LEDA 3LSDA 4AVTA 3OY8B 2OUJA 1Z0HA 5JMCA 2JJ6A 2VW2A 3HMYA 4Y22A 1O4ZA 2YMZA 4XJ8A 4DQAA 1SLTA 4XXAA 5DUUA 1MS3A 1QOTA 3WV6A 2A6WA 2JE7A 4OZXA 4WVWA 4YW3A 1LHOA 2GMEA 3UJQA 4M3CB 3ZSLA 1BJQA 1RITA 2NYYA 3IPVB 2DUQA 5T55A 3TAYA 1X50A 3ILRA 1JYCA 3N7JA 1LU2A 3PJQA 1N3OA 2VUAA 2PHXA 5H9QA 3WDYA 1MACA 3AZVA 1Z78A 1MZ6A 1YXWA 2GN7A 5JVVA 3V65A 3WCRA 5JDBA 3SLIA 4YGDA 2SLIA 4XJ9A 1W6PA 1DGLA 2E53A 4FOYA 3ZVXA 4FOQA 5CA6A 1WD4A 2ZGTA 2CWMA 1LOFC 2YV8A 4ATEA 4NO4A 1LULA 2FMDA 3AZXA 4FP3A 4Q1PA 3N7LA 3SNMA 1VIWB 3NV3A 2JD4A 2EAKA 4PF5A 4Y1YA 4YM1A 1SLCA 4XE9A 3PVOA 1V6MA 1FATA 1NLSA 3D6EA 4UW6A 4XIOA 1AXZA 4GKXA 5T54A 2V73A 1FNZA 1V6NA 1DQ6A 1ENQA 3Q9OA 2V5YA 4M3CF 4Q26A 4XBLA 4YLZA 2ZAAA 1V6KA 4D69A 1W6NB 2AH2A 2DUPA 4LBQD 1Q8SA 2PHUA 1QNYA 5IUQA 3AXDA 4PQ9A 1UAIA 4C1WA 3AK0A 3WG4A 2ERFA 3WHTA 1GBGA 5FRAA 2D7FA 2EF6A 5T5OA 3JUUA 1IKPA 1GZWA 2D3SA 1DQ2A 1Y7BA 3FFZA 4RL7A 5GLUA 2JDZA 4YFZA 5H9PA 4K1YA 1CPNA 1BZWA 3N7MA 1G86A 1N1VA 3A0KA 4YG0A 5T5JA 4ISQA 3AP9A 4FQ4A 5GZDA 2DVGA 3RMYA 2WSUA 2P37A 4FPKA 4UW3A 2EALA 1AX0A 2ES3A 1S0GA 1AXYA 1H30A 4HANA 4XDQA 3AYCA 1N3PA 2NMOA 1KITA 1ZM1A 4P9WA 2A75A 1W0PA 1SFYA 2D6LX 1WLDA 3PVEA 1Q8PA 2DV9A 4PBOA 1LECA 2YXSA 3M1HA 4K21A 4W65A 1QOSA 2UWBA 5T50A 4BMBA 1HDKA 2R0FA 4YFWA 2GNMA 1CIWA 1HQLA 1W6QB 1WW5A 2WNEA 3AJZA 2ZGMA 1LHWA 1AXKA 1SBFA 5BYNA 3O0XA 4BOWA 4TZDA 3OBTA 4YW5A 1MS0A 3QLQA 2CYFA 1V6OA 1LHUA 4ZXKA 3APBA 1GNZA 3MW4A 1LHVA 4YW1A 1TEIA 5JOWA 1D2SA 2DWRA 3QCWA 2VH9A 1U0AA 1AVBA 2DVAA 2LALA 4LBMA 3B01A 1HLCA 2A3WA 3NWKA 1G9AA 2YY1A 3A0NA 4XOGA 3WG1A 2B7YA 5EWSA 1AF9A 2ZHNA 3D4KA 2HYKA 5CAZA 1S0DA 2CL2A 3V64A 2DU0A 3B00A 3SH5A 2WJSA 5GZGA 1MS1A 3ZSJA 1GKBA 1LOEA 5E89A 1URXA 1OFSA 2EXIA 4FPOB 1XQNA 4Q27A 1DYPA 3INAA 3AJYA 1QKQA 2A6XA 5DG2A 5L73A 2C5DA 1I1EA 1CN1A 1V00A 5JOZA 1VLNA 2ARBA 1JN2P 2ZHLA 2R16A 3WOGA 2E6VA 3V0BB 2ZHKA 2R1BA 3O5SA 4TYSA 3N36A 1LOCA 1LOFA 2CWSA 2GDFA 1SBDA 1LODA 2D44A 1KRIA 1LJ7A 3ZXFA 1Q8VA 3POWA 1LGCA 2NM1A 2UU8A 3WDWA 3GALA 1YRZA 1W6NA 3M3CA 3M3QA 3POSA 3VKFC 1PZ7A 2DURA 3FBYA 4XYXA 5IK8A 3AFKA 1N47A 3ENRA 3UK9A 2R0HA 3USUB 4Q1RA 2ENRA 3A4UA 4XJZA 4YZ3A 2VU9A 4ISRA 1SBEA 5KXBA 5SV8A 2OUHA 5CBLA 3TB0A 4YZ5A 4UW5A 1N1SA 4LBQA 4KBBA 5E88A 4DRRA 4Q2FA 4R9BA 1ULCA 5FREA 5GZEA 4YG3A 3RG0A 3RS6A 2ZGSA 1DIWA 1MR5A 1QDOA 1VAVA 3DUIA 2NN8A 4P9YA 4CTEA 1QF3A 2AUYA 1IS5A 1GSLA 2LTNA 3M3OA 1QU0A 1WLWA 2ZGNA 3HR9A 1ENSA 3B9CA 3POYA 4WV8A 1HQWA 3T1MA 3UJOA 2UWCA 4XILA 2CNAA 4XJWA 4Q8LA 5DUVA 4GALA 5DZEA 1LHNA
chains in the Genus database with same CATH superfamily
1D2QA 2ZCWA 3H0OA 4A3ZA 1ASJ2 1LEMA 3NV4A 5FZDA 1ZRDA 1JTZX 1DQ5A 1UY4A 1W6OB 5FZ8A 2GNTA 5JLVA 5F39A 1EAH2 3RQ0A 1JZ5A 4HZFA 1G9FA 3RRDA 1AR72 4Q4Y1 5IVFA 2JIJA 2FDKA 5JZGB 2HKXA 1FX5A 3PMEA 4C1XA 3ZM8A 3PL0A 5C3SA 4FVVA 1I9RA 4FPGA 1F2NA 1BBT1 1FYUA 1YFYA 3K3NA 1W3VA 4AGVA 3O0VA 4RQPB 4AVBA 3ZFGC 4EN6B 1HIXA 5IVBA 2XUMA 3HJRA 1KXGA 3MICA 4JKLA 4XQ4A 2QQNA 1KS4A 1VPHA 4C8DA 1KJLA 5GM0A 2NZ9A 4GIQA 1M4WA 1MS8A 3N9PA 3VV1A 4PHZA 4X8PA 1D4M1 4FPHA 3RI8A 1YHFA 4I02A 1NZIA 4QDSA 3WG2A 1VBD2 3PUHA 4DMIA 3NRUA 1L7LA 4RHV2 5CG8A 1PHMA 3GJAA 3M3EA 2H6CA 2ZGOA 5FP4A 5FY7A 2XLFA 3WNPA 4CZSA 2IVIB 1CZVA 2QDNA 2P4EA 1TQ5A 2JENA 2VMCA 2ID4A 5FYHA 1PO11 1W2TA 1V6LA 4PT6A 5IW0A 5A6QA 4K40A 1S0CA 4K20A 5KC6A 2JG8B 1W03A 2D93A 1W9YA 1AX2A 1JU3A 3LGRA 3WXPA 1ULEA 1XC6A 3L2YA 2H6BA 5DDJ1 1WBLA 4B29A 4A4AA 4QPGB 4W6WA 2AREA 4AVCA 1COV2 1IOAA 1QJX1 2W3JA 2XQRA 4EN7B 5FPXA 3BGAA 3MUZ1 1KGYA 3EJKA 5HCFA 4GJYA 4AHWA 3O1RA 1BMV2 3X29B 2OPKA 4E2GA 2ZBJA 3IPVA 1BEV2 1ZX5A 2VVEA 2JE9A 4IV1A 1NOVA 1SACA 4K8RB 4CCMA 3ZX7A 2RDSA 5FPLA 2WS91 2VR4A 5I93A 2YGMA 5IFTA 2Y6FA 3AMNA 4XF1A 2DUOA 4K1ZA 3ZYHA 5FYUA 4QPYA 4HONA 4QGMA 2HEYF 4HL0A 5EZWA 5E1RA 3WDVA 1G9CA 2VPVA 5FXVA 1GYKA 4YZ4A 3HQUA 1R1A1 5FY8A 3RZLA 3I4IA 4FAGA 4CPBD 1UY0A 1N1YA 2BTVC 4AEMA 3M7AA 1R092 4LHSA 1RHI1 4KU8A 3DCQA 1QXPA 4QGNA 3S5QA 2WL1A 3VBRB 2CY6A 4Q0SA 3ZFFA 1I3HA 2D6MA 4FFIA 3IDEA 4OFGA 4A42A 4EJRA 1EPWA 1W05A 4N9HA 5EPAA 1T6GC 2Y34A 1CVNA 4DOUA 5F7UA 1DQ1A 3DKQA 4BIOA 3F2ZA 4AEDA 1LOGA 2WUHA 3KVAA 1PK6B 3VBUA 1WCSA 2TNFA 5FQ0B 1YQ6A 1ODMA 1OA2A 4JC1A 3I3QA 3MFCA 4DRVA 3O1UA 5BUVA 1SLBA 4IV1C 2PELA 3OBRA 4FOWA 1UN1A 4BISA 3BTYA 5APAA 3CNAA 4FXKB 1V6JA 1J58A 3BIEA 1C57A 3ZMOA 1YQ5A 1PM4A 4XXPA 1DGRN 1PO21 5IK4A 1VBB2 1ST8A 1D7PM 2EXJA 4FO9A 3KM5A 1ND2A 1RINA 2Y6KA 3I2JA 3OGRA 4FPEA 4Z82A 3RJ2X 2KM2A 1CR7A 5DAWA 1FMD1 2J42A 5K8SA 4AVSA 1Y9GA 1W8UA 4XHBA 1RXFA 3KMHA 3UL2A 1QHDA 2X05A 4DY5A 2R043 1GWMA 1AL23 4NOTA 4AI1A 4DPNA 1CJPA 1SCRA 3UNPA 1RUE2 3IMNA 2WFF3 2GMMA 3A22A 4UFLA 5J1XA 2ZHMA 2WNOA 2WO7A 2Y6GA 5KHJA 4I30A 4B7EA 2B4KA 5FZFA 1HKDA 1B09A 2WABA 2WQZC 4XBNA 1XE0A 4AEDC 3S7IA 3VBUC 5F5QA 4LO4B 4LLOA 1S2EA 5LCWL 1JZ4A 3Q8EA 3RSJA 4COWA 5GLWA 2A7AA 1RMU3 2VZUA 3ACIA 5DZGA 3WF1A 3BYWA 4FAHA 3KF3A 3E97A 4LO6B 2EXKA 5FTTC 2Y60A 4XTMA 1ND2C 2FQPA 4BQ1A 3ILNA 1RVF3 1UZYA 2VOKA 4H2AA 4HN1A 2YC0A 3RNSA 5ABJB 2A5ZA 4RGKA 1OBNA 5BNPB 3TN91 3NV1A 3SITA 3IIAA 3P3NA 3VZOA 3THPA 1RL3A 4BQWA 1CJDA 4W6YA 2DBNA 4E4SA 5ACA3 3HBKA 2ZZQA 1NG0A 2B9VA 1YLLA 5GLZA 1E5RA 3DPRB 2J1TA 2RR13 5DZFA 3ZDVA 4LBJA 3VL9A 4XFHA 3IBMA 4FOVA 4JX0A 2A73B 4RSUA 4TLGA 4LBQB 1CX1A 4COUA 2AENA 1AJKA 3CO2A 2VBDA 4Q8KA 1XE7A 4N53A 3ZFGB 4IQPA 2VVDA 3IDCB 4GH4A 5K0UA 3WUCA 2I07B 2ADEA 1ZBE3 2J1AA 2ZGUA 3ASIA 1S0EA 4AQ6A 2RS52 5HXVA 1RUC1 3HEIA 4XUQA 2JX9A 1S0IA 3ZXLA 3MGUA 1S1AA 3NMBA 1SG3A 2HWF2 2CAVA 1SQ4A 2QQLA 3DYPA 4Q5OA 5L9BA 2Y6JA 2YU1A 3UGFA 4LORA 4JDNA 3FN9A 3ZN4A 3J7HA 1OVSA 1RIRA 4CEYA 2XMLA 1KEXA 4EQVA 1W90A 1HJFA 2XH6A 3ATGA 4LQRA 2VQ0A 2JWPA 2XVKA 4COZA 2R1DA 1NY71 5F32A 1OUSA 2DVDA 3OUJA 2PLV1 4CP1A 5FOJB 4YVSA 2NQYA 3PJYA 1UMZA 3URFA 1QOOA 1O5LA 1TNRA 5AC91 1VBE3 4NR1A 2WNVC 4QX0A 4YGEA 2YYOA 3NO8A 3GDBA 3MEPA 4WM8A 4P14A 4PDWA 4QB1A 1SDWA 3JBG3 4K8FA 2BFUS 3W58A 4YGBA 2BEOA 4LA2A 4R9DA 3B69A 4BMEA 1C4RA 1S0JA 3SH3A 4AQ2A 1ZREA 3RZHA 4N53C 5JOXA 3W20A 2CGPA 1FI2A 3UESA 2HWB3 4GH4C 5K0UC 4IEPA 1XXNA 5A3OA 4AYUA 2Y6HA 2QUOA 1HJGA 1F35A 3CQOA 4M00A 2A6VA 3VKMA 5A6XA 4QT6A 2YFZA 3RZMA 3S5AA 3ZPOA 3FLRA 5DAVA 2D5FA 1J3RA 1KQRA 5EJ3A 3WDTA 5D1IA 1Q43A 3WVJA 5FR3A 1LOAA 2GAUA 5FZLA 3AVRA 2J1RA 1H6XA 4CP9A 4CEYC 3WZ1A 2NLRA 1B35C 3VDDB 5BNNA 1C1FA 1RUD3 3Q8FA 4LITA 4OHWA 4O61A 4XFBA 4W8JA 5IJRA 3SEEA 3NV2A 1VMHA 4YVSC 5LA9A 4YYOA 1C28A 1NUKA 2RM21 4WVVA 1S4CA 2DDUA 2WT1A 4KGQA 2PHDA 4JGZA 4HK9A 1UX6A 5FMOS 4YZ1A 1HXS3 1W9SA 2HWE2 5LASA 5ANNA 4WM8C 3JQXA 5C4WA 1X82A 4PDWC 5JI7A 1DF0A 1Z0HA 3LFMA 2R071 3H7YA 2RDNA 1FPN1 1WMXA 4AFBA 4Y22A 5TSWA 3DXUA 3NNFA 4XXAA 4BK4A 4Q4X2 1O3RA 1K5MA 2ET7A 4B4QA 1W8FA 4XF0A 2A6WA 3H3LA 5FBJA 2Y0OA 5BNQA 2NYYA 3IPVB 4QXBA 4IV1B 4DXZA 2Y0IA 4Q4V2 2D40A 1JZ2A 3ZR6A 2K46A 1YCIA 3N7JA 4OULA 2ILMA 5ANQA 3UGHA 3AZVA 5FZEA 5JVVA 1PGW1 1YXWA 2GN7A 5JDBA 1QWRA 3POGA 4C0BA 4QPWA 1W6PA 3NNLA 4BDVB 4FOQA 5BNNC 1JYXA 5F2SA 3KV5A 3M70A 2DFCA 4Q4W2 1LOFC 1YJLA 4NO4A 3FX3A 3HOBA 2ZX2A 1XJAA 3AZXA 4JGZC 3U4SA 2B45X 1CAVA 1QQP1 3I2OA 3SCHA 3ZFFB 4CXXA 4FI9A 5JIUA 4QPIA 1RUG2 5C4WC 3AMHA 4WZCA 4OHXA 1FATA 1H1IA 1NLSA 3D6EA 4LOSA 2O8QA 4GKXA 4M4RA 2YDEA 4EZHA 1V6NA 4FFFA 4DXRA 2W1QA 4XBLA 1MQTA 2C1FA 3J7LA 3VL8A 4P9IA 4HSJA 3R4DB 1AYM2 1OQEA 1W2OA 1K5MC 2G9GA 2HYXA 2PHUA 3POFA 4XUTA 4AEDB 3VBUB 5FZAA 2VMFA 4QXHA 4QU1A 4C1WA 3IT8A 1Q3EA 1PIV1 5FFOC 1NLRA 2EF6A 4AL9A 1D4VB 1GZWA 1QJFA 4RL7A 4XFCA 1EYBA 2P5BA 3BTXA 1NE6A 1RUI3 1PVC1 4MXVA 2R061 3TWIA 2CSGA 4DO0A 1ND2B 4YG0A 5T5JA 4A2UA 1JUHA 4LK7A 4ISQA 4ZZ5A 2RV9A 1L3JA 3J26N 2WSUA 1IQDC 1UD1A 4XFAA 1PNFA 4FPKA 3CJIA 4UW3A 4XQWA 1POV0 1LB2A 3WW2A 1AX0A 1LAJA 1H30A 3AYCA 1ZM1A 4IDZA 4LJHA 3EYPA 1W0PA 3PVEA 3KVBA 4QPIC 1J84A 3S30A 4BMBA 2UWBA 1BCXA 2GNMA 1CIWA 2WZPP 3SKJE 1GQGA 4YPJA 1S2KA 1MQTC 4HKOA 1LHWA 1RUF3 1AXKA 4KBZA 4QX1A 5A7WA 1YFWA 1AUYA 1DGWA 4JVAA 3EMRA 3IDAA 3SKVA 2XOMA 4JDOA 4NJ4A 4H7MA 1SPPB 4YRDA 1LHVA 5C7GA 4LKEA 4X6RB 1D2SA 3CIHA 3QCWA 4CDWA 3H7JA 1U0AA 1GP4A 4MGYE 2DVAA 4QD2A 5FZ9A 1G9AA 5LY2A 4NHLA 3ZYFA 2WZR1 2RJKA 4AXOA 2P6CA 5F3GA 2BGOA 4ZY9A 3BU0A 3PUAA 1SFPA 2B7YA 5EWSA 2Z4FA 1H8TB 4PI2A 5CAZA 4G9SB 3CJIC 3V64A 2VZPA 1E5IA 3J7NA 1O8SA 3JD72 5GZGA 3J8F3 1MEC3 1TMF2 5K7PA 1MS1A 1JZ3A 1UZVA 3OEBA 2BGPA 4QXCA 2PMWB 2EXIA 2YU2A 1A34A 1XQNA 5CFDB 3AC0A 3INAA 1HRI2 2RVAA 5L73A 3NVCA 2JIGA 4ARXA 3LDRA 4DXTA 4GD4A 4ZS3A 2VZ1A 3JB4C 3O5SA 3NL1A 1V70A 2JDPA 2JDYA 1SBDA 2XBO2 1LJ7A 1W9TA 1Q8VA 4N53B 3ROUA 2PAEA 1ASJ1 2QQMA 2UU8A 2B9UA 4GH4B 1Z7S2 2HWC2 1DYOA 4G4FA 5K0UB 5C3QA 1REFA 1EAH1 4CDWC 3POSA 4KNCA 1AR71 2IXHA 4XYXA 1WCKA 3AFKA 2WO3A 3UK9A 1W2NA 4YZ3A 3THDA 5L7OA 1Y4WA 2MEV2 3KCYA 1QJU3 4YZ5A 2KD7A 4CEYB 2VNRA 5F5IA 4KBBA 1AR82 4R9BA 2ZXQA 3BVCA 1LKNA 5FYCA 3SEPA 1X8MA 3ZSEA 3C7EA 3RG0A 2BWAA 4JHTA 1OH3A 1QDOA 4AW7A 2LUWA 2NN8A 2VECA 5FJHA 1IS5A 1CD3G 3W5MA 1QH7A 4IV3A 2Q8OA 3C7OA 4WM8B 5EIYB 3B93A 1SFNA 4TXWA 1H4GA 4V1PA 4NHKA 2Y8KA 3TNQA 5A3MA 5FZBA 3B9CA 3MF6A 3MV11 4R4XA 1F15A 4WV8A 1HQWA 1VBD1 3UJOA 3W5NA 1J59A 4RHV1 5ISLA 2XPJA 4Q8LA 5DUVA 3VZKA 4ZU7A 4JGYA 4D6QA 4UT5A 4QQHA 3K51A 3UKNA 1VR3A 4MVTA 4WVMA 4Y1XA 3W59A 2CV6A 3CMGA 2ADDA 2CDPA 2Z79A 3GYDA 3FZ3A 1F5FA 1OF3A 2WWJA 3AL6A 2AACA 4P9GA 5DAQA 4A45A 2BV4A 3VD3A 1K5JA 5L7OC 4HSLA 3MLLA 5T5LA 5F3EA 4YW2A 3I8TA 3ZXKA 1W6MB 4LKFA 4CP9B 2XWBB 3IAQA 1COV1 3QOPA 5BNNB 2JG9A 3WINE 2BBVA 5JMOA 4QM8A 1GQPA 2EVXA 1BVP1 3PUIA 4IEYA 1BMV1 1AYN2 4C91A 2Q8EA 1BEV1 4NWWA 4EWAA 3LOBA 2D3PA 1EV13 5J37A 5IAXA 4A6OA 4EWEA 4JRAA 3V0AA 4IV3C 5KHHA 2PQSA 3C7HA 5FXWA 1QXRA 1TME3 5K9YA 4GWMA 3D0JA 4FXGB 4Y22B 2DF7A 2G9FA 4ES8A 1AHSA 5FYVA 1K5MB 3R4SA 5FLJA 3WHUA 4JGYC 2OA2A 5AFEA 4EE2A 5DN2A 1R091 5LA2A 1CAXA 5BV6A 2VZ3A 1OMIA 3LB9A 2YB7A 3EBRA 4PBPA 4AE2A 2ARCA 3NNGA 4H7LA 1LTEA 1HB4A 4L11A 1OI6A 4LE3A 4IEQA 2RJLA 3ZYBA 4I3PA 1XB9A 3NKGA 2BQPA 3ZYRA 2V4VA 1SMVA 2RS33 3A23A 3OY8A 3MIGA 3T3YA 1LOBA 2DVFA 5A80A 1O3QA 1XOYA 3H3UA 4G3YC 3VZNA 2ZS6B 3VKOA 2JG9C 3FLTA 3ON7A 3N9NA 3USSA 4IERA 3SHRA 3CHXA 5HBAA 4S2DA 2NMNA 5K4LA 4NHYA 4QX3A 4NHMA 2RS12 2BNOA 4YM2A 4XPVA 1CAVB 5AVAA 4MZUA 4DY3A 1G7YA 3I49A 5A1LA 3FWEA 4QPIB 1GLHA 1QJY3 3UKTA 1H2KA 5A3UA 4NIHA 1VBB1 2BFUL 4HXCA 5H9RA 4D7TA 4UFJA 1MQTB 3VBHA 5F6LB 2V4AA 4XIKA 3I97A 2ZMNA 1UYXA 5FYMA 3CDZB 3C2UA 3THCA 4HFSA 2JKXA 4LKSA 4NAOA 1QIQA 5FZMA 2XUEA 1U5XA 1UO9A 2Q8DA 1JHNA 1LR5A 4CCEA 3I59A 1RUE1 3NJZA 3U4XA 1GZWB 2ZX3A 2AEYA 1US2A 4E8CA 5JXIA 2VQUA 1H2LA 1Q5OA 2D6PA 2F6BA 4R9CA 4H14A 4XJAA 1ZRIA 2J1VA 1QDCA 2AR6A 4ZKTB 1AR63 4L2NA 1VBA3 2FZ1A 1STMA 1PZ9A 1NAEA 4IGOA 4LR4A 5I91A 4MGTA 2QQIA 1ONAA 2D6KA 1ENRA 1IS4A 2QQWA 3AX4A 4Y20A 3VBOB 2WFPA 1UPSA 4IW3A 5F2WA 1Q8OA 3OTFA 2OW4A 4A41A 2RMU3 5FLIA 4EN9B 5A1AA 2YG0A 3WCSA 5C8CA 2YZ4A 4QDRA 1H1MA 3LE0A 3VBHC 3SXWA 5J3UA 4BIFA 2XJVA 3KWVA 1V6IA 4D7SA 1WW7A 2WQ4A 1NCRA 5A7WB 1ZBA2 4DINB 3DGTA 1LRHA 4MGKE 2ZZJA 3ZYGA 3O1VA 1A6CA 5FKCA 4BQ5A 1YQCA 5KXEA 3H8RA 1C8M3 2W52A 2XQXA 2CTVA 3K77A 3U1XA 4TTGA 3SMHA 4BYYA 4MX3A 1NX9A 1VALA 5KHIA 2ZKNA 2XONA 4CDWB 1GWLA 3WEZA 2G19A 1V9U2 1SEFA 2VZTA 2OKXA 4I2OA 4DNYA 2D3RA 3THTA 2LROA 1VAMA 2JDUA 2WO2A 2XG3A 4DIQA 2IXJA 4CUCA 1NLQA 1A8DA 2BZDA 5DG1A 5A3LA 1JUIA 5A3PA 1RVF1 3VUOA 3LIGA 3RZKA 3AYAA 2G9ZA 4R8HA 4EZ4A 1H1AA 3N9OA 4Y1ZA 4Y5TA 5GLTA 1FV3A 5I8YA 2ORZA 1EY2A 1JW6A 1PNGA 1QY4A 4NE9A 2HWD3 4KWKA 1X36A 2BDRA 5J36A 1WLCA 3MLJA 1UPIA 4AAPA 2GH2A 2RS51 5GLVA 1POQA 2FDGA 4RGGA 3I3MA 4GB33 4FTSA 1S55A 3PLQA 4QX5A 3R05A 5C8CC 5C9AB 1O6UA 2BWCA 1I6XA 3TYJA 1DU3D 2HWF1 3JU9A 5FZGA 1AR93 1ZZ9A 2OYZA 4I0AA 1NCRC 1MVQA 3OEAA 4LBLA 3ZDSA 2XVGA 3HAGA 2Z69A 3LIHA 4NRPA 3IIIA 4O9GA 2ZGKA 5F3CA 5FY9A 1XRUA 2XJTA 2QNKA 3AP7A 3HNYM 2E7QA 4X8NA 1UOJA 4CYDA 3WUDA 1ACCA 1WCQA 3WW3A 2XGXA 2XLGA 4IE7A 2JICA 3AP5A 5CFCA 1MS4A 4IE4A 1DZQA 1VP6A 1O91A 3O1OA 2WN3A 3R6SA 2VD7A 3HVDA 4AZZA 3AP6A 2FMYA 3O1MA 4FTBA 4N8MA 5L7OB 2N7GA 5HCBA 4YZ2A 2H0VA 3WW1A 1XYPA 3WR0A 1ZA4A 3VDAA 5F1RA 4NPRA 2VW1A 4MO3M 4IE6A 3VD5A 3KS7A 2BJSA 3OF1A 5A7QA 3WP5A 2Y6LA 1NZCA 2GP3A 1RUH3 1CPMA 4CCNA 3GM8A 3T2TA 2VCMA 1GZCA 3VHRA 3MZHA 1APNA 2Q8CA 1BKZA 2OXBA 5KR7A 1X9TA 4IV3B 4YW4A 1OH4A 4YW6A 3MHZA 5KHKA 1DGRA 2YFUA 1C5IA 4HBNA 4OLLA 3USUA 5DUWA 2G1MA 3ACHA 2OT7A 2WAAA 4I3GA 1UX7A 1W0OA 2BERA 2GC3A 3R4UA 4HN0A 1SLIA 3VLBB 5A6YA 3D82A 2DCKA 4LO7A 4JGYB 4ZXEA 1K3IA 3TOJA 2E31A 1GQHA 3B3QE 5DXDA 4FFGA 2W87A 4WVMB 5CFCC 2L9LA 1CZTA 3M2MA 3NKTA 5LRRA 5I0RA 4CXYA 2ZPXA 2HWE1 2IC1A 4MGIE 2VY0A 5A1FA 2AYHA 3WSOA 2XWJB 3RDIA 3BOPA 1T2XA 2VTFA 3OJBA 4ZHNA 1IKQA 4LEJA 1SHWB 4EN8B 3NNJA 3PMSA 4Q4X1 1RUD1 2Q1MA 1NXD1 3S6PA 3S0MA 4MXWB 1G6NA 3H8XA 3AYEA 2ZGPA 4FPYA 4GMP1 4Q4V1 5B2GB 3LPGA 2HJIA 3JCIA 1YIFA 3BN6A 3I2HA 4AI8A 3V0AB 5LBCA 5FZ1A 1HXS1 4DZGA 1GWKA 1WA4A 4FT8A 1OLMA 1POV3 1GANA 3FUOA 1F31A 2E26A 4LUMA 4W4ZA 2A71A 4UBHA 3WDUA 3VD4A 1LCLA 4KG8A 1H4HA 4Q4W1 5FWEA 1OKQA 2RDQA 2X10A 3FHAA 2PHTA 1CAXB 1BK0A 3WF0A 2GP5A 3WDXA 1JBCA 4MLOA 4MV2A 4BLJA 3U14A 1RUG1 5EHDA 4P00B 2A6YA 2BGCA 3SQOA 5JUVA 3OY8B 4QM9A 3POBA 5FPBA 5JMCA 1AYM1 2JJ6A 1IPKA 4FSJA 3RZGA 4XVHA 2YMZA 1ZZ7A 2VOVA 4BCUA 4DQAA 3I2DA 2V09A 5FK7A 1JOBA 3O1TA 2VUCA 2YHJA 2JE7A 1W04A 4K6BA 4PI0A 4UOJA 1LHOA 1UY2A 1XYNA 2GMEA 4Y5SA 3UJQA 4HOOA 1RUJ3 2DUQA 5FOBB 2BRTA 2GC1A 3KLSA 2VBBA 5EJ1B 5T55A 5B4NA 1KFUL 4XFIA 3TAYA 4ASKA 2V72A 5JXHA 1LU2A 3PJQA 1N3OA 5CYYA 3KD4A 5H9QA 3VDCA 4B1LA 3V65A 3SLIA 4EROA 3E5QA 3NNMA 1XE8A 5F6KA 4XJ9A 4BQXA 1KS5A 1DGLA 2VMEA 4HVQA 1ENXA 3AMMA 3BKZA 2R042 1AL22 3T2QA 1WD4A 1UU4A 1FOD3 1HRV3 3I59B 4ATEA 2WFF2 1PMIA 1XPWA 4IGPA 3IZOA 1H2NA 4FP3A 1ZYBA 3N7LA 1R083 1VRBA 2XJUA 3NV3A 1VBC3 2W94A 5EJZB 3U0ZA 4LKDA 4HETA 4TWTA 4CUGA 3C8XA 2ZEZA 4XIOA 2O1QA 1FNZA 3T4HB 1DQ6A 1ENQA 4XUNA 2V5YA 1RJ8A 4I0WB 1RUOA 4QWNA 4RS5A 1VRH3 3BPZA 3PTYA 1RMU2 2W5FA 5FZ4A 4QQPA 3ELNA 3AK0A 2DCZA 2ERFA 1GBGA 1HV0A 2D97A 2WNVA 5FZ7A 3GF6A 2J1SA 1OURA 5T5OA 2VTXA 1C5HA 5C8CB 4UBGA 1RVF2 4BQ2A 1JODA 3GZAA 2KXLA 3VHNA 3ZYJB 1NCRB 4I09A 1RUF1 2JD9A 4AF9A 4Q4Y3 1WMDA 4XFGA 4CPBA 5F8PA 1GOFA 3JD71 1ZZ8A 3U37A 1TMF1 1YIPA 5ACA2 1O4TA 5FAXA 1S0GA 1AXYA 4HANA 2E63A 3AVSA 2NMOA 5IFPA 1BBT3 3B9IA 1SFYA 1HRI1 1NA1A 1OOPA 2RR12 2D6LX 4PBOA 3WY6A 3ST7A 4N43A 1K12A 3HNMA 3MBWA 4K21A 4MHUA 1J83A 1HDKA 2IXCA 3DECA 3KQ4B 3AKTA 4QQOA 1HQLA 4YFWA 3RYPA 1B35A 2WNEA 1GUIA 4XC9A 2ZGMA 4RS5C 1IG0A 2D98A 2XBO1 3HPNA 4URAA 4TZDA 5LBBA 4CDQC 1ZBE2 1Z7S1 2HWC1 1HX6A 2XHNA 3APBA 3J8F1 3I3EA 1D4M3 2PFWA 3VHPA 2BOIA 5D8AA 3NSTA 4HT1T 2DWRA 3LA7A 4BU2A 3F95A 1TE1B 1Y9QA 2HEVF 1RTVA 1AVBA 1OHFA 3WNLA 3FE5A 2WA4A 4QQ2A 2KA3A 2VQAA 3ZFEA 3B01A 3O1SA 3T0DA 2MEV1 4XACA 5AVPA 1YJKA 2UYBA 2Y64A 2W1SA 3A0NA 1PO13 3POIA 3Q8AA 1TZOA 4AAXA 1WCUA 4C90A 5CKQA 5IVEA 1AR81 2ZHNA 3D4KA 1S0DA 2IFRA 3ETQA 3NJYA 1W28A 4CVUA 2WJSA 1OD3A 3OPTA 1VBE2 5DDJ3 5C3RA 1NA1C 1OOPC 2FCTA 2DBIA 2P17A 2QBXA 3KV9A 3QBQA 5IVVA 1QJX3 4N43C 5HPOA 2CU5A 3JBG2 2FZ2A 1V00A 3KT1A 1JN2P 2ZHLA 1UY1A 1ZVFA 2R1BA 5HI0A 4Z2AA 5I8TA 4CUAA 3EB7A 5LRSA 4PLNA 3N36A 1LOCA 1LOFA 2HWB2 2WS93 1LODA 3L2HA 1KRIA 3WW4A 1OKOA 1LGCA 3EHKA 2KR2A 2F4PA 1K45A 5D8AC 2JDNA 2F4LA 3H9AA 3VBSA 5F5CA 3GALA 1YRZA 4R4ZA 2ZOEB 1W6NA 3WDWA 1O7FA 3M3CA 4J1XA 3VKFC 4DUWA 1PZ7A 3FBYA 1R1A3 5J96B 3ZFEC 1NCQA 3USUB 4Q1RA 2ENRA 3RYKA 3A4UA 2VU9A 1GNYA 1RHI3 3KZ4C 4Y4RA 3LD8A 5KXBA 1J1LA 1RUD2 4BZ4A 2VMIA 4CUBA 1F5JA 4D6RA 3D8CA 1N1SA 4LMFA 4DRRA 4Q2FA 4OI1A 3CKHA 1ULCA 5FREA 5FY5A 5I0TA 1AYN1 2VUDA 4BK5A 2VCCA 3RS6A 1HXS2 4HKWA 4AHYA 1JOPA 1MR5A 2JB8A 1VAVA 2ZJCA 3VGIA 4CTEA 5C70A 2GZWA 2LTNA 3CL1A 3AMQA 3M3OA 3B94A 1W9FA 4LOTA 3MFAA 5B4XA 5KBFA 3AM2A 3MV01 3HR9A 1ENSA 3T1MA 2UWCA 4OZOA 1CAUA 4IGQA 4B8EA 4WM7A 3OB8A 3S7EA 4Z92B 4MH0E 4AQSA 4DEVA 1K42A 4GALA 1LHNA 4GJZA 1PO23 3OGSA 5FZIA 4A7ZA 4DXSA 3O12A 3VBSC 5FY4A 2K9ZA 4LUKA 5IYYA 1FMD3 2VXRA 2EA7A 2TEPA 2PXJA 2PHWA 3AL5A 1NCQC 4LBNA 2EAAA 5HV0A 1LENA 2OX0A 2Z42A 4ZU5A 5C33A 2VZRA 2VOTA 3E6CC 4CEWA 3I3DA 4OVEA 4IXLA 5FP8A 4E4DX 3MIFA 5GKAC 3IAPA 3I3BA 1F4HA 2ARXA 3T08A 2VGDA 3OG2A 1V0AA 1S0FA 1HW5A 2RS11 3RMXA 5CZKA 1WMEA 2BNNA 3FUQA 1OA4A 4PCRA 4LBOA 5FXXA 3H1MA 1NQJA 5HCHA 3UETA 2WLQA 3ZKUA 3WD5A 3FFQA 1MVEA 2ZACA 3AYDA 3GCXA 4N7IA 5IT6A 5JSRA 1FV2A 4WM7C 4M0HA 1DFQA 3I54A 4MUVA 5FO8B 2YBKA 5C5UA 5FYBA 2C24A 1UU6A 4NUBA 4MG2A 3GCWA 5EP9A 2XJSA 4AGGA 1ZRFA 5DUXA 2DTYA 1RUI2 4JDMA 4UW4A 4AWDA 4R9AA 3VDBA 4CCLA 1MZEA 1DLLA 4TSVA 4IEOA 3M3IA 3TN93 4HVRA 4YNIA 5JR7B 2A3YA 2W47A 3HT2A 1YI7A 4Y1UA 3DYMA 5A32A 5FBZA 1X33A 4CEWC 2IVJA 3M4FA 2WNUA 5E8AA 3PTRB 3ZYPA 1JU4A 4FPLA 4WZFA 1DDLA 2R7EB 4QX8A 3RWKX 2UYAA 2DYCA 1DZTA 3ES4A 3WP6A 4A7KA 2JDHA 3H3ZA 1DP0A 1PX4A 1S0BA 3LPFA 4YARA 4XAEA 3LDBA 5LEJA 4M3CA 3WLUA 5KHGA 1HQNA 3IMMA 2OZJA 3QH6A 3CU7A 1RUF2 4AG4A 1NQDA 5FZCA 4O65A 3MDPA 4GA9A 1ZBA1 2WRAA 4AVVA 5BY5A 4NWVA 4RS5B 1RUC3 1UCXA 2E33A 2FBEA 2H0BA 3AZZA 4COVA 5FPUA 2CGNA 3VD9A 5FZKA 4JQTA 4QKDA 4TLFA 5T3NA 4B4RA 2WNVB 1V9U1 4XMAA 3SH4A 4ITCA 2QKDA 2D43A 2LM3A 3G6JB 1MZ5A 5CADA 2C9AA 4F7ZA 3PU3A 1YC61 1ZNPA 2BU9A 2PLV3 1D0HA 1UIJA 4XEZA 2WNUC 4QDQA 5C8WA 4MYEA 2A70A 3LAGA 3IM0A 5AC93 3J8F2 1MEC2 1KJRA 3LA3A 5FYSA 2X53S 3KB5A 1OFNA 5FMCA 5FDBA 5HCAA 5JZGA 4RFRB 1VB4A 3LCPA 2ZMLA 3ZXGA 3FBMA 2XJRA 1NA1B 4MSVA 1XU1A 1AL0G 3H1WA 4UWDA 5FWJA 3WQ1A 2WT0A 5JPMB 1XNKA 4XCAA 5FLHA 3RWNA 1BK1A 2J1EA 2Y38A 5G05L 3SISA 1B35B 1T6BX 3ALQA 3J7MA 2Q0AA 4BHPA 4NIDA 2GALA 5GJ6A 4B4PA 2ZX4A 1DYKA 1ULDA 5FPVA 4YVSB 1XBFA 2K2SA 1YYNA 2FDFA 1MS9A 2DTWA 1X9PA 3I2KA 4P5YA 5D8AB 4P9XA 5IVYA 4M0NA 3AB0A 1GV9A 1EUUA 4PDWB 1G9DA 4YM0A 1Q56A 2QQVA 1ZZCA 2ZMKA 3ZPYA 4E9KA 2MPFA 4H55A 5EYXA 2W08A 1QJU2 4QB6A 2JECA 4UFMA 4XF9A 1W6QA 2RM23 2YPDA 2OZ6A 3OCPA 3MW2A 5A7PA 2XKOA 4CCKA 4LK6A 5JZGC 5JXGA 4SLIA 3UT0A 1H0BA 1OC1A 1SLAA 2R073 5CNAA 3WF2A 4BPZA 2DFBA 4CSWA 3HD8B 2UURA 3IN9A 4LBKA 1FPN3 3LA2A 3ACFA 2JXAA 3DEMA 5F9TA 1Q8QA 3BODA 2UWAA 5LW9A 4HKLA 3ZXEA 3L9JT 2VTXJ 2DU1A 3BU7A 4Y1VA 4U2AA 3GBGA 4CE8A 4X6QB 2ZGQA 5IK7A 4EN0A 2XJPA 4JGZB 2D6NA 3C7GA 3B5LB 1IPJA 3NJVA 3K75B 4GKYA 3WNOA 4GQ7A 4JAAA 3VBSB 3WNKA 5C4WB 3B7MA 1OT5A 4IL7A 4LXLA 4GWJA 5BPXA 5LATA 2GSYA 3HT1A 2GNBA 2VUJA 5FY0A 1NCQB 4Z8BA 5A7SA 4QU2A 3GNEA 1KFXL 3LWCA 4FPJA 5FP3A 2EICA 1PZ8A 5LBFA 3OBAA 4RR3A 2YPJA 4L92A 5CVRA 4DFSA 1MS5A 1QQP3 3QD6A 5DAXA 5LA1A 1ZZ6A 1W2AX 3VBRA 3PUSA 5LK7B 3AKPA 1OF4A 1QMJA 2EIGA 4FP2A 3LEIA 4DS0A 1JS9A 4HLTA 2JB4A 4ZS2A 5CG9A 3S57A 2LS6A 1EV12 1ULGA 2VC9A 2XLAA 1L7QA 1WUVA 1H9PA 5L9VA 1TME2 4QPGC 1D0GA 1IHMA 1W6PB 1M06G 5EYYA 3QH7A 5FMDA 1PK6A 4MGSA 3N35A 1W8NA 4U36A 3BI3A 4CU9A 1PIV3 1W8TA 3N3HA 4S2FA 5JXJA 4BQ4A 2HEWF 3AKQA 1XNAA 5CB7A 2W0XA 2QQOA 1W39A 2VJXA 2VCAA 1WKYA 4OMCA 4Q29A 4WM7B 4XBQA 1PVC3 2R063 3I2FA 3U10A 2WKKA 4KQ7A 4L97A 2NP0A 3ETPA 1PVXA 2E32A 4GMP0 3TEWA 4KGGA 3FL7A 3ZR5A 2P1BA 1F9KA 2XJQA 2ZA9A 4D94A 4LO8A 4XFFA 2IXLA 2RS32 4JTOA 3WF3A 5IVJA 3GBFA 2C0ZA 4AK3A 3K46A 3KGLA 3GGLA 2G4IA 4RR3C 1UXZA 2QJVA 2VZOA 4KU7A 4AI0A 5IWFA 3TRSB 4CEWB 5EFUA 1G8WA 1U5IA 2P6HA 4UFHA 2GMPA 3N9MA 4XF4A 3VBRC 4CRQA 3KQRA 3HQXA 3BUCA 5EXOA 1BYHA 2X29A 1U5YA 5BXXA 4A6SA 1QJY2 2BBAA 1JOJA 1WW6A 3JXSA 5FPAA 2SBAA 1PK6C 1SDDB 4ORFA 3A7QA 5JR2A 3CJIB 2P3KA 4PLOA 1DQ4A 3OYWA 4EWDA 1VMJA 2R041 1AL21 2FHRA 1GOGA 5F3IA 5KWRA 1LGBA 2WZR3 3H42B 2WFF1 1IS3A 4AFCA 3VZMA 5DPNA 1Y3TA 2I45A 1XNTA 2QDRA 4XUOA 1OQ1A 1IQAA 3BIWE 1IS6A 5D21A 3HN3A 4EYUA 2BPA2 5DAPA 4AVTA 1AR62 4UF0A 5L36A 2VQTA 1VBA2 2OUJA 3IDBB 5DQ0A 4LO5B 4B3NA 2VW2A 3E5XA 4NROA 3HMYA 1R64A 1RMU1 1UYZA 3PVBB 4XJ8A 5DUUA 4JHZA 1MS3A 3UGGA 1RGSA 1QOTA 1JMUB 2QCSB 4K3UA 1UIKA 3WV6A 1S2BA 3WNMA 4OZXA 3HQRA 1ZRCA 1HN0A 2RMU2 4M3CB 3A21A 1BJQA 1RITA 3SC7X 4O7XA 1J3PA 4DEQA 1IG3A 3VN4A 1ASJ3 3ILRA 1JYCA 1F8VA 3OGJA 3WDYA 1MZ6A 4IEUA 4JQRA 4JKMA 2V5DA 5FYZA 1EAH3 3WCRA 1AR73 3KHCA 5LA0A 2VVFA 1C8M2 2E53A 4FOYA 4QGLA 2IXIA 4RD7A 4UFKA 4DUVA 2WO1A 1J3QA 2VULA 2I74A 5ACA1 2CWMA 3HNBM 1JYTA 1O8PA 2RR11 4I0BA 4BJ0A 1LULA 4Q1PA 4S2HA 4A7YA 3HIFA 4NVPA 3AKRA 3SNMA 1YUDA 4ZPIA 2W9XA 4AFAA 2EAKA 3RVHA 2B5HA 2BOJA 3JB8A 2W91A 4KL1A 3IWZA 4Y5Z0 4YM1A 4EV0A 1SLCA 2R30A 1V6MA 4ZZ8A 5J48A 4YW1A 2VZVA 5FPZA 4M3CF 4Q26A 2BVVA 2HWD2 4D69A 4IEZA 5C9AA 2AH2A 2DUPA 3DKWA 1ZBE1 3NQHA 4V2WA 4XCBA 3DPRC 1QNYA 4PQ9A 4GB32 4UXAA 5C6CA 1VBD3 3WG4A 3O1PA 3WHTA 4RHV3 2ETEA 3ECQA 3K3OA 3H8UA 1AR92 3JUUA 1IKPA 2D3SA 5KC5A 1DQ2A 4NAMA 3LQCA 3TEZA 2JDZA 2P3YA 5H9PA 2VMGA 4NPMA 1CPNA 1TG7A 4NIAA 1BZWA 1ULPA 3N7MA 3O14A 4E2SA 1HN1A 4FQ4A 4AFMA 1KD7A 1E57A 2BVBA 2DVGA 2ORXA 5FXZA 1FT9A 2OS2A 2P37A 1RXGA 3J4UH 1JHJA 1VBE1 4CU7A 2EALA 1TVGA 2D5HA 1KITA 4P9WA 1COV3 2W1WA 3LFIA 3VB9A 4K7JA 1QXJA 3JBG1 1WLDA 1Q8PA 2DV9A 3VDDA 3OOXA 3EXUA 5T50A 2Z5WA 5LEKA 3POJA 1W6QB 1BEV3 3AJZA 2QZ3A 2CDOA 4IETA 4XQDA 2HWB1 5I0DA 1SBFA 1H8VA 3Q8CA 3VZJA 5C9AC 4BOWA 2JDAA 2WYSA 1NT0A 2ZEWA 4L9BA 3OBTA 1RUH2 1DG6A 2C26A 1MS0A 3K2OA 2CYFA 4TN7A 1V6OA 3EO6A 1GNZA 4OI2A 3AKSA 5CU1A 3RI9A 3ME2A 4AOCA 3B02A 1TEIA 4JKKA 5FK8A 1BVVA 3VD7A 3UKVA 2VH9A 4WBBA 2QVSB 1R093 2JG9B 2XKPA 1ZA7A 4LBMA 2A3WA 2RJ2A 3ZYIB 4LIUA 4D3WA 1JZ7A 2C4XA 5FZHA 4Y33A 4LT5A 1PGL2 4XOGA 3WG1A 2A1XA 2B46X 3J9SA 2J22A 1YFXA 5FYYA 2CL2A 5FP9A 3SH5A 3B00A 4OI4A 2VNOA 4OCTA 2IFWA 4NMIA 3ZSJA 1LOEA 5E89A 1URXA 1OFSA 1U12A 4YW7A 4Q27A 3OD0A 3VDDC 4Q0VA 1VAKA 1E5SA 2A6XA 1I1EA 2HLEA 2C5DA 4URTA 4P02B 4XETA 1VLNA 4RR3B 2ARBA 1JYNA 2E6VA 2ZHKA 1OQDA 4TYSA 1NYWA 2GDFA 4PIZA 1YQ2A 2O14A 2TUNA 4AEJA 3OSDA 4Z07A 1VBB3 4QB2A 2VZSA 4CP0A 2NM1A 1RC6A 3P1IA 2Q1ZB 5A33A 3WQ7A 4CU6A 1TNFA 3BPSA 3HWJA 1UMHA 2WBKA 4I01A 1W9WA 3MI8A 4RN5A 4B1MA 3HBZA 2B8MA 5IK8A 5AFBA 4ASLA 4Y4YA 1OLQA 1N47A 2R0HA 5JI9A 1PX3A 4XJZA 1RUE3 1YI9A 4ISRA 4N90A 1SBEA 1WWYA 4KI5M 4UYBA 4Y3OA 5BNOA 1UNBA 4N7UA 3I7DA 5CBLA 3JZVA 3TB0A 3PU8A 2ZX0A 5CKMA 5E88A 3FHIB 2EIDA 1XNDA 2QQKA 4NHXA 2ZGSA 1DIWA 1O5UA 3VBHB 5IATA 3DUIA 2E7AA 4FTEA 1GSLA 3SCGA 1ALYA 4NIIA 2LRPA 2Y26A 2BNMA 5FV3A 1GOHA 2ZGNA 5ERLA 4P5HA 4E4HA 3ZFFC 2CNAA 1UXXX 1JYVA 1RUJ2 4B7KA 4FQZA 4OQ8A 3C7FA 5JAXA 1RUI1 3PDQA 4LPLA 4Y26A 1H6YA 2R6QA 1QEXA 3N9QA 4UFIA 2I2SA 3JQWA 1AJOA 1J1TA 1UU5A 1C1LA 4XZUG 4XMIA 1YO8A 2DCTA 1OLRA 1SCSA 2W68A 1SPPA 2P3IA 4BM8A 2P3JA 3KCXA 5BNOC 3T0AA 3ACLA 3OYWB 4CDQA 3MPPG 1GMMA 3OGGA 4QQLA 4E27A 4C0HA 1EPZA 1FOD2 1HRV2 2OVUA 4Y20B 5M0TA 2Q5TA 2BP6A 1O4YA 5EV7A 1BHGA 1R082 5JSPA 2FCVA 3AXEA 5T5PA 1VBC2 1F4AA 4W50A 2GNDA 3WP3A 1XYOA 1H8TA 3WF4A 2QZ2A 4BLIA 4ARYA 5J7MA 1QGLA 2C6SA 4J25A 3RFRA 3CLPA 2ZGLA 4O9EA 4PJYA 4UF0B 4LULA 4DB5A 3MF9A 4Q0QA 4FFHA 4Y24A 1UWWA 1VRH2 2RS53 4COYA 1OVPA 2CHHA 2DCYA 2VL4A 2WN2A 4JCKA 1A8MA 5DABA 1GP5A 5CFDA 3OUIA 2FDHA 5FMBA 2WAOA 1W3XA 3MIBA 2VXJA 1NE4A 1X7NA 4HVOA 2HWF3 3VHOA 5CKNA 1DQ0A 3FC0A 4XUPA 5FP7A 2FD8A 4GWNA 4L99A 4P9LA 1YNAA 2X5IA 3AP4A 4XDOA 1XNCA 1IPSA 3CZJA 1NXMA 1OXCA 4FPCA 4KMQA 2HBUA 4RGAA 3E6DA 4Z2WA 4GAZA 1CIYA 2JE8A 3VKNA 4Q4Y2 1JI6A 2OQ7A 4M01A 1H9WA 2XB6C 2VOXA 1MEC1 4FPFA 4XJUA 1EP0A 2X09A 2ZABA 1BBT2 4V2VA 1DGWX 3MIHA 4MGQA 4HPKA 1W8HA 1CGPA 1H8TC 3RZJA 4BE3A 4YWAA 3CZUA 1GICA 2UY9A 3UV9A 5F37A 1QNWA 4XTPA 5FKBA 5A3WA 3C3VA 3P5BA 3ACGA 2NPIA 3BOWA 3T1LA 4QAWA 1RB8G 1DZRA 1Y43B 5CFDC 1UZWA 4HMZA 3DV8A 3ZN5A 3ZXDA 1BXHA 3GXUA 4QHZA 1LESA 1DBNA 1D4M2 1P8JA 1W8ZA 3H1YA 5I8SA 4XURA 5CFCB 3RPQA 3PURA 4D7YA 5GZFA 4F8AA 1FXZA 5IVCA 1RYYA 2A6ZA 5LK5A 4E8DA 4OHVA 2X5IC 2WA3A 1WD3A 3E1F1 4MOAA 5I0UA 3NW4A 4ONUA 2E7TA 3UYJA 4YM3A 1L7RA 5FZOA 1QJU1 2R49A 1PO12 3O7OA 4ZU4A 3T09A 3ITQA 4AI3A 1U5ZA 2YC2A 2RG4A 2YROA 1SLLA 3WT3A 1G9BA 4OYUA 2W2IA 2XDVA 1CAWA 3LDKA 3GBWA 2HWE3 1UY3A 2YUEA 4F83A 2ZAHA 1JYWA 5DDJ2 1CQ9A 5L9RA 3OPZA 4M3CE 1FAYA 4QMAA 1QJX2 4XZPA 2WQ8A 2WZ8A 3OUHA 4Q4X3 1W6MA 4SBVA 4NIGA 3D3AA 3KSCA 4E4ZA 3M8LA 1GU3A 1US3A 4PF1A 3VKLA 1IGOA 4GMP3 4LTAA 4Q4V3 2WS92 1LU1A 3D5OA 3LSEA 4PIXA 5C5TA 5IK5A 3ZSKA 4XDPA 3ZLIA 5LWBA 1A78A 3KF5A 1KDMA 5H9SA 3P3PA 4CA9A 2FDIA 1FNYA 3PVNA 1R1A2 2MNGA 2W95A 3CEWA 4YG6A 1WBFA 1SZBA 2P34A 4Q4W3 4N9IA 1RHI2 3NAPA 5JIAA 3HN1A 1LNSA 4YVWA 4KWLA 4HK8A 1HB2A 4J6GA 2PYTA 4OHYA 4RA0A 1UL9A 2QQUA 3MUY1 4QKBA 4AI2A 1RUG3 4IEVA 5T52A 2RDRA 4K9SA 2QE3A 1XNBA 4KG0A 4NPLA 3WNXA 3U78A 4BA6A 1EV11 2AGSA 1W0NA 2IXKA 1N3QA 2RE9A 3ORJA 4XAAA 5A7OA 1AYM3 3AZWA 1ND3A 1TME1 4QX7A 1CZSA 3ZO0B 4R52A 1WW4A 3BCWA 3LOIA 3V56A 5FO9B 2EXHA 4AVAA 1WLTA 3MIDA 1AZDA 3Q8BA 3ZXJA 4XABA 2VOWA 3T2PA 4CDXA 2C9KA 1R1ZA 2VNVA 3ZXAC 5GALA 5KXDA 2DVBA 1PO22 1RUNA 2MHFA 5C71A 1O3TA 3LKJA 4JTNA 4GXLA 2Q1FA 4META 2VMDA 3CF6E 5A33B 5GZCA 1AX1A 2WWUA 1FMD2 3GZTB 4AGRA 3WG3A 3K4AA 2VCBA 4OQ9A 2P2KA 2FCUA 2RS31 3LEMA 3ILFA 3NAPC 5G04L 2ZEYA 3TNPB 4YVWC 4MADA 2YC4A 3ABZA 5E16A 3AZYA 4S2GA 4IEWA 5FYIA 2WSVA 2VAUA 3DF0A 3ZN6A 4BQYA 5BNOB 2GN3A 3EQEA 1PMJX 3V0BA 4CDUA 1W99A 3K4DA 4BWOA 3ZOIA 1GNHA 1JXNA 4KWUA 4CCDA 2EIBA 5IAVA 1PGSA 3IKWA 1GZ9A 4JV4A 5FUPA 2GC0A 1ND3C 2WINB 1QJY1 4AHZA 3RJRA 3MW3A 5F5AA 3WNNA 2Y33A 3ZSMA 4CP2A 4Q0UA 3N7KA 2JKBA 2LW8A 3SCFA 3VZLA 1UQXA 3K48A 1CONA 2IUWA 4PIYA 1OPMA 3W21A 3VBFA 4BXSV 5JSOA 4CDXC 5LZ6A 2W39A 1JYIA 2XR4A 4CCJA 2RHPA 3TBDA 3W9AA 1KDKA 3VBOA 1A3KA 1RJ7A 2PHFA 2WZEA 2WYFA 3CBNA 4GZ9A 4IE0A 5HV4A 2PQQA 2EIEA 1WZXA 1REEA 1DHKB 1UZZA 3KT4A 4QKFA 5C3OA 5KXCA 1UKGA 2D6OX 4WVZA 3TN92 4F3JA 3BTAA 3P6BA 2WT2A 4ATFA 5JPNB 3JD73 1CESA 4OUEA 5FUIA 1TMF3 2B42B 5JOYA 1AR61 2VW0A 1VBA1 3DL3A 1N1TA 3RYRA 1UW8A 1QH6A 5FZ6A 3ZKYA 4CDQB 3KV6A 4FCAA 4QKNA 3IB3A 1ZZBA 1HRI3 4NRMA 4YGCA 1QJZA 4CDUC 2E51A 2WWSA 4QHBA 3O0WA 4HG6B 2ARAA 2A3XA 1WA6X 2E9QA 1UKRA 3ZMNA 3WX5A 4BQ3A 1GFF2 2RMU1 2ZEXA 4RFT0 5A6ZA 2XBO3 4ET7A 1X8EA 1ULFA 4L8QA 4LLFA 1W6OA 1Z7S3 2HWC3 4BB3A 1JZ6A 2ATFA 3TEXA 3VBFC 5FY1A 4ASMB 2TBVA 1RUC2 3VBOC 1JZ8A 2VG9A 1C8M1 1I5ZA 2BUKA 1UMIA 3E5UA 3LF7A 1W8WA 1OOPB 3G7DA 2Q30A 3FLPA 1BQPA 1OD5A 2MEV3 4N43B 2PHRA 4GWIA 1UOBA 2WDBA 4RQPA 2GC2A 5CEHA 2ZGRA 2X5IB 4XHXA 3QACA 1AR83 1NY72 1QJEA 3I2IA 1W06A 2PLV2 4XF3A 1LGNA 4ZONA 5JWPA 4LE4A 2YBPA 2HH9A 3GJBA 1LEDA 3R0RA 5SV5A 3LSDA 2PAMA 4OMDA 5AC92 3WQBA 2PA7A 1VMFA 4W6XA 1HB1A 2HWD1 2B39A 1BLZA 1YWKA 3N4MA 5L19A 1HB3A 4AI9A 1O4ZA 1SLTA 4GB31 4NN0A 2BW8A 4HPKB 2ZKLA 2W92A 4PQQA 1GR3A 4WVWA 3ZFEB 4YW3A 2O8OA 5A7NA 3BTZA 1VB2A 3ZSLA 1MPXA 1AR91 2IWGB 1W2UA 1H2MA 3LEKA 3RGBA 2WIIB 2CAUA 1X50A 1WCDJ 2VUAA 2PHXA 4GULA 1MACA 2VNGA 1XSQA 1Z78A 3MIEA 4CU8A 1WGPA 4H3WA 2F17A 3MYXA 2JG8A 1ODNA 3LEGA 4YSFA 4YGDA 2SLIA 1CX4A 3WQ0A 4LHNA 3ZVXA 2JDKA 5CA6A 2W1UA 1OSGA 3TEYA 4QPGA 3OBZA 4OUMA 2ZGTA 2GU9A 4RQPC 1YQ8A 1JH5A 2ZTNA 2YV8A 2O0OA 4A3XA 4LHLA 1DCSA 3T30A 2FMDA 1MZFA 2W46A 1GP6A 1Y9MA 1VIWB 5FZOB 2JD4A 2RM22 2WR9A 3KHBA 4PF5A 1AYN3 1UF2C 4Y1YA 1EUTA 2JDMA 3AMPA 4XE9A 3PVOA 5I0SA 5T54A 4UW6A 1CAWB 1AXZA 1PMHX 2V73A 3Q9OA 3RZZA 2Q4SA 4YLZA 5CISA 5HXMA 2VZQA 2VMHA 2R072 1RUH1 1V6KA 2ZAAA 1W6NB 4UAPA 4P9JA 4LBQD 1PM7A 1Q8SA 1FPN2 1E5HA 5IUQA 3AXDA 3MO4A 4CCCA 1UAIA 3PIGA 2PTMA 2WC2A 3AFGA 4CCOA 3FHQA 3T2OA 5FRAA 2D7FA 5FZ0A 2J1UA 4CXWA 2Z2SB 3FFZA 1Y7BA 4YFZA 4IESA 5GLUA 1XU2A 2QFEA 4K1YA 4MXWA 5LB6A 2XVLA 2JG8C 2OQ6A 1G86A 1PGL1 4PLMA 1N1VA 4OI0A 1PGW2 3A0KA 1OPOA 1W8OA 2VO5A 3AP9A 3H8OA 5GZDA 1CWPA 2OPWA 3RMYA 4Q0PA 1UOFA 2QTWB 3FMGA 1ZRRA 3MPBA 4LIVA 3U07A 1C8NA 2ES3A 4RYDA 4AFDA 4XDQA 5DMYA 2OIIA 5FQ0A 1N3PA 3KT7A 3DYOA 2A75A 3MLKA 5FYTA 3NAPB 4YVWB 1CAUB 4JRLA 1LECA 1O59A 1QQP2 1YFUA 2RS13 1QOSA 2VM9A 2YXSA 3M1HA 4W65A 2R0FA 4AQTA 4FBFA 1WW5A 2R32A 4E2QA 2YBSA 4QHOA 5BYNA 3GHMA 4AEKA 5FO7B 1C3HA 3K4ZA 3O0XA 1UYPA 4L0PA 3OGVA 4YW5A 3PHMA 2J7MA 3QLQA 4D6SA 5EQUA 1LHUA 4ZXKA 1ND3B 3GHNA 2K0GA 3MW4A 4DUXA 3CJXA 3ES1A 3H50A 1POV1 5J98B 2AZ5A 5JOWA 2IZWA 2XL9A 1PIV2 5C3PA 1DLCA 4BXFA 4LNVA 2LALA 3I2GA 3PNAA 3NWKA 1HLCA 5FCCA 1VJ2A 3OPWA 4CDXB 5JCTA 1OA3A 1PVC2 2R062 2XXZA 2YY1A 2HBTA 3GZEA 4A44A 1AF9A 2PAKA 3NJXA 4BH9A 3N9LA 2HYKA 3BB6A 4IUGA 2DU0A 5FZ3A 3U11A 4INDA 4NRQA 3POEA 1GKBA 2ZX1A 4D8MA 4Z1VA 4UI9L 4OHZA 4MHRA 4FPOB 1DYPA 3AJYA 1QKQA 5DG2A 2QQJA 1ULOA 1CN1A 3DXTA 5D2AA 5JOZA 3PUQA 2ET1A 3ZN6B 4J1WA 3T0BA 5E6HA 2R16A 4OUSA 3WOGA 3V0BB 4CDUB 2GH8A 1HV1A 2AEZA 1IZ3A 2X8KA 3GZUC 1O3SA 2CWSA 3ZIWA 1RUJ1 2D44A 4IEXA 1YEWA 3WP4A 5FJKA 5ABJA 3ZXFA 3POWA 2PN5A 1ZBA3 1WMFA 5BNPA 5A32B 3T4VA 1GZTA 2WNUB 3M3QA 4KH9A 2BYVE 5FUNA 2DURA 4IE5A 5A3NA 5IHRA 4ES9A 2CGOA 3ENRA 3VBFB 3ZIXA 2VE1A 5A3TA 3E6BA 1V9U3 2PHLA 3DPRA 3KCCA 2YGLA 5FMOL 5A70A 1FOD1 1HRV1 2WZR2 5SV8A 1UOGA 2UY8A 5LY1A 2OUHA 3KGZA 3PIJA 2WLPA 1REDA 4QX2A 1OLME 4UW5A 4LBQA 1R081 1VE0A 3OD4A 4XW3A 4MGZE 1NKGA 1VBC1 3LZZA 5GZEA 3U75A 1XSRA 2DCJA 3DN7A 1I5PA 4YG3A 3ZFGA 4AR2A 2VBPA 5LBEA 2XHKA 2FDJA 1UYYA 5J09A 4P9YA 4AHXA 1QF3A 2AUYA 2JEMA 3KV4A 1VRH1 4QXKA 1QU0A 4D0QA 3D0SA 4P08A 1WLWA 1UZ0A 4LHKA 5FIXA 4JZRA 3POYA 4KWJA 3BALA 1OUXA 4LA3A 4XILA 5ABJC 4M4PA 2QQPA 4XJWA 3FJSA 5DZEA 2XL7A 5CIRA 5BNPC 2AC1A
chains in the Genus database with same CATH topology
1D2QA 2ZCWA 3H0OA 1ASJ2 1LEMA 3NV4A 1ZRDA 1JTZX 1DQ5A 5JLVA 1W6OB 2GNTA 3RQ0A 1EAH2 4HZFA 1G9FA 3RRDA 1AR72 4Q4Y1 5JZGB 2HKXA 1FX5A 3PMEA 4C1XA 4FVVA 1I9RA 4FPGA 1F2NA 1BBT1 1FYUA 1YFYA 4AGVA 3O0VA 4RQPB 4AVBA 3ZFGC 4EN6B 1HIXA 2XUMA 1KXGA 3MICA 4XQ4A 1KS4A 1KJLA 5GM0A 2NZ9A 4GIQA 1M4WA 1MS8A 3VV1A 4X8PA 1D4M1 4FPHA 3RI8A 1YHFA 4I02A 3WG2A 1VBD2 4DMIA 5CG8A 4RHV2 1PHMA 3M3EA 2H6CA 2ZGOA 2XLFA 4CZSA 2QDNA 1TQ5A 2JENA 1PO11 1V6LA 4K40A 1S0CA 4K20A 5KC6A 2JG8B 2D93A 3WXPA 1AX2A 3LGRA 1ULEA 3L2YA 2H6BA 5DDJ1 1WBLA 4B29A 4QPGB 4W6WA 2AREA 4AVCA 1COV2 1IOAA 1QJX1 4EN7B 5FPXA 5HCFA 3EJKA 4AHWA 1BMV2 3X29B 2OPKA 4E2GA 2ZBJA 3IPVA 1BEV2 1ZX5A 2VVEA 2JE9A 4IV1A 1NOVA 1SACA 3ZX7A 2WS91 5I93A 2YGMA 3AMNA 4XF1A 2DUOA 4K1ZA 4QPYA 4QGMA 2HEYF 4HL0A 5EZWA 5E1RA 3WDVA 1G9CA 2VPVA 1GYKA 4YZ4A 1R1A1 3I4IA 4FAGA 1N1YA 2BTVC 4AEMA 3M7AA 1R092 1RHI1 4KU8A 1QXPA 4QGNA 3VBRB 2WL1A 2CY6A 4Q0SA 3ZFFA 1I3HA 2D6MA 3IDEA 4OFGA 4EJRA 1EPWA 4N9HA 1T6GC 1CVNA 4DOUA 1DQ1A 4BIOA 4AEDA 1LOGA 1PK6B 3VBUA 1WCSA 2TNFA 5FQ0B 4JC1A 1OA2A 3MFCA 4DRVA 5BUVA 1SLBA 4IV1C 2PELA 3OBRA 4FOWA 1UN1A 3CNAA 4FXKB 1V6JA 1J58A 1C57A 3ZMOA 4XXPA 1DGRN 1PO21 5IK4A 1VBB2 2EXJA 4FO9A 3KM5A 1ND2A 1RINA 3RJ2X 4Z82A 4FPEA 2KM2A 1CR7A 1FMD1 5K8SA 4AVSA 4XHBA 3KMHA 3UL2A 1QHDA 4DY5A 2R043 4NOTA 1AL23 4AI1A 4DPNA 1CJPA 1SCRA 1RUE2 3IMNA 2WFF3 2GMMA 2ZHMA 5KHJA 4I30A 4B7EA 1HKDA 1B09A 2WQZC 4XBNA 4AEDC 3S7IA 3VBUC 5F5QA 4LO4B 4LLOA 3RSJA 4COWA 5GLWA 2A7AA 1RMU3 5DZGA 4FAHA 3E97A 4LO6B 2EXKA 5FTTC 4XTMA 1ND2C 2FQPA 4BQ1A 3ILNA 1RVF3 1UZYA 2VOKA 4HN1A 3RNSA 2YC0A 5ABJB 2A5ZA 5BNPB 3TN91 3NV1A 3SITA 3IIAA 3P3NA 3VZOA 3THPA 1RL3A 1CJDA 4W6YA 4E4SA 5ACA3 2ZZQA 1NG0A 1YLLA 5GLZA 3DPRB 2RR13 5DZFA 4LBJA 3VL9A 4XFHA 3IBMA 4FOVA 2A73B 4RSUA 4LBQB 4COUA 2AENA 1AJKA 3CO2A 4Q8KA 1XE7A 4N53A 3ZFGB 4IQPA 2VVDA 3IDCB 4GH4A 5K0UA 3WUCA 2I07B 1ZBE3 4AQ6A 2ZGUA 3ASIA 1S0EA 2RS52 5HXVA 1RUC1 2JX9A 1S0IA 3ZXLA 3MGUA 1S1AA 2HWF2 2CAVA 1SQ4A 4JDNA 3ZN4A 1RIRA 4CEYA 2XH6A 3ATGA 2VQ0A 2XVKA 4COZA 2R1DA 1NY71 2DVDA 5FOJB 2PLV1 4CP1A 4YVSA 2NQYA 3PJYA 1UMZA 3URFA 1QOOA 1O5LA 1TNRA 5AC91 1VBE3 4NR1A 2WNVC 4YGEA 2YYOA 3NO8A 4WM8A 3MEPA 4P14A 4PDWA 1SDWA 3JBG3 4K8FA 2BFUS 3W58A 4YGBA 2BEOA 4LA2A 4R9DA 3B69A 4BMEA 1C4RA 1S0JA 3SH3A 4AQ2A 1ZREA 2CGPA 4N53C 5JOXA 1FI2A 2HWB3 4GH4C 5K0UC 4IEPA 1XXNA 4AYUA 2QUOA 4M00A 2A6VA 3VKMA 4QT6A 3FLRA 2D5FA 1J3RA 1KQRA 5EJ3A 3WDTA 5D1IA 1Q43A 3WVJA 1LOAA 2GAUA 4CEYC 3WZ1A 2NLRA 1B35C 3VDDB 5BNNA 1C1FA 1RUD3 4OHWA 4XFBA 3NV2A 4YVSC 4YYOA 1C28A 2RM21 4WVVA 2WT1A 4KGQA 2PHDA 4JGZA 4HK9A 1UX6A 5FMOS 4YZ1A 1HXS3 2HWE2 4WM8C 3JQXA 5C4WA 1X82A 4PDWC 5JI7A 1DF0A 1Z0HA 2R071 3H7YA 1FPN1 4AFBA 4Y22A 5TSWA 4XXAA 1O3RA 4Q4X2 1K5MA 2ET7A 4B4QA 4XF0A 2A6WA 2Y0OA 5BNQA 2NYYA 3IPVB 4IV1B 4DXZA 2Y0IA 4Q4V2 2D40A 1YCIA 3N7JA 4OULA 2ILMA 3AZVA 5JVVA 1PGW1 1YXWA 2GN7A 5JDBA 1QWRA 4C0BA 1W6PA 4FOQA 5BNNC 3M70A 4Q4W2 2DFCA 1LOFC 1YJLA 4NO4A 3FX3A 2ZX2A 3AZXA 4JGZC 2B45X 1CAVA 1QQP1 3SCHA 3ZFFB 5JIUA 4QPIA 1RUG2 5C4WC 3AMHA 4WZCA 4OHXA 1FATA 1H1IA 1NLSA 3D6EA 5FFOC 2O8QA 4GKXA 2YDEA 1V6NA 3VL8A 4XBLA 1MQTA 2C1FA 4P9IA 4HSJA 3R4DB 1AYM2 1OQEA 2G9GA 1K5MC 2PHUA 4AEDB 3VBUB 4C1WA 3IT8A 1Q3EA 1PIV1 1NLRA 2EF6A 1D4VB 1GZWA 4RL7A 4XFCA 1EYBA 1NE6A 1RUI3 1PVC1 4MXVA 2R061 3TWIA 1ND2B 4YG0A 5T5JA 4A2UA 1JUHA 4ISQA 1L3JA 3J26N 2WSUA 1UD1A 4XFAA 1PNFA 4FPKA 3CJIA 4UW3A 4XQWA 1POV0 1LB2A 3WW2A 1AX0A 1H30A 3AYCA 1ZM1A 1W0PA 3PVEA 4QPIC 3S30A 4BMBA 2UWBA 1BCXA 2GNMA 1CIWA 2WZPP 1GQGA 1S2KA 1MQTC 4HKOA 1LHWA 1RUF3 1AXKA 1YFWA 1AUYA 1DGWA 4JVAA 4JDOA 4H7MA 4YRDA 1LHVA 4X6RB 1D2SA 3QCWA 4CDWA 3H7JA 1U0AA 4MGYE 2DVAA 4QD2A 1G9AA 4NHLA 2WZR1 2RJKA 4AXOA 2B7YA 5EWSA 1H8TB 5CAZA 4G9SB 3CJIC 3V64A 3JD72 5GZGA 3J8F3 1MEC3 1TMF2 5K7PA 1MS1A 2EXIA 1XQNA 5CFDB 3INAA 5L73A 1HRI2 3NVCA 3JB4C 3O5SA 3NL1A 1V70A 1SBDA 2XBO2 1LJ7A 1Q8VA 4N53B 3ROUA 2PAEA 1ASJ1 2UU8A 2B9UA 4GH4B 1Z7S2 2HWC2 4G4FA 5K0UB 1REFA 1EAH1 4CDWC 3POSA 4KNCA 1AR71 2IXHA 4XYXA 1WCKA 3AFKA 3UK9A 4YZ3A 5L7OA 2MEV2 3KCYA 1QJU3 4YZ5A 4CEYB 2VNRA 4KBBA 1AR82 4R9BA 1LKNA 3ZSEA 1X8MA 3RG0A 2BWAA 1QDOA 4AW7A 2LUWA 2NN8A 2VECA 1IS5A 1CD3G 1QH7A 4IV3A 2Q8OA 4WM8B 3B93A 1SFNA 1H4GA 4V1PA 4NHKA 3TNQA 3B9CA 3MF6A 4R4XA 4WV8A 1HQWA 1VBD1 3UJOA 1J59A 4RHV1 2XPJA 4Q8LA 5DUVA 3VZKA 4ZU7A 4JGYA 4QQHA 3K51A 3UKNA 1VR3A 4MVTA 4WVMA 4Y1XA 3W59A 2CV6A 3GYDA 2Z79A 3FZ3A 1F5FA 4P9GA 5L7OC 4HSLA 3MLLA 5T5LA 4YW2A 3I8TA 3ZXKA 1W6MB 2XWBB 1COV1 3QOPA 5BNNB 2JG9A 3WINE 2BBVA 4QM8A 2EVXA 1BVP1 4IEYA 1BMV1 1AYN2 4C91A 4EWAA 1BEV1 4NWWA 3LOBA 2D3PA 1EV13 5J37A 4EWEA 4JRAA 3V0AA 4IV3C 5KHHA 1QXRA 1TME3 5K9YA 4GWMA 3D0JA 4FXGB 4Y22B 2DF7A 2G9FA 4ES8A 1AHSA 1K5MB 3R4SA 5FLJA 3WHUA 4JGYC 2OA2A 5AFEA 1R091 1CAXA 5BV6A 1OMIA 3LB9A 3EBRA 4PBPA 4AE2A 4H7LA 1LTEA 4L11A 4LE3A 1OI6A 4IEQA 2RJLA 3ZYRA 4I3PA 3NKGA 2BQPA 1SMVA 2RS33 3OY8A 3MIGA 1LOBA 2DVFA 1O3QA 3H3UA 4G3YC 3VZNA 2ZS6B 3VKOA 2JG9C 3FLTA 3USSA 4IERA 3SHRA 5HBAA 4S2DA 2NMNA 4NHMA 2RS12 2BNOA 4YM2A 4XPVA 1CAVB 5AVAA 4MZUA 4DY3A 1G7YA 3FWEA 4QPIB 1GLHA 1QJY3 3UKTA 1H2KA 1VBB1 2BFUL 5H9RA 4D7TA 3VBHA 1MQTB 5F6LB 4XIKA 2ZMNA 3C2UA 4HFSA 1U5XA 1JHNA 1LR5A 3I59A 1RUE1 3NJZA 3U4XA 1GZWB 2ZX3A 1H2LA 1Q5OA 2D6PA 2F6BA 4R9CA 4H14A 4XJAA 1QDCA 2AR6A 4ZKTB 1AR63 4L2NA 1VBA3 2FZ1A 1PZ9A 4LR4A 5I91A 1ONAA 2D6KA 1ENRA 1IS4A 3AX4A 4Y20A 3VBOB 2WFPA 1UPSA 1Q8OA 3OTFA 2OW4A 4EN9B 2RMU3 5FLIA 3WCSA 5C8CA 2YZ4A 1H1MA 3VBHC 3SXWA 5J3UA 4BIFA 2XJVA 1V6IA 4D7SA 1WW7A 2WQ4A 1NCRA 4DINB 1ZBA2 3DGTA 1LRHA 4MGKE 2ZZJA 3ZYGA 1A6CA 5KXEA 1C8M3 2W52A 2CTVA 3SMHA 4BYYA 4MX3A 1VALA 5KHIA 2ZKNA 4CDWB 1V9U2 1SEFA 4I2OA 4DNYA 2D3RA 3THTA 1VAMA 2XG3A 2IXJA 1A8DA 5DG1A 5A3LA 1JUIA 3VUOA 1RVF1 3AYAA 4R8HA 5I8YA 1H1AA 4Y1ZA 5GLTA 1FV3A 1EY2A 1JW6A 1PNGA 1QY4A 2HWD3 4KWKA 1X36A 5J36A 1WLCA 3MLJA 1UPIA 2GH2A 2RS51 5GLVA 4RGGA 4GB33 4FTSA 1S55A 3PLQA 4QX5A 3R05A 5C8CC 2BWCA 1I6XA 3TYJA 1DU3D 2HWF1 3JU9A 2OYZA 1AR93 1ZZ9A 4I0AA 1NCRC 1MVQA 4LBLA 3ZDSA 2XVGA 3HAGA 2Z69A 4O9GA 2ZGKA 1XRUA 2XJTA 2QNKA 3AP7A 2E7QA 4X8NA 4CYDA 3WUDA 3WW3A 2XGXA 2XLGA 2JICA 3AP5A 5CFCA 1MS4A 1DZQA 1VP6A 1O91A 3R6SA 3AP6A 2FMYA 4FTBA 5L7OB 2N7GA 5HCBA 4YZ2A 2H0VA 3WW1A 1XYPA 3WR0A 1ZA4A 5F1RA 4NPRA 2VW1A 3KS7A 3OF1A 3WP5A 1NZCA 1RUH3 1CPMA 3T2TA 3VHRA 1GZCA 3MZHA 1APNA 1BKZA 4IV3B 4YW4A 5KHKA 1DGRA 3USUA 1C5IA 4HBNA 4OLLA 5DUWA 4I3GA 1W0OA 2GC3A 3R4UA 4HN0A 1SLIA 3VLBB 3D82A 2DCKA 4LO7A 4JGYB 3TOJA 1GQHA 3B3QE 5DXDA 4WVMB 5CFCC 3M2MA 3NKTA 5LRRA 5I0RA 2ZPXA 2HWE1 2IC1A 4MGIE 2VY0A 2AYHA 2XWJB 3RDIA 3BOPA 3OJBA 1IKQA 4LEJA 4EN8B 3PMSA 4Q4X1 1RUD1 2Q1MA 1NXD1 3S6PA 3S0MA 4MXWB 1G6NA 3AYEA 2ZGPA 4FPYA 4GMP1 4Q4V1 5B2GB 2HJIA 3JCIA 1YIFA 4AI8A 3V0AB 1HXS1 4DZGA 1WA4A 4FT8A 4LUMA 1POV3 3FUOA 1GANA 1F31A 2A71A 4UBHA 3WDUA 1LCLA 4KG8A 1H4HA 4Q4W1 1OKQA 2PHTA 1CAXB 3WDXA 1JBCA 4MLOA 4MV2A 4BLJA 1RUG1 2A6YA 2BGCA 3OY8B 4QM9A 5JMCA 1AYM1 2JJ6A 1IPKA 4FSJA 2YMZA 1ZZ7A 2VOVA 4BCUA 4DQAA 3I2DA 2V09A 2YHJA 2JE7A 4K6BA 1LHOA 1XYNA 2GMEA 3UJQA 1RUJ3 2DUQA 5FOBB 2GC1A 3KLSA 5T55A 1KFUL 4XFIA 3TAYA 1LU2A 3PJQA 1N3OA 5H9QA 3KD4A 3V65A 3SLIA 4EROA 3E5QA 1XE8A 5F6KA 4XJ9A 1KS5A 1DGLA 4HVQA 1ENXA 3AMMA 2R042 1AL22 1WD4A 1UU4A 1FOD3 1HRV3 3I59B 4ATEA 2WFF2 1PMIA 1H2NA 4FP3A 1ZYBA 3N7LA 1R083 2XJUA 3NV3A 1VBC3 3U0ZA 4HETA 4TWTA 4XIOA 2O1QA 1FNZA 1DQ6A 1ENQA 2V5YA 1RJ8A 4I0WB 1RUOA 4RS5A 1VRH3 3BPZA 3PTYA 1RMU2 4QQPA 3ELNA 3AK0A 2DCZA 2ERFA 1GBGA 1HV0A 2D97A 2WNVA 3GF6A 5T5OA 1C5HA 5C8CB 4UBGA 1RVF2 3GZAA 2KXLA 3VHNA 3ZYJB 1NCRB 4I09A 1RUF1 4AF9A 4Q4Y3 1WMDA 4XFGA 3JD71 1ZZ8A 1TMF1 1YIPA 5ACA2 1O4TA 5FAXA 1S0GA 1AXYA 4HANA 2E63A 2NMOA 1BBT3 3B9IA 1SFYA 1HRI1 1NA1A 1OOPA 2RR12 2D6LX 4PBOA 3WY6A 3ST7A 4N43A 4K21A