1V6MA

Peanut lectin with 9mer peptide (iwssagnva)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 52
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6mA00
3AFKA 5JLVA 1LOBA 1VAVA 1UZYA 4M3CE 4YM1A 4BPZA 4HANA 3WCSA 1AJOA 2EXIA 3MPPG 2ZHLA 4FPKA 2DUOA 4NO4A 3PVNA 4YZ2A 3IMNA 3ZXJA 4FPFA 1LCLA 2V5YA 1N3OA 2ZGUA 2ZHNA 3WG3A 2W39A 2ARXA 1D2SA 3MW2A 2DUPA 5EXOA 2E51A 3WCRA 5DUXA 1W6PA 2TEPA 1LHNA 4RL7A 2PHFA 3AZWA 1C4RA 1N1VA 2A71A 3LCPA 3VKNA 5KXCA 2P37A 1DQ0A 1HLCA 3WUCA 3ZSMA 1SCRA 1G8WA 1AZDA 2GMMA 2DTYA 4BM8A 4YM3A 1V6KA 3USUB 1WCSA 4AVSA 1SLTA 1ONAA 4TZDA 1SLIA 5GLWA 3SH5A 2DTWA 2EAKA 1OFSA 3SISA 3GALA 4ISRA 3B9CA 4Y22B 3V0AA 1LEDA 1G86A 1ULFA 2JDZA 3T1LA 1AX2A 5LK5A 1WD4A 1KDMA 1CONA 1DQ1A 1QDCA 2ZGSA 3POYA 1LHOA 4KBBA 5H9PA 3SH4A 2GN3A 1GSLA 3WDYA 5DZGA 5JOZA 4JC1A 1ZM1A 3OBRA 4P14A 3ZVXA 1CPMA 1SBEA 4AGRA 2ERFA 1IS4A 4R9CA 3BOPA 1VLNA 1KJRA 4DQAA 2ENRA 4YLZA 1LOCA 5IK7A 4TYSA 5DUUA 1EPWA 5T55A 1IKQA 3B69A 3AP7A 1JOJA 2VH9A 1UPSA 3WZ1A 4R9AA 3OPZA 5KXBA 1BQPA 1HQWA 5IK5A 1W6QB 1RITA 2JE7A 1JYCA 3ZYPA 1APNA 2WJSA 2ZGLA 4F83A 4M01A 4FQ4A 4XXAA 2WT1A 4XJ8A 4LBLA 4ZKTB 1LHVA 2DVBA 1LHUA 3AZXA 3D6EA 4NOTA 1OKQA 2DU1A 1PZ8A 4Q1PA 4LBKA 1VALA 2WSUA 4FPEA 4FPCA 1S0IA 4Y1ZA 4YGBA 3IM0A 2ZAAA 5HCBA 1LOFA 4XBLA 3WV6A 1JW6A 1NLSA 2AREA 5DXDA 5IK4A 1O4ZA 4Y1YA 2WT0A 5E88A 5EYYA 3U4XA 2W68A 3FUQA 2UWCA 1N3PA 2D6PA 1UKGA 4XTPA 4FOQA 1GZCA 3PVOA 4YZ4A 4CZSA 1WUVA 1MS0A 3WUDA 3H0OA 1V6LA 1F31A 4XJWA 1URXA 3ILNA 3VKLA 4Z8BA 1S0FA 2WKKA 1W0OA 4FQZA 5HCAA 3OYWA 3V65A 3VKMA 1FV2A 1WLCA 4Q2FA 4XJZA 3FLPA 3POSA 4XMAA 3I4IA 5H9QA 3INAA 1GLHA 1GICA 1Q8PA 3D5OA 3OJBA 3FFZA 4XE9A 1I1EA 2D3SA 2DVAA 3RMXA 2PHWA 2R1DA 1CN1A 3ENRA 2DUQA 2D3RA 1MS3A 1IKPA 1CESA 1QNWA 4M3CB 3WDTA 1LENA 1LGNA 1V6NA 4RA0A 1ENRA 5JOXA 1QU0A 2VU9A 3VUOA 5AVAA 1QOOA 4AVVA 5SV8A 2GNMA 1C1FA 1GZWA 3ZXFA 1PZ7A 3BTAA 4SLIA 1JN2P 2JKBA 1DQ5A 4PF5A 4C1XA 1WW5A 4LBOA 3M1HA 3D4KA 1V6MA 1NXD1 4YW4A 2DVFA 2RHPA 3ZSJA 1CIWA 2DURA 3PJQA 1MVEA 1J1TA 2D44A 1IS3A 1N1YA 4XILA 5F9TA 1G9FA 4YM0A 4K1YA 2E53A 1MS5A 1DQ6A 1QF3A 3USUA 4YG6A 2C9AA 1W6MB 3IPVB 2ZZJA 2GNBA 4JCKA 1H9WA 2OW4A 4XJAA 4XYXA 2EF6A 1DHKB 3ZXLA 4XHXA 1LESA 1H9PA 4Y22A 3FLTA 3IN9A 3FBYA 2ZABA 1QMJA 4P9YA 3V0BB 3I8TA 5JOWA 1ULDA 2EALA 3QCWA 3A0KA 3N36A 4BMBA 1N3QA 4AYUA 1DIWA 3Q9OA 3RS6A 5EYXA 1A8DA 4PBOA 3WG2A 2NZ9A 3AP4A 4HL0A 3NV1A 5GZDA 2PHTA 1B09A 2UWBA 4UW3A 5H9RA 1I3HA 1JXNA 1GKBA 3WDXA 1GZWB 5GM0A 2A3WA 4LBNA 4DPNA 1W6QA 2GMEA 4Y20B 3VKFC 1ZA4A 4D69A 2ZGPA 1F9KA 1YI7A 2FHRA 5KXDA 4YM2A 1GNZA 3UJOA 3V64A 3JU9A 2ZGOA 2ZGMA 3N35A 4WV8A 5DUVA 1FYUA 2ZGKA 2EIGA 2ZACA 2A6WA 2CYFA 3AK0A 3KQRA 3GNEA 4PCRA 1LJ7A 2AYHA 5IK8A 2YROA 3RRDA 2AUYA 4YZ5A 1S1AA 3AYAA 4CTEA 1WW6A 3A0NA 2PELA 4GKXA 3JUUA 1MR5A 1AXKA 2EXJA 2JD4A 3HN1A 3R05A 4ATFA 1G9DA 4R9DA 2GNTA 3PVEA 5BYNA 3N7JA 2CY6A 1SBFA 4R9BA 1F5FA 4FPHA 4XBQA 4P9WA 1IS5A 2GDFA 1CR7A 1DYKA 1JHNA 2AR6A 1H30A 3AZYA 3L2YA 4XIKA 1S0EA 4XTMA 3NV2A 2A3YA 3B01A 4YZ1A 3AJYA 1V6IA 4LBJA 3M3EA 3WOGA 2G4IA 2AH2A 2DWRA 2VW0A 4FP3A 5CBLA 1C57A 5GLZA 3WDWA 1VIWB 2WT2A 1KQRA 1G9CA 1N1TA 1RINA 5CNAA 5FRAA 1IOAA 2XB6C 5GZEA 1JYIA 3MW4A 4UW5A 1LOGA 2ZGTA 3OBTA 4YGEA 5H9SA 1Z0HA 3M3CA 3ASIA 2YMZA 3WVJA 5FREA 3ZYRA 1GNHA 2D3PA 1UMZA 4YW1A 4BQ1A 3ILFA 1DLLA 4M3CA 2B7YA 2OUHA 1S0CA 3FUOA 2YZ4A 1WLWA 4Y1XA 4YGDA 3VKOA 2JECA 2Z42A 3WLUA 1HKDA 1DGLA 1TEIA 3LSDA 4M00A 3FLRA 1SLCA 4FPLA 4MYEA 3T1MA 1LULA 4DS0A 2D6NA 3TB0A 4BLJA 1UL9A 1N47A 3NV3A 4LBQD 1LECA 2ZKNA 2ZMKA 1N1SA 4M3CF 4YG0A 2NM1A 2VW1A 1S0JA 1CPNA 5DZEA 1S0BA 3RG0A 1MVQA 1W6MA 2ZA9A 2SLIA 3IPVA 3WDVA 4BMEA 1V6JA 5GLVA 5DG2A 4ITCA 2D6MA 4XIOA 5EWSA 1W0PA 1AX0A 2JE9A 1MS9A 2ZGQA 3A4UA 1YO8A 4YG3A 3M2MA 1FAYA 3APBA 4FOVA 1AF9A 4FOWA 3V0BA 4IQPA 1LEMA 3WG4A 3N3HA 1Z78A 3PMEA 2A3XA 4Q26A 4Y1VA 2VUAA 4XZPA 3AJZA 2P34A 4JRAA 1UN1A 5CA6A 1S0GA 5JOYA 2EXKA 2ZBJA 4Y20A 4XBNA 2XG3A 5T5LA 4WVVA 4Q27A 2VW2A 4XXPA 1V00A 2LTNA 5GALA 1MS1A 4XJUA 4AWDA 1JUIA 3M3QA 5L73A 1MZ6A 2PHRA 1MZ5A 2AGSA 3MEPA 1QOTA 5IT6A 2ZHKA 4U2AA 3NV4A 1Q8VA 1QOSA 1Q8SA 2D7FA 4FPOB 3W59A 1S0DA 3WNXA 1LU2A 1MS8A 2NP0A 4CRQA 3N7LA 4XMIA 5GLTA 4FPYA 4WVWA 2R1BA 5GJ6A 4Q1RA 2GMPA 4ZXKA 3MW3A 2PHXA 1AVBA 1QGLA 1Q8OA 5GLUA 2P3JA 4UW4A 1A78A 3ZSLA 4YFZA 5DZFA 1O4YA 2W52A 1SBDA 2YY1A 4PQ9A 2E7TA 5T50A 1FNZA 2GNDA 4Q8LA 2ARBA 2EXHA 4OZXA 1SLLA 1WLDA 1VAMA 1AX1A 1FNYA 2D6OX 1IS6A 1BZWA 2OVUA 2R49A 2JJ6A 1AJKA 3KM5A 3RSJA 3VV1A 4GKYA 1YIFA 4ATEA 1HQLA 2Q5TA 2CWMA 4DRVA 4GXLA 2P2KA 2I2SA 3ZSKA 1KITA 3R4SA 3UK9A 2UURA 4YW5A 1CVNA 2DVGA 3O0WA 2CL2A 1DFQA 5JVVA 2D43A 2ES3A 3R4UA 3O0XA 1JBCA 3WHTA 1D0HA 2KM2A 2WLQA 1FATA 4YFWA 4AGVA 3C2UA 5IUQA 1LOFC 2CNAA 4WZFA 5CAZA 2UU8A 5JMCA 4XHBA 2DV9A 3ATGA 2A70A 1ULCA 4LBQB 2OUJA 3SH3A 3RMYA 3WDUA 3T2TA 1R1ZA 1Q56A 3M3OA 1QKQA 4DFSA 4UW6A 4FOYA 3RQ0A 1SFYA 4YZ3A 2YV8A 2WSVA 4ASMB 2P3KA 3HR9A 1CQ9A 2LALA 4FPJA 3SNMA 2VXRA 1FX5A 1UX6A 3AYDA 4XJ9A 2YXSA 1YYNA 5DUWA 1SLBA 1LODA 2V73A 3WHUA 1HDKA 1AXZA 1ULEA 2ZGRA 5HCFA 3AYCA 3B3QE 3SITA 1LGCA 2UWAA 1FV3A 1LU1A 2A75A 2DYCA 2FMDA 3OY8A 2R0HA 1SACA 4W65A 4U36A 3AP6A 4FVVA 3AZZA 3B00A 1WBLA 2BQPA 1OQ1A 3O0VA 3N7KA 5KXEA 1SCSA 2HYKA 1G9AA 3QLQA 1U0AA 1W6PB 1LOAA 1W6OA 5GZGA 2R0FA 4XDQA 2ZMLA 3ILRA 1LTEA 5E8AA 5F5QA 3POWA 1AXYA 1ENQA 2NMOA 2DU0A 1DQ2A 4P9XA 1GBGA 1DYPA 2A6VA 1WW4A 4XOGA 1CJPA 4GWNA 1KJLA 1WBFA 2SBAA 5T54A 1UAIA 2PHUA 1GYKA 2A7AA 3AXEA 1DQ4A 2A5ZA 2C5DA 1GV9A 4YW2A 1BJQA 1W6NA 3AZVA 3NWKA 1WW7A 3V0AB 2CTVA 2NMNA 3IKWA 4Q8KA 5JDBA 2GALA 1G9BA 2D6LX 3DUIA 2E7QA 2H0BA 4FPGA 2NYYA 5GZFA 1QNYA 2ZGNA 2W08A 4K1ZA 2A6XA 2DVDA 3AXDA 3WG1A 4L8QA 1DBNA 4YGCA 3OY8B 1LGBA 5T5OA 2VY0A 4Y26A 5E89A 5T5JA 1RIRA 4Y1UA 1QDOA 2NN8A 4GA9A 3ZXKA 4FP2A 3AP5A 1YRZA 4H55A 1LHWA 3BIWE 4K20A 3W58A 5DG1A 3UJQA 2E6VA 1LOEA 4DRRA 3UL2A 4ISQA 1SLAA 1W6OB 2A6ZA 3CNAA 2WNEA 1Q8QA 3AX4A 4AVTA 1MACA 3N7MA 3TAYA 4LBMA 3O12A 4Y24A 1PZ9A 4YW3A 1ULGA 1KRIA 4PBPA 2WQZC 1WD3A 2CWSA 3ZXEA 2GN7A 1KDKA 3AYEA 4BLIA 1V6OA 1W6NB 4I30A 5CB7A 1YXWA 1G7YA 1BXHA 2R16A 1ENSA 3AP9A 1C1LA 3LSEA 2A6YA 5GZCA 3OGGA 4LBQA 3HMYA 3ZPYA 4C1WA 1GANA 2AENA 1XQNA 1DZQA 1MS4A 1BKZA 1GZ9A 3SLIA 1Y7BA 4AGGA 2ZMNA 4GWMA 4GALA 1A3KA 4K21A 1X50A 3O5SA 3OYWB 2P3IA 1UZZA 3BODA 5T52A 1BYHA 2ZHMA 4BOWA 5T5PA 2D6KA 3DGTA
chains in the Genus database with same CATH superfamily
1JHJA 2MHFA 3LE0A 2VQTA 2VJXA 2AACA 1NZIA 3AMPA 1K12A 4FPKA 1BLZA 2ARCA 5IVVA 3PVNA 1VMHA 1BMV2 5F2SA 5M0TA 3BKZA 1GQHA 3WQ0A 1YQCA 3UGFA 2ZHNA 2W39A 4FAHA 2Z79A 4Q4W2 1H8TC 2Q0AA 3MW2A 2VMIA 2DUPA 2XWJB 3QACA 4LIUA 1F2NA 5FY5A 2WWJA 2E51A 2EVXA 2PLV1 3NNJA 2C1FA 1AR72 3WCRA 1UZWA 4HVOA 3WSOA 3THTA 3AZWA 4CUBA 2A71A 5KXCA 1C8NA 4COZA 1HLCA 4QD2A 2WZR3 3WUCA 1ZBE3 2DFCA 1AZDA 2GMMA 2WO1A 4Z07A 1UIJA 2RS51 4CXWA 5LBBA 2V4AA 2Y6FA 1WCSA 4AVSA 1RL3A 2XUMA 1OVPA 4TXWA 2D93A 3J8F2 4YNIA 5GLWA 3IAQA 2WFF3 1F4AA 2XPJA 2YHJA 1DLCA 1TZOA 1VRH3 2HWC2 3IIAA 5FZBA 4ZKTB 1XRUA 1ZZ6A 2TUNA 5FYCA 1KXGA 2JDAA 4AQ6A 1CJDA 3RGBA 1KDMA 1DQ1A 2ZGSA 1PVC3 3IDCB 3MDPA 5FJHA 3POJA 3VDDC 2GN3A 3RZMA 2QFEA 4YVWC 4JC1A 3VHRA 1ZM1A 4BQ4A 4L0PA 4WVZA 1R091 1PM4A 1IS4A 2MPFA 3MPBA 5FYMA 3BUCA 3BOPA 5FKBA 1HJFA 4RS5A 3JBG1 5T55A 1EPWA 3B69A 2JB8A 4FFHA 2VZRA 4B29A 5L7OC 2Q8OA 1CZSA 5FY8A 3ST7A 4AFCA 4LA2A 5KXBA 3OPZA 4HSLA 4NVPA 1BQPA 4B1MA 1W6QB 2PYTA 1CAXA 1D7PM 3HVDA 3RYKA 2X09A 4M01A 3L9JT 3NKTA 2VL4A 2XL7A 2DVBA 2QQVA 1VBD1 2FCUA 4LBKA 2R6QA 3LIHA 2B9VA 3DKQA 1WMXA 4FPCA 4QXHA 1RC6A 3S57A 4YGBA 1AR83 4QPGA 1MEC2 1SDDB 4YVSB 3VBUC 4AEDB 4AW7A 1RMU3 4BQ5A 5C3OA 4CPBD 1TNFA 2BU9A 2VOXA 2WS91 4AQ2A 1TMF3 3KVAA 1H4HA 3HNMA 1ENXA 2UWCA 4D3WA 5F37A 1UKGA 3PVOA 2AEZA 1W03A 2E33A 1WMDA 4MXWB 2JE8A 1BHGA 1H2KA 1C28A 2XHKA 3VKLA 2E63A 5A7WA 1SDWA 3J7NA 3MIEA 3HT1A 3NVCA 1REDA 3OYWA 3ACHA 5A32B 1IG3A 2XGXA 5A3OA 3DPRB 4MVTA 3E5UA 3INAA 1GLHA 1UOGA 3FFZA 5D21A 2W1SA 4QAWA 3NAPB 2QQLA 2R1DA 4Y5Z0 3RVHA 2D3RA 3UGHA 4J1WA 5JPMB 1IKPA 1QNWA 1LGNA 3THDA 4BIOA 5JOXA 1E5IA 1PO21 3EO6A 3VZNA 1RUC1 1GZWA 3NNLA 1C8M2 5BV6A 3BTAA 5JZGA 4LUKA 3TNPB 1WWYA 1OSGA 1YQ6A 1UMIA 4XFHA 5LW9A 4QU1A 1OA3A 1LNSA 1VBB1 1H6YA 1IS3A 4XILA 5F9TA 2JDMA 4IEVA 1DQ6A 2HWF3 3KHBA 5J09A 4A6SA 3ZXLA 1E57A 4WBBA 2AEYA 1E5HA 2WNVB 4UFLA 3VZOA 3FLTA 4AHWA 1O5UA 4BHPA 2HWD3 4K7JA 1QH7A 2ZABA 3MUZ1 1AL21 1RHI3 2WR9A 3I8TA 2XLFA 4QT6A 4AAXA 3N36A 4BMBA 5G05L 2AC1A 4AYUA 2VBDA 1NKGA 1OLME 3FE5A 1A8DA 3MLJA 1ZYBA 4GH4B 5EYXA 3WG2A 1JZ7A 4Q4V2 4HL0A 2PHTA 4XUPA 1B09A 5H9RA 1I3HA 2DBNA 3FHAA 1CGPA 1S2BA 3MV01 4V2WA 1YJLA 3KF3A 5ACA2 1AYN3 1W6QA 2XQXA 3OUIA 4IESA 3NJXA 2ZGPA 1F9KA 1UQXA 2DFBA 1FYUA 1TG7A 1QEXA 2E32A 2GZWA 2IXJA 2W9XA 2ZGKA 3THPA 4BQYA 5FYZA 1QJY1 2AUYA 4PF1A 3ALQA 2JG9A 3ZYJB 4CTEA 1ZX5A 4ZY9A 5ABJC 4LOTA 1MR5A 1AXKA 2EXJA 4AEDA 2GNTA 2H6CA 5T3NA 5BYNA 3AMHA 4HPKB 1OQDA 1SBFA 5LZ6A 4XBQA 4P9WA 1JHNA 1DYKA 4XIKA 1H30A 3NV2A 1R1A1 4I0BA 3BI3A 3F95A 2XVLA 1Z7S1 2J1VA 3MO4A 4MXWA 3U4SA 1LAJA 4EWAA 1G6NA 1AR73 4HN1A 1XYOA 4H7LA 5CBLA 4LO8A 5LBEA 4IEQA 1KQRA 3AKSA 1ACCA 5A32A 1B35B 1G9CA 1UD1A 3OGRA 1N1TA 2J1TA 5CNAA 1JYIA 1IOAA 3DPRA 5FZLA 1W90A 4Z92B 3UKTA 4UW5A 4Z82A 1LOGA 4XUTA 5FZAA 1PIV2 4OHVA 1Z0HA 1JYVA 4E27A 3NAPA 4CVUA 3J8F3 1OQEA 4NJ4A 3ZYRA 5FCCA 2XVGA 3VZJA 3E6CC 2OZ6A 2HWC3 4YW1A 4GB31 2OUHA 1S0CA 5JIUA 2V72A 1WLWA 4RHV1 3PHMA 4N43B 4H14A 4QX5A 5JAXA 2D40A 4M0HA 1HKDA 1DGLA 2ET1A 3LSDA 4ET7A 1W9YA 4FPLA 4CU9A 1OOPB 5A7QA 2GC1A 1X36A 4ZU7A 3I2GA 1UL9A 1JOPA 3S30A 1YWKA 5KXEA 1CAVB 4LBQD 2IXIA 2ZMKA 5F3EA 4YG0A 2NM1A 2VW1A 4IXLA 2YB7A 2GC2A 2Z2SB 3HNYM 2IFWA 1JYXA 2BERA 5BPXA 5CG8A 1GWKA 2ADEA 4UWDA 5F32A 1TE1B 4ZS3A 3A4UA 1JZ5A 1WMFA 1YO8A 4YG3A 1JZ8A 5C9AB 3A7QA 1FAYA 3SCHA 1ZZ8A 3SMHA 1AF9A 1VBC2 3L2HA 5FP4A 3IIIA 4IQPA 5BNNB 1PK6B 5IVYA 2R062 5J37A 1OBNA 1KFUL 3F2ZA 5JI9A 1MEC3 4INDA 3LPGA 3CU7A 4GH4A 4LPLA 3I97A 4PIXA 2HEVF 1UN1A 2DCYA 1S0GA 2LS6A 2D5FA 1NCRC 4QKFA 4BWOA 4DXRA 3N9PA 3NSTA 3CF6E 4GWIA 2J7MA 4O61A 4QQOA 2XG3A 4H3WA 2CU5A 1RJ8A 4L2NA 3ZLIA 1RUG2 5FFOC 2LTNA 3TBDA 1XNTA 2B46X 2VMDA 2RM22 4QX0A 1MS1A 2QQKA 4HXCA 4KG8A 2VTXA 4D0QA 4AI1A 1JOBA 4P5HA 2ZHKA 5IT6A 2HBTA 3THCA 1Q8SA 4FPOB 4XUNA 3WX5A 4FSJA 2RDQA 4CPBA 1MS8A 2B42B 4KU7A 4HPKA 3FC0A 5IATA 1AYM2 2V09A 4BK4A 4WVWA 2R1BA 4QB1A 5GJ6A 4ZXKA 3BCWA 5LY2A 3FHQA 2J1RA 2PHXA 2J1SA 4JDMA 3VBOB 4OHYA 1C8M3 1D4M1 1L7RA 4EWEA 2WYSA 3KGZA 4YFZA 1HXS2 2VOKA 1VJ2A 4GMP0 4LULA 4UF0B 4WV8A 3ROUA 2YY1A 4IEWA 3O14A 3KQ4B 5FZ6A 1LR5A 1B35A 2ARBA 1S4CA 2DF7A 2EXHA 1W2TA 4OZXA 3MUY1 5K4LA 4QB2A 4CE8A 1STMA 3W5NA 1NY71 4IE5A 4JQRA 1T6GC 5FTTC 1SFNA 4FFIA 3S5AA 4UFMA 3S7EA 3T0AA 1HQLA 2CWMA 4DRVA 4JGYC 1F4HA 4NPRA 3MIFA 1GNYA 4IETA 3VLBB 1H2LA 1AL0G 3BOWA 4YSFA 4LTAA 1W8FA 2BWCA 2D43A 4W4ZA 2ES3A 3R4UA 4XVHA 3S6PA 2HWB1 4CDUC 1JBCA 2XBO2 5BXXA 1D0HA 2KM2A 2WQ4A 2VOVA 1XOYA 4YFWA 1GWLA 4Q4V3 2XKPA 5IUQA 1LOFC 3K2OA 1OOPA 3SKJE 2UU8A 5CAZA 5JMCA 2DV9A 1CAVA 4LBQB 4C91A 3SHRA 3ZYIB 3WDUA 1R1ZA 4NN0A 5ACA3 3DYOA 4OYUA 2R7EB 4DFSA 1WKYA 2QDNA 3A21A 2BOIA 4LORA 3RQ0A 4B4PA 2HWE1 1C3HA 4DZGA 5HV4A 2WO7A 1CQ9A 2LALA 4OHXA 1VBA2 2KA3A 4XF9A 4CDQC 3SNMA 1FX5A 1UX6A 5FZOA 5IFPA 4J25A 4F8AA 5BNNA 1W99A 2UY8A 3SKVA 1PK6A 5A6QA 1LODA 1AXZA 5FUPA 4CUGA 2IVIB 4IERA 5J48A 1TME1 3AYCA 3B3QE 1LGCA 4KQ7A 4AEKA 5J7MA 1FV3A 2A75A 2DYCA 2ZZQA 4PI2A 4DB5A 4H2AA 2R0HA 1SACA 3VHOA 4OQ8A 5C5TA 3AZZA 1WBLA 1QJX1 2BQPA 3HPNA 2W95A 4JHTA 1OQ1A 3O0VA 3VL9A 5JCTA 5EV7A 1SCSA 1I5ZA 2X53S 1H2NA 5FK7A 3QLQA 4A2UA 3ETQA 1G9AA 1U0AA 1W6PB 5GZGA 1HB3A 1X9TA 3TWIA 4GJZA 3ILRA 1KS4A 3VZMA 1UWWA 1AXYA 5CFCC 5FOBB 1DQ2A 3VD9A 3UYJA 1DYPA 2CAUA 1GOFA 4KGGA 3C7OA 3TOJA 3LAGA 1PIV3 4KWKA 3SC7X 1KJLA 2SBAA 4LKEA 3OPWA 1WZXA 2BYVE 5AC92 4QGMA 4AVAA 1UAIA 2GU9A 2DCZA 1GYKA 1EV11 2A7AA 2VCBA 1OUXA 4OI1A 3I3BA 3LWCA 3U14A 3WP5A 1XNBA 1RUI1 1BEV2 4N7UA 3N9NA 5FZ1A 1PHMA 2RG4A 3H9AA 1ZZCA 4QX8A 5A3MA 1J3QA 3VBOA 1OLQA 2ZEYA 4XW3A 4FFGA 3POBA 4Q29A 4QDRA 5FZ8A 5GZFA 4D7YA 5F8PA 4Q4Y1 4L8QA 4UF0A 4W6YA 4QX7A 1LGBA 3LA3A 2VY0A 4N53C 5T5OA 1NG0A 4JRLA 5KHJA 1QDOA 5F5CA 3WP3A 1V9U1 2FZ1A 3ORJA 5J1XA 4HN0A 2QQOA 2PA7A 2YUEA 5KHKA 1LOEA 4B3NA 4JVAA 4X6RB 2A6ZA 1JZ4A 5KHGA 2WNEA 3WW4A 3AX4A 4J6GA 2AZ5A 2CGOA 3MF9A 5EJ1B 5J96B 3NJVA 4CCCA 1FOD1 1F15A 1VBC3 4Y24A 1KRIA 2B5HA 2R063 4QDQA 4LHSA 1UXZA 1P8JA 3VHNA 5CISA 1XE8A 1FPN1 1NE4A 3OBZA 2GN7A 3EHKA 1KDKA 4BLIA 4EN8B 3OBAA 1YXWA 4NHKA 5IHRA 2R16A 3AP9A 2VECA 4XFIA 2A6YA 3UETA 1K5JA 4LBQA 4C1WA 4WVMA 2AENA 4CEYB 5FUIA 3T4VA 4IW3A 2RJLA 4B1LA 5K7PA 1SMVA 4CA9A 2Y26A 1DU3D 1GZ9A 2JEMA 4N7IA 4AGGA 4GWMA 4QPYA 2ZX1A 4LIVA 2RM23 2YU2A 3O5SA 1VBE2 4YWAA 1XNDA 5A7OA 2ZHMA 4AOCA 2XHNA 5LA2A 2QKDA 4YVWB 3B94A 3QH7A 1K5MB 2D6KA 2JIJA 3AFKA 1LOBA 1DG6A 1UZYA 1VAKA 2JX9A 2LUWA 3AKTA 4XACA 4BPZA 1AJOA 5JWPA 1UYZA 2VVEA 2DUOA 1ND3B 2OIIA 2ZHLA 4NO4A 4WM8C 1AYM3 1PNGA 2W87A 2YFUA 3K46A 3ZXJA 3TEZA 5EHDA 1YNAA 4XQ4A 2GP3A 3AKQA 4PDWB 4X8NA 4A7KA 3ECQA 3WG3A 1J3PA 1YFUA 2ARXA 4HT1T 4IE7A 2LM3A 5EXOA 4BQXA 1HXS3 1R64A 2O0OA 1NAEA 1W6PA 4XF1A 4XF4A 1X8MA 5D8AB 4Q0UA 5DAWA 3JB4C 2ZJCA 1RUJ2 3VKNA 1GP6A 3DKWA 3DF0A 1YFYA 4D6SA 5C8CB 1COV2 4QKNA 1SZBA 2P6HA 1DZRA 2Y6JA 4MGZE 3RZKA 2A1XA 4AQTA 4BDVB 1HQNA 1NA1B 1QY4A 3VBUB 1W2OA 1ONAA 4RR3A 1SLIA 2DTWA 2HEWF 3KVBA 3J7MA 2Y6HA 3GALA 4MUVA 4PQQA 3ZFEB 4GIQA 4B7KA 2ZEXA 5BNPC 3VBSC 1LEDA 2JDZA 3T1LA 3WNLA 2I45A 4ARYA 1QDCA 1CONA 1ZBA2 3POYA 2C4XA 3SH4A 3CJIC 2WL1A 5DZGA 1NZCA 5FYSA 2Z5WA 3NJZA 4MADA 3OBRA 3ZVXA 4BXSV 5CFDC 1CPMA 2XBO3 2FD8A 1QJU2 3P5BA 2JDHA 4DUWA 2X10A 2WAAA 3PIGA 3BU7A 3IDEA 1LOCA 2WDBA 4XFCA 2XUEA 1W2AX 5HXVA 1GOGA 1H0BA 4H7MA 3DXTA 3WF4A 3WZ1A 2OX0A 2R073 3AVSA 4GMP3 1OT5A 1RITA 4QKBA 1NT0A 5FMDA 1JYCA 1VR3A 3D0JA 3ZYPA 1WCQA 2QQJA 2JDYA 1CAWB 2VZ1A 4FQ4A 2VBBA 2WT1A 1WGPA 4XJ8A 3PTRB 1RB8G 1VBA3 2EIBA 2WNUB 4DIQA 4NOTA 1RJ7A 2XQRA 3K48A 3OG2A 3H42B 1OLRA 1YJKA 4Q1PA 4UBHA 4FTSA 4D7TA 4MG2A 1CIYA 5LRRA 1S0IA 3IM0A 1HB4A 2ZAAA 3OEAA 5HCBA 4HG6B 3VD5A 4CYDA 5EZWA 3LEIA 2W1UA 5I8TA 4FTBA 1NLSA 1OHFA 2VUCA 4Y1YA 5FYHA 2Z69A 3AFGA 4IV3C 3U4XA 3H8OA 2W68A 3FUQA 1XE7A 4M4RA 4QPIB 4QGLA 1N3PA 2PLV2 2D6PA 4XTPA 2Q8EA 4CEYA 5LB6A 1GZCA 4YZ4A 5FP9A 3GXUA 1MS0A 3WUDA 1ZZ9A 2Q8CA 2PAKA 4A7YA 1H8VA 1UO9A 1ZBE1 4RS5B 3QD6A 4XJWA 1QIQA 4HVQA 5I0DA 1UX7A 2JDKA 2WKKA 1W0OA 4AAPA 3V65A 3VKMA 1W2NA 4XFAA 1WLCA 4Q2FA 3FLPA 2VZOA 1W8NA 4YVWA 1K5MA 1VRH1 3AL5A 1GICA 1X82A 4QQPA 1RUF3 1VE0A 4XFBA 4HK9A 5AC93 1I1EA 2VR4A 1KGYA 3RMXA 4Q0SA 3WQ7A 2PHWA 1ND3A 3C7EA 4NMIA 1BBT1 2HEYF 3EYPA 2HWD2 4M3CB 2YPJA 2W5FA 1RHI2 5FMBA 3X29B 4PDWA 1R092 1QOOA 4FFFA 4AVVA 1HIXA 5SV8A 4URAA 1C1FA 3ZFGC 4CCKA 5FY0A 1JN2P 4HBNA 4CDXC 4C1XA 1WW5A 3JBG2 3M1HA 1V6MA 4CDWC 4YW4A 2DVFA 5D8AA 2NLRA 2RS13 3FL7A 2RHPA 3ZSJA 3UNPA 2B9UA 3PJQA 1J1TA 4KI5M 3T09A 2WA4A 1QHDA 4LK7A 5BNOC 5C8CA 1G9FA 4FTEA 4YM0A 2I07B 5DDJ1 5LA9A 2E53A 1MS5A 5BUVA 3LA2A 1NA1A 1W6MB 3VBUA 1YQ8A 2ZZJA 2GNBA 4JCKA 1H9WA 2OW4A 4P08A 2JD9A 2EF6A 2ZPXA 4XJAA 4XYXA 1DHKB 4R8HA 4XHXA 2XJTA 5C3QA 3MV11 1VBD2 3ZFEA 2X5IC 5F3IA 3MGUA 1WCDJ 1UOBA 3BGAA 3M7AA 1AR81 3IN9A 5K0UC 2QUOA 5D1IA 3V0BB 2EIDA 5JOWA 1ULDA 2Q1MA 1XJAA 1TMF1 2WS92 2YGMA 3PU3A 1PGW2 4L97A 1N3QA 1YUDA 3K3NA 1DIWA 2UY9A 3KLSA 3RS6A 2BFUL 3HWJA 1HN1A 2ET7A 2K2SA 3AP4A 5EFUA 2CSGA 3H1YA 4XF3A 4MGIE 5GZDA 3ZX7A 2C9KA 2JDNA 3D82A 3ES4A 3KCCA 3WDXA 1GZWB 1QJFA 5GM0A 3FMGA 4P9GA 5JZGB 5GKAC 4DPNA 1D4VB 2GMEA 2FHRA 2VBPA 4YM2A 5KXDA 1NOVA 1CAWA 5FQ0B 3JU9A 3V64A 1ND2B 5DUVA 3ZIXA 1OF4A 2ZACA 3T0DA 2WNUA 1VBE3 5KC5A 4IGPA 5IK8A 3ZR5A 3OD4A 4L99A 3RNSA 3H3UA 3JUUA 3DYMA 2GAUA 3URFA 4EZ4A 4L92A 2QTWB 4R9DA 2VCCA 5I0UA 4C0HA 3PVEA 4COWA 3N7JA 1PO22 4QWNA 1RUC2 1RUE1 4E4HA 1IS5A 2GDFA 3AZYA 3L2YA 4P02B 4QPIA 3M4FA 1S0EA 4ZZ8A 5A3UA 1REEA 4QQ2A 5C4WC 4CEWC 1O3RA 1RUH1 4YZ1A 3SXWA 4IUGA 1YQ5A 4QM9A 1VBB2 2Y34A 2AH2A 4CCJA 1ULPA 5A7SA 1C57A 3OUJA 2PMWB 4AFBA 1RUJ3 4KNCA 4YW6A 3BALA 5FUNA 5A6YA 3U10A 3WF0A 1COV3 3KGLA 4OCTA 1QXPA 4CP0A 3OBTA 3EXUA 3UKNA 1NXMA 5H9SA 2BTVC 1ZVFA 3M3CA 5FO9B 3I3MA 2YMZA 5FREA 4LO5B 4R4XA 2VMGA 3WW1A 4BQ1A 1DLLA 1JMUB 1JODA 4M3CA 2B7YA 2VMFA 3VD4A 3VB9A 3VD3A 1ZBA3 2JG9B 1PM7A 3LOIA 4YGDA 1O5LA 3VKOA 1VB4A 2QBXA 5FPVA 4CCEA 3WLUA 1DGRN 1QJU3 1UNBA 3GBGA 1RUD3 1LULA 5CU1A 1GP4A 4DS0A 5AFEA 5FBJA 2D6NA 4WM7C 3CLPA 3TB0A 5FY1A 4BLJA 1W0NA 4NR1A 3DCQA 3NV3A 5DZEA 4WZCA 3LA7A 4N8MA 3RG0A 4KGQA 1S0BA 3E6BA 5FMCA 3WDVA 1W6MA 2Q1FA 2SLIA 2ZA9A 5FZFA 4TTGA 2W92A 4MXVA 5DG2A 5C33A 1QJY2 2JG8C 2JE9A 2ZX4A 1GWMA 1MS9A 2ZGQA 4FXKB 4TN7A 3APBA 4FOVA 3V0BA 1A34A 4FBFA 2RR12 1XNAA 1U5YA 3P3PA 1NCQB 2A3XA 3JZVA 5EQUA 3KB5A 3GF6A 1J84A 4MGYE 2TNFA 1GZTA 4ZZ5A 4Q4W1 1VP6A 4LT5A 4P5YA 5DABA 1K45A 2WO3A 5JOYA 1Z7S2 4QXBA 4ZXEA 4DXSA 2PLV3 4BISA 3CO2A 4JQTA 5IFTA 4P9IA 2ZBJA 4KMQA 3ACGA 1A8MA 2W0XA 4V2VA 3HJRA 3PIJA 4LO6B 4Q27A 2VW2A 2N7GA 5FQ0A 1ND2A 4PJYA 3CIHA 2L9LA 5B4NA 3LFIA 2WRAA 4DXZA 4QKDA 1HV1A 4AWDA 5L73A 3M3QA 5FY9A 1TVGA 2PHRA 1MZ5A 2HWC1 4KL1A 3MEPA 1UW8A 4IEYA 1HRI2 3T4HB 4GB32 1QOSA 1UY0A 4LOSA 3W59A 4D8MA 1S0DA 1JYWA 4CUAA 3N7LA 5FYYA 4RHV2 4XMIA 1RXFA 2GMPA 3WP4A 3N9MA 1R093 1QGLA 4JDOA 2XJPA 1W39A 3PLQA 4HZFA 4RQPC 5DAQA 5GLUA 3VBHC 3ZDSA 1PGL2 5IYYA 1ZRDA 3D0SA 3JBG3 3DXUA 2W47A 2E7TA 3VBRC 1QQP2 2GNDA 2Y6GA 1A6CA 5LATA 3R4DB 1AX1A 2R49A 4IE0A 1BZWA 3C3VA 1EY2A 3KM5A 4FXGB 3U11A 1K42A 3MLKA 4Y4RA 2CHHA 4EN0A 3I3EA 4GXLA 1VBD3 1W9WA 3I2HA 4NE9A 3Q8CA 4S2GA 4XDPA 1MEC1 2UURA 4YW5A 3WNKA 1HRV1 5L19A 1OMIA 4QGNA 3O0XA 4BA6A 2WS93 2R32A 2BGOA 1SQ4A 2WLQA 1ASJ2 1POV1 3HOBA 1FATA 3RJRA 3W21A 4QPGC 2YBKA 5HV0A 4GJYA 4XHBA 2A70A 3GZTB 1PX3A 3WP6A 5FO8B 2J42A 3SH3A 3WQBA 2CGNA 4LO7A 3JD71 3T2TA 3QOPA 1Q56A 3LDBA 1H1AA 1NUKA 4UW6A 2VNGA 4JKKA 1SFYA 1HB2A 2HH9A 2P3KA 3HR9A 4MH0E 4PLNA 1EPZA 2F4LA 3AM2A 4MGKE 4RD7A 4EWDA 5JXIA 1WA6X 4XFGA 2BDRA 4LJHA 4LK6A 2V73A 4FI9A 1ULEA 2GC3A 1NCQA 4KG0A 3GDBA 4MHRA 5HCFA 1DGWX 4AK3A 5BNQA 3H7JA 1PO23 4EQVA 2ADDA 1RUC3 2VZVA 5ISLA 2G19A 3OY8A 4U36A 4DEQA 3B00A 4NIHA 5ERLA 2VCMA 4PHZA 4R52A 2F17A 3HBKA 2VE1A 3KF5A 3N7KA 4MOAA 4DY3A 1UU5A 2WWSA 1VBB3 4C0BA 1W6OA 1CZTA 4XCAA 5DMYA 3VD7A 1LTEA 1DZTA 1BVP1 3LEMA 2NMOA 1XNKA 4P9XA 1NY72 1LKNA 4JGZB 4K3UA 1GBGA 4XOGA 4IV1B 4A41A 2GH8A 3TEYA 2K9ZA 1WBFA 5T54A 3FX3A 3NNGA 2BNMA 4K40A 3LDRA 4LKDA 3W20A 3OGSA 2FQPA 3VBFC 2K0GA 1DQ4A 1AUYA 1UU4A 4D6QA 4PIYA 1IPSA 1W6NA 2XONA 2YU1A 3AZVA 5FZOB 3V0AB 5KHIA 3BTZA 2CTVA 4Q8KA 2HWB2 1FI2A 5JDBA 3TEWA 2GALA 3K4DA 3H8UA 1G9BA 3RPQA 3RYRA 4Q4V1 1PGSA 1IHMA 1O8PA 4FPGA 4OUMA 1XBFA 3POIA 1QNYA 2W08A 3ZFFB 3AXDA 3WG1A 1W8HA 4YGCA 2WYFA 3KSCA 4AL9A 4XC9A 1O7FA 3ZYFA 4AEJA 1UIKA 4E4SA 3PVBB 5A1AA 4CDQA 1KS5A 4AQSA 2NN8A 3ZXKA 4Q0VA 1MQTB 2ZCWA 4K20A 3B7MA 5FP8A 2E6VA 2XKOA 3I2IA 3M70A 5FO7B 1QJY3 4OZOA 3O1MA 3Q8BA 3C7HA 4OFGA 3W5MA 4W50A 5A7NA 3OD0A 2XMLA 1C5IA 2BJSA 4NWVA 1PZ9A 2RR13 5FV3A 1TME2 1LB2A 2BWAA 2PFWA 4MV2A 1W05A 3ZXEA 3I7DA 3GZAA 5FPUA 2BVVA 3AYEA 3FHIB 4I30A 4Q4X2 1JZ6A 4YVSC 5CB7A 1G7YA 4NHXA 4AEDC 2VM9A 1UY3A 1QJX2 5CFCA 2WZEA 5JSPA 4EN7B 1Z7S3 3HMYA 3ZPYA 2ZS6B 5JSOA 4JX0A 1RTVA 1AR61 3JQWA 1MS4A 4LLFA 1OH4A 3SLIA 4AHZA 2XJVA 2QQWA 2ZMNA 2P3YA 4DY5A 1GFF2 4K21A 1X7NA 4ZPIA 2PQSA 2P3IA 3ZKUA 3J7HA 3NW4A 1MPXA 1UZZA 3A23A 3BODA 4NPMA 4IEXA 4A44A 4BOWA 2MEV1 1KFXL 1EV12 2ORXA 1HRI3 3DPRC 5C3SA 1VAVA 1RUI2 2R041 2BNOA 4GB33 4HANA 3HD8B 5FZCA 3WCSA 3MPPG 4Q5OA 5I93A 3B93A 3IMNA 4QHZA 4RHV3 3KT4A 1Y9QA 4X8PA 4KU8A 1LCLA 2V5YA 1N3OA 2ZGUA 5BY5A 1QWRA 4Z1VA 4Q4Y2 5CVRA 3Q8FA 4AE2A 1D2SA 4HLTA 4DUXA 1PO12 4FO9A 2A73B 5A1FA 1RXGA 3D3AA 5F7UA 2TEPA 5KWRA 1OD5A 1O59A 2B4KA 3HT2A 1C4RA 1XYPA 1IQDC 1QQP3 1N1VA 1V9U2 4Y5TA 4EE2A 2BGCA 1DQ0A 5EJZB 1EAH1 2Y6LA 4JGZA 4WVMB 2P1BA 2R072 1SCRA 3ZSMA 4BM8A 4HK8A 2DTYA 4IV1A 4NIGA 1V6KA 2VQAA 4RN5A 5LWBA 2W46A 1OKOA 3IZOA 3WW3A 1HN0A 3T2PA 4HONA 5FPZA 5EIYB 5IVBA 2EAKA 4YW7A 3QBQA 4RSUA 4CCDA 1US2A 1U5IA 5FIXA 3IDBB 4C90A 1EP0A 4Y22B 3V0AA 1ULFA 1AX2A 2UYBA 1WD4A 2WNVC 4KBBA 4MZUA 1VMJA 1FPN2 1LHOA 2JDUA 5H9PA 1GQGA 1GSLA 3VZLA 5IVJA 3ZFFA 4COYA 2ERFA 1OUSA 4E8CA 1ASJ3 4R9CA 3QH6A 1CD3G 1VLNA 4FCAA 1KJRA 5FYBA 2C6SA 2DCTA 2ENRA 3ZR6A 5FZEA 4DQAA 4DUVA 5IK7A 2Q30A 2ZX0A 3PUIA 4GH4C 1IKQA 4NPLA 4QQLA 5DUUA 4LLOA 3SQOA 1UPSA 3PDQA 2FBEA 1MQTA 4YYOA 1RUG1 2KXLA 4R9AA 2QQPA 3OPTA 1WA4A 2FZ2A 1S55A 4ZONA 4BCUA 4G3YC 2TBVA 3FBMA 1DGWA 3IT8A 2WJSA 2XLAA 4F83A 5FZ4A 2X8KA 4JTNA 4WM8A 4LEJA 4YRDA 1UY2A 3RI9A 4LBLA 4Y3OA 4J1XA 3D6EA 5FZ0A 1RUF2 2WZPP 2E31A 5IVEA 4XFFA 3KV9A 2C26A 2WSUA 4RR3B 4QU2A 4XBLA 2OT7A 2BOJA 3WV6A 2BPA2 2AREA 1XC6A 5F2WA 2VOWA 4JKLA 5IK4A 3KV5A 1O4ZA 1D4M3 2QNKA 5EYYA 4OUSA 4XEZA 4AEMA 5B2GB 5IAVA 4IEUA 1O3TA 1W9TA 5FPBA 1J58A 3PTYA 3H0OA 1V6LA 5JR2A 4RGGA 1F31A 2XJQA 2RS12 4Z8BA 1S0FA 3N9OA 5FLHA 4FQZA 5HCAA 3PMSA 3ZXDA 5FXZA 4Y33A 3GZEA 5F3CA 1B35C 3POSA 4XMAA 3I4IA 2ORZA 4NRQA 4XE9A 1Q8PA 3OJBA 5CFDA 3MLLA 1OA4A 4K8RB 2YYOA 3U0ZA 2D3SA 2J22A 4OI2A 4AXOA 2CGPA 2DUQA 3J26N 2HYXA 3ZMOA 1CESA 3ZKYA 3AMNA 2HLEA 4OMDA 2XBO1 4IL7A 4A6OA 2HWB3 3E5QA 1H8TB 1AHSA 1QU0A 1W8ZA 2RDSA 1POQA 3DL3A 5AVAA 3LIGA 2RE9A 1RYYA 2XVKA 3R6SA 4N43C 4SLIA 3Q8AA 1DQ5A 4E2QA 5AFBA 5C71A 3RYPA 3ZIWA 1VMFA 1JUHA 4GMP1 1L7QA 3GYDA 5LEJA 2DURA 2O8OA 4JTOA 3MI8A 4QMAA 1KD7A 5LA1A 1FMD1 1OOPC 2XL9A 2RS31 3NKGA 4JZRA 4QDSA 5I91A 2JDPA 5FMOS 2F6BA 4DEVA 4XUOA 2BZDA 3TN92 5FOJB 5KBFA 4OMCA 2BRTA 1H9PA 2QZ2A 1ZRIA 4IE6A 4Y22A 3VDDB 5C6CA 2IUWA 1RVF1 2WFPA 4ARXA 4P9YA 2ARAA 5C9AC 3ZM8A 1TME3 3H3LA 3QCWA 5F3GA 5BNNC 2J1UA 5A3WA 4LXLA 1PK6C 1GOHA 4XCBA 5FZIA 5IW0A 2RMU1 3ON7A 3B5LB 4Q4X3 5DAXA 4C8DA 5HBAA 4E8DA 2IVJA 5L7OB 3NV1A 1QJX3 1UU6A 1JXNA 4W8JA 5HXMA 1LRHA 4OUEA 2A3WA 3DN7A 1AR91 4Y20B 4E2GA 3VKFC 3ZDVA 3UJOA 1GU3A 1O4TA 2ZGOA 2ZGMA 1Q3EA 3AK0A 3KQRA 2EIGA 4S2DA 2A6WA 2CYFA 3OTFA 5K8SA 2QZ3A 2CAVA 5AC91 3GNEA 4PCRA 1LJ7A 2AYHA 3FZ3A 3FJSA 2YROA 4LQRA 3ITQA 3RRDA 3U37A 3U75A 3ZN6B 2WBKA 1EV13 3AYAA 1BEV1 3NNMA 3ZPOA 4GKXA 1U5XA 1RUI3 1ZRRA 2VO5A 3R05A 1QJEA 2JD4A 3GHMA 2XJSA 4FT8A 2W1WA 1G9DA 1F8VA 3LPFA 3JXSA 1UYXA 5KR7A 2CY6A 4R9BA 1F5FA 4AI3A 5LCWL 3MF6A 1CR7A 2AR6A 3EQEA 4Q4Y3 2BVBA 2A3YA 2Y33A 2VZPA 3B01A 1JZ2A 2VQUA 3AB0A 3VBOC 3AJYA 5A33B 1V0AA 1V6IA 1PO13 1UOJA 1RUD2 1XE0A 3GZUC 4UT5A 4X6QB 4HETA 5CKNA 2OXBA 3AC0A 4FP3A 2JICA 4HFSA 4MSVA 3SCGA 3BU0A 1W8UA 1K3IA 1V9U3 2RJKA 2VZUA 4P9JA 5DDJ2 2XWBB 3V56A 4BQWA 2J1EA 1R081 5K0UA 2E7AA 3OF1A 2FCTA 4LHLA 5GZEA 2XB6C 3MW4A 2QQNA 2ZGTA 4DOUA 3DEMA 1S2KA 2XJRA 1NQDA 4I01A 1VRBA 3ASIA 3C7FA 4B7EA 4CU8A 1GNHA 2D3PA 4CCLA 1FOD3 3ILFA 4UFJA 5FWJA 3KT7A 2GH2A 3RZGA 2NPIA 3FUOA 1H8TA 5JMOA 1FPN3 3GCWA 1UYPA 3HQUA 3IBMA 1ZRFA 3UGGA 1RGSA 4M00A 1TEIA 5F39A 3H7YA 4KWLA 3FLRA 3RWKX 3O7OA 4QQHA 3GGLA 4CXXA 4NHLA 1Y3TA 3WNMA 2JWPA 5CZKA 4UAPA 3ZXAC 3HIFA 3AMQA 1N47A 2Y8KA 3AVRA 1LECA 2ZKNA 4M3CF 1N1SA 4Y4YA 2FDIA 1S0JA 1CPNA 4DNYA 4XF0A 2WZR1 1MVQA 4BMEA 1V6JA 2Y60A 5GLVA 4CU6A 4ITCA 2D6MA 2DCJA 4LHNA 5L9BA 2QQIA 1JU4A 3VGIA 3WEZA 2RS52 2VTXJ 3VDDA 5FZ3A 3G6JB 1WLTA 4MGQA 2WFF1 3GBWA 3M2MA 1HJGA 2BEOA 4FOWA 5C4WA 4A3XA 2WN2A 2EAAA 1DCSA 3AKPA 3NL1A 3WG4A 1QJZA 2XH6A 3N3HA 1PVC1 3NO8A 3PMEA 4OI4A 1J1LA 4Q26A 4Y1VA 2BBAA 4W6WA 1RUE2 4AVCA 1HV0A 2C0ZA 4XZPA 2P34A 5L7OA 3I2JA 4GD4A 4JRAA 3KS7A 1Y9MA 4XDOA 5K9YA 3RI8A 1RUH2 2VZTA 3POEA 2RDRA 3PL0A 2EXKA 4XURA 4MO3M 1BCXA 2W3JA 3ABZA 1O91A 4BB3A 1QXJA 4Y20A 4XBNA 5T5LA 4WVVA 3WF1A 2ILMA 4XXPA 1V00A 5GALA 1T2XA 4UYBA 4XJUA 5J98B 2VOTA 5ABJB 2EA7A 1W9SA 2FMYA 3ZN6A 2AGSA 3GM8A 1QOTA 1U12A 3NV4A 1Q8VA 2Y0OA 3WNXA 1ZBA1 4NROA 4ASLA 4CRQA 2PHLA 4META 4A4AA 4Z2WA 1GP5A 1RMU1 2W94A 1EYBA 1QJU1 3MIBA 4Q1RA 3M3IA 3MW3A 5FZHA 3HQXA 4JKMA 3U07A 1Q8OA 1UKRA 3C8XA 4QM8A 3VHPA 5A33A 3KV6A 2WUHA 4KBZA 1PMJX 2W91A 4TLGA 1JS9A 2ATFA 1O4YA 2K46A 5C5UA 4SBVA 3BYWA 4PQ9A 4ES8A 5T50A 4CP1A 4Q8LA 4UFHA 2PTMA 3BTXA 1J59A 3LDKA 1X8EA 2VZ3A 1SLLA 2D6OX 3O1OA 2OVUA 3H1WA 2JJ6A 3VV1A 4I02A 3WQ1A 3POFA 3TN93 4OULA 2EIEA 2Q5TA 5IWFA 2BNNA 2P2KA 4PLMA 2I2SA 3S7IA 3ZSKA 3UK9A 4UFIA 3OGJA 4AZZA 1DYOA 1CVNA 2D5HA 3JB8A 5JVVA 4E4DX 3TEXA 1CX1A 5SV5A 2PN5A 1T6BX 2EICA 5C70A 4N90A 2IWGB 3C2UA 4N9IA 2Q4SA 5JR7B 5L9VA 1ULCA 1JTZX 5F5AA 2OA2A 3RMYA 4P00B 4BU2A 3M3OA 5JXGA 3NNFA 4CEYC 3B9IA 3VBFB 1NX9A 4L9BA 4D94A 4ZHNA 4OI0A 1NLRA 2BP6A 2WSVA 2HWF1 3I3QA 1KEXA 3ZN5A 4AHXA 4XQWA 4ASMB 5FBZA 3RFRA 4CCOA 5FPXA 4QXCA 1JYTA 2ZAHA 2UYAA 3WT3A 2VXRA 3VBHA 3PJYA 4RQPA 4XJ9A 1YYNA 3IMMA 5ANNA 5HI0A 3NMBA 5AVPA 2XLGA 5FLJA 1OD3A 2HWD1 4I3PA 1MZFA 1BBT3 1POV0 2Y64A 3MIDA 1K5MC 3GHNA 4LE3A 1RHI1 2G1MA 3HN3A 1UCXA 4ES9A 1AL22 3VBRA 4EV0A 1UYYA 1NCRB 3KZ4C 2FMDA 1OLMA 1ND3C 2YC4A 4UOJA 3RZLA 3LKJA 1SHWB 5FZMA 3H1MA 3LZZA 4PDWC 2XXZA 3ZYGA 2HYKA 3ETPA 2JIGA 5L9RA 1AYN1 2R0FA 4XDQA 1NYWA 2QQMA 5KHHA 5CEHA 5DDJ3 5E8AA 3POWA 5F5QA 1ENQA 2GC0A 2DU0A 5D8AC 2ZEZA 4Z2AA 5ABJA 2A6VA 1WW4A 2MNGA 3MYXA 4GWNA 3MHZA 4EN6B 5C8CC 4RYDA 2VUJA 4KWJA 4UFKA 5CKQA 3AXEA 1H1MA 2VCAA 1NA1C 4RFT0 2LW8A 3LEGA 2C5DA 1HRV2 2J1AA 1PMHX 1WW7A 3EMRA 2NMNA 1PGW1 1SPPB 3IKWA 1UPIA 3ZFEC 5C8WA 4Y5SA 1D0GA 4IE4A 3ZSEA 3WR0A 1BMV1 4I3GA 2D6LX 5B4XA 2H0BA 4W6XA 4A45A 3UKVA 2OQ7A 2ZGNA 4LR4A 4K1ZA 2A6XA 2DVDA 3H8XA 4NUBA 5A3TA 3KD4A 5LK7B 1W06A 1R1A2 3OY8B 4Y26A 3CBNA 4CUCA 3WNNA 1AR71 2I74A 3ACFA 2QJVA 1RIRA 3JD72 5T5JA 4GA9A 4FP2A 2ETEA 4H55A 5EP9A 4NHYA 1LHWA 1OXCA 3W58A 4D6RA 5DG1A 2O8QA 5CYYA 4DRRA 3UL2A 5LA0A 4ISQA 4G4FA 1SLAA 1W6OB 2Y38A 4JGYB 2XOMA 3CMGA 1F35A 1UMHA 1BK1A 2RS53 3CZJA 1Q8QA 2GP5A 3MICA 4HKWA 3J8F1 4GQ7A 1MACA 1XSRA 4NAOA 4QPWA 3N7MA 2VQ0A 4CDUB 3N4MA 1XSQA 4LBMA 4XQDA 2WNUC 4YW3A 4PBPA 3WF3A 1WD3A 2CWSA 2HKXA 3EB7A 1RUE3 1V6OA 1W6NB 4TSVA 1E5RA 4NRPA 2W2IA 1BXHA 4QXKA 3WXPA 3OGGA 1RUH3 3ZYHA 4HKLA 1I9RA 4KWUA 1GANA 4A42A 3G7DA 1XQNA 2G9ZA 3PU8A 5LEKA 2ZX3A 3CHXA 1DZQA 4QPIC 4MGTA 3CL1A 1H4GA 1PX4A 3E97A 4PLOA 5FK8A 3VBFA 1BKZA 4EROA 5J36A 1Y7BA 2KR2A 2OZJA 2JKXA 2YG0A 3FWEA 4GALA 4CDQB 1CAUB 1X50A 1IG0A 1BVVA 3K51A 4RS5C 5FR3A 4NHMA 5DAVA 5I0TA 5T52A 1Y43B 5FZ7A 1BYHA 2QCSB 3I2FA 3VDAA 3DGTA 5JLVA 3J4UH 2FCVA 4M3CE 1UF2C 4YM1A 3RZZA 3WD5A 1FXZA 3FN9A 2EXIA 5CKMA 5IAXA 2Z4FA 4JDNA 1US3A 2HJIA 4YZ2A 1NCRA 4LE4A 4FPFA 5EJ3A 4F3JA 4HOOA 4XZUG 2BUKA 1JZ3A 4F7ZA 2VGDA 4COUA 3K77A 1XU2A 5FWEA 3WNPA 1UZ0A 1W9FA 3RDIA 1UOFA 5DUXA 4RL7A 3CDZB 1LHNA 3WW2A 5CFCB 2PHFA 3KMHA 3I2DA 2IXCA 4PIZA 4RGAA 3LCPA 2P37A 2E26A 5LRSA 1G8WA 1W28A 4YM3A 2NQYA 5A3NA 5HPOA 3USUB 2V5DA 2VMEA 1SLTA 4IEPA 1ZZBA 3ZOIA 5DN2A 4DXTA 5A6ZA 4TZDA 3SH5A 5F6KA 4YVSA 3MIGA 5JI7A 1OFSA 3SISA 2RR11 4I09A 4ISRA 3B9CA 2ZKLA 3ZO0B 1G86A 3KT1A 1YCIA 4AFMA 1SPPA 5LK5A 3ACLA 3N9QA 3OUHA 3WDYA 1RUNA 5JOZA 3NQHA 1J83A 4P14A 1PNFA 1SBEA 4AGRA 4Q4W3 4N53B 1C8M1 1E5SA 3M8LA 1ALYA 4YLZA 1D4M2 5FYVA 4TYSA 3A22A 2BGPA 3PUHA 4S2FA 3POGA 3AP7A 1JOJA 2VH9A 3BPSA 1OURA 2YC2A 2Y6KA 1AR62 4O7XA 2WAOA 3U1XA 4N9HA 1HQWA 5IK5A 2JE7A 1OFNA 5JZGC 5FXXA 4JGYA 3KV4A 1APNA 2WQ8A 4BZ4A 2LROA 2ZGLA 3J9SA 3K3OA 4CCMA 2ZEWA 4XXAA 5D2AA 4BH9A 3MFCA 1LHVA 2MEV2 3WY6A 1HRI1 1LHUA 1ND2C 1X9PA 3AZXA 4E9KA 1OKQA 4CDUA 2WINB 1ST8A 2DU1A 1PZ8A 1I5PA 2R042 2BBVA 1CWPA 3E5XA 5LASA 1VALA 1GQPA 4FPEA 4Y1ZA 3K75B 4ORFA 1LOFA 1JW6A 3P1IA 1AL23 4YPJA 5DXDA 1OI6A 2C24A 3GCXA 5JXJA 2BV4A 1PGL1 3ZXGA 3MZHA 4E4ZA 3TRSB 5E88A 2WT0A 4IDZA 2VD7A 3W9AA 3RZHA 4I0WB 4FOQA 1I6XA 4ZU5A 4CZSA 4QHBA 3E1F1 1QQP1 1WUVA 4JAAA 3VL8A 2VNRA 4NRMA 1Y4WA 1URXA 2VG9A 2YC0A 1EAH2 3ILNA 1JU3A 3OB8A 5ACA1 4M0NA 3NRUA 1CAUA 5FP3A 1W04A 3HQRA 1UY4A 3IB3A 4IGOA 1FV2A 2O14A 2VZQA 2WNVA 2VTFA 3K4AA 3CQOA 4TWTA 5I0SA 4XJZA 1FT9A 2HWE2 3O1VA 1TQ5A 5H9QA 3D5OA 1XNCA 3PNAA 2GSYA 5FXWA 2B8MA 3LEKA 2DVAA 4WM8B 3VN4A 1W3VA 4AVBA 2VULA 4YARA 1YFXA 3ENRA 3H3ZA 1CN1A 4LITA 2G9FA 4XAAA 1MS3A 1HRV3 4ZS2A 4AFAA 5KC6A 3WDTA 1LENA 1V6NA 4RA0A 1ENRA 1YFWA 4BJ0A 1ASJ1 2VU9A 3VUOA 3PUQA 4CXYA 1POV3 1REFA 2GNMA 4AFDA 2JG9C 3ZXFA 1PZ7A 4EN9B 5DQ0A 3ELNA 2JKBA 4PF5A 4CP2A 2WC2A 5LBFA 4LBOA 2P4EA 3D4KA 4HVRA 3WNOA 2LRPA 3ZYBA 1NXD1 4AI0A 4OLLA 1R1A3 4B8EA 4K6BA 1OF3A 3DYPA 3T0BA 1CIWA 1W8TA 3JD73 1MVEA 3IAPA 1F5JA 2D44A 3LD8A 1OC1A 2WIIB 1N1YA 4O65A 4Q0QA 4K1YA 1QF3A 3USUA 4A7ZA 4YG6A 5FP7A 2C9AA 1O3SA 3IPVB 4PT6A 5BNPB 4AI8A 4LKSA 1PIV1 3VBSB 4R4ZA 5FY4A 3K4ZA 2X05A 1LESA 2WO2A 4S2HA 3PUAA 3H8RA 3CJIB 3DV8A 4DO0A 1PVXA 4GULA 3FBYA 5CFDB 2VNVA 1QMJA 2IXLA 1GUIA 2E9QA 4OHZA 2ZX2A 2WLPA 2OYZA 2EALA 3SEEA 1EUTA 1S2EA 3A0KA 3RWNA 3I59B 3NAPC 4N53A 3Q9OA 4PBOA 4IEZA 1NCQC 2RJ2A 2NZ9A 1UXXX 4M4PA 4XUQA 2UWBA 4UW3A 1GMMA 3T30A 3T2OA 1GKBA 1YHFA 4LBNA 2FDGA 3TYJA 2VMCA 3Q8EA 4D69A 1ZA4A 5JPNB 1YI7A 4UI9L 1GNZA 4BIFA 2VVFA 3N35A 3ZMNA 5E1RA 1RUOA 5E6HA 4OVEA 4O9EA 5C3RA 3R0RA 3BPZA 1IPJA 1O6UA 1UZVA 1M4WA 2WZ8A 4YZ5A 1S1AA 5FDBA 1WW6A 2RV9A 4N43A 3A0NA 2PELA 5F6LB 1VBC1 2DCKA 4ATFA 5ANQA 3HN1A 1FOD2 2CDOA 2R061 1C5HA 3ME2A 1ODMA 3LF7A 3OGVA 4IV3B 4LHKA 2XDVA 4FPHA 3S5QA 3VZKA 3VDCA 3P3NA 4EJRA 2OQ6A 4CP9B 4NAMA 3N9LA 4XTMA 4UBGA 1L7LA 3HNBM 2PAEA 2Y0IA 4DINB 3KCXA 4LBJA 1W8OA 3M3EA 3WOGA 2G4IA 2DWRA 2VW0A 4D7SA 5C3PA 2WA3A 3JCIA 5GLZA 3O1SA 3I54A 1VIWB 1FMD2 3WDWA 2WT2A 5LY1A 2RS32 2G9GA 2VC9A 1YIPA 2KD7A 1RINA 5FRAA 1YQ2A 5C9AA 3BN6A 2B39A 2RM21 4KH9A 5A70A 4YGEA 2VXJA 2FDKA 3WVJA 3AMMA 2WABA 5JSRA 1UMZA 4AHYA 1RVF2 4Q0PA 3CJXA 5HCHA 2WNOA 3I2KA 3LB9A 2YZ4A 5IJRA 5A7PA 1OH3A 1AYM1 4Y1XA 3ZFGB 4Q4X1 5FYUA 4O9GA 3S0MA 1W2UA 4CDXB 2RMU2 2JECA 2Z42A 4TLFA 2IXKA 3CKHA 4CDWB 1NLQA 5TSWA 5A1LA 3PURA 1JYNA 2VUDA 5I8SA 1W3XA 5A3LA 1SLCA 3BB6A 4MYEA 3T1MA 1GR3A 1HXS1 1SFPA 4EZHA 5BNOB 4UXAA 1AR92 2PXJA 5DZFA 1AR63 4IGQA 5A3PA 4QX1A 3RZJA 4MHUA 1XYNA 3IPVA 3WINE 2XJUA 1EUUA 1Q43A 5EWSA 3CZUA 4XIOA 3VBSA 1H2MA 1W0PA 1YI9A 1AX0A 1HB1A 2X5IB 4AI2A 3OEBA 4PI0A 5CADA 5K0UB 3CJIA 2MEV3 4LNVA 5FZDA 2X29A 2R043 2R30A 3AKRA 1LEMA 3TNQA 4URTA 2FDFA 4E2SA 1Z78A 2VZSA 5FPAA 3I59A 1XB9A 4JHZA 2VUAA 3AJZA 2OPWA 3ES1A 5A80A 4NIIA 5LBCA 2YBSA 5CA6A 1PO11 5FLIA 2P5BA 2JB4A 1DF0A 4MGSA 3BTYA 2XR4A 4CSWA 5I0RA 2H0VA 1ZREA 2OPKA 1ULOA 4BE3A 4LMFA 3MIHA 2IFRA 2R071 1J3RA 1R082 1EAH3 4NWWA 3WF2A 5JUVA 5BNPA 4A3ZA 1JUIA 2HWE3 1MZ6A 4LA3A 5J3UA 1VBA1 4JGZC 5A6XA 3UV9A 4U2AA 4GWJA 2W1QA 2HBUA 4IV1C 5FYTA 3MBWA 2D7FA 2P17A 3ACIA 1LU2A 1CZVA 3D8CA 5EPAA 3FFQA 1ZA7A 4IV3A 2NP0A 1IZ3A 5GLTA 4FPYA 5JIAA 2OS2A 5JXHA 5C4WB 2O1QA 2JENA 4AR2A 4CEWB 4CP9A 2YBPA 5E16A 1AVBA 3SEPA 3J7LA 1NE6A 2P3JA 3LQCA 4UW4A 2DDUA 5FYIA 1A78A 3ZSLA 4ASKA 3I49A 4I2OA 3HEIA 2FDHA 1TNRA 2W52A 1SBDA 4QB6A 1VB2A 3T08A 3ZFFC 4ONUA 2PHDA 4AG4A 1CX4A 1FNZA 2D98A 1RUG3 1W8WA 4P9LA 3O1PA 3CEWA 2WZR2 1ZBE2 2WN3A 3GBFA 2VNOA 2QDRA 1WLDA 1QH6A 1VAMA 2D97A 1FNYA 4QHOA 1IS6A 1AJKA 2CDPA 4LO4B 3RSJA 1MQTC 3KHCA 4GKYA 1YIFA 4ATEA 5FZ9A 2WFF2 4QX3A 1RUF1 2BFUS 4V1PA 5L36A 1VRH2 3O1UA 2DBIA 1BK0A 1KITA 1WCUA 3R4SA 4HKOA 4I0AA 1OVSA 4LKFA 4ZU4A 2ZXQA 3UESA 1L3JA 1PVC2 3ZFGA 2DVGA 3O0WA 2CL2A 1DFQA 3P6BA 4CDXA 1BBT2 4CDWA 2PAMA 3WHTA 3JQXA 1Y9GA 3NJYA 1OA2A 4G9SB 3PUSA 4MX3A 4WM7B 4AGVA 1DDLA 5BNOA 2CNAA 4WZFA 4XETA 5FZKA 1XXNA 2YFZA 1O3QA 3ATGA 1D2QA 1O8SA 3BIEA 1WCKA 2OUJA 2RS11 3AL6A 2Q8DA 2VAUA 5F1RA 4QX2A 2F4PA 3BVCA 2JG8B 5F5IA 3U78A 1QKQA 3C7GA 1YLLA 2ID4A 4FOYA 2X5IA 4YZ3A 2YV8A 2RVAA 3OSDA 3LGRA 1IPKA 4GAZA 3T2QA 3O1TA 2YDEA 4FPJA 3AYDA 3LFMA 5DPNA 1ZZ7A 2YXSA 4K8FA 1SLBA 5DUWA 3WHUA 4FAGA 1HDKA 1ZRCA 1AR82 2ZGRA 4OHWA 3H50A 1RMU2 2VPVA 5IVFA 3SITA 3RJ2X 3O1RA 2UWAA 4NIAA 3E6DA 3UT0A 1LU1A 2BW8A 1TMF2 1WMEA 1SG3A 4W65A 4AI9A 3AP6A 2B45X 4FVVA 3IWZA 1M06G 1ODNA 2CV6A 4B4QA 4HSJA 4HMZA 3B02A 1YEWA 1PMIA 4XAEA 1OPOA 1LOAA 2ZMLA 1FMD3 3MFAA 2RS33 3KWVA 4XABA 2FDJA 3GJAA 2RDNA 2JXAA 3TN91 1DGRA 2Q1ZB 4OQ9A 1XU1A 4NIDA 5C7GA 4BXFA 1CJPA 1VBE1 3OOXA 4GZ9A 2IZWA 2PHUA 3T3YA 1RVF3 2WWUA 2A5ZA 4RGKA 1QXRA 1GV9A 4YW2A 1BJQA 3NWKA 3GJBA 3VBHB 2VMHA 1H1IA 4IEOA 4RQPB 5APAA 4CEWA 3I2OA 5G04L 3OCPA 4B4RA 5FY7A 3SCFA 3LOBA 3DUIA 2E7QA 2RMU3 4DMIA 2QE3A 4EYUA 4CCNA 2NYYA 1UY1A 1SEFA 4XPVA 1JI6A 3VBRB 4MLOA 1DBNA 4BK5A 1JH5A 3ZN4A 5E89A 5I8YA 4Y1UA 4BQ2A 1AR93 2IC1A 3HBZA 5CIRA 5IVCA 4K9SA 3AP5A 1IGOA 1YRZA 3BIWE 2P6CA 1RUJ1 1H6XA 1HW5A 2IXHA 3USSA 3KCYA 3UJQA 2HWF2 4RFRB 1CAXB 1COV1 3VDBA 3CNAA 5FJKA 3IDAA 4AF9A 4AVTA 1BEV3 1XPWA 3TAYA 1V70A 1NQJA 2VVDA 3O12A 1X33A 1ULGA 1VPHA 1OPMA 1YC61 1MZEA 2WQZC 5FMOL 2ZTNA 4QPGB 4JV4A 4BYYA 4RR3C 5FAXA 5CG9A 4WM7A 5FKCA 2H6BA 1ENSA 1C1LA 3LSEA 5GZCA 2YPDA 3EBRA 1RUD1 4BQ3A 1IQAA 5DAPA 2OKXA 4L11A 2JG8A 1Q5OA 2V4VA 1AYN2 2QVSB 2YGLA 3EJKA 3I3DA 5FXVA 1ZNPA 4CU7A 1R083 2QQUA 3DECA 3HAGA 1HX6A 5A7WB 1A3KA 2ZOEB 1U5ZA 3OYWB 1DP0A 5FPLA 4LUMA 2PQQA 4COVA 5T5PA 5FZGA
chains in the Genus database with same CATH topology
2MHFA 3AMPA 4FPKA 3PVNA 1BMV2 1GQHA 3WQ0A 2ZHNA 2W39A 4FAHA 2Z79A 4Q4W2 1H8TC 2Q0AA 3MW2A 2VMIA 2DUPA 2XWJB 3QACA 1F2NA 2E51A 2EVXA 2PLV1 2C1FA 1AR72 3WCRA 4HVOA 3THTA 3AZWA 2A71A 5KXCA 1C8NA 4COZA 1HLCA 4QD2A 2WZR3 3WUCA 1ZBE3 2DFCA 1AZDA 2GMMA 4Z07A 1UIJA 2RS51 1WCSA 4AVSA 1RL3A 2XUMA 2D93A 3J8F2 4YNIA 5GLWA 2XPJA 2WFF3 2YHJA 1VRH3 2HWC2 3IIAA 1XRUA 1ZZ6A 2TUNA 1KXGA 4AQ6A 1CJDA 1KDMA 1DQ1A 2ZGSA 1PVC3 3IDCB 3MDPA 3VDDC 2GN3A 2QFEA 4YVWC 4JC1A 3VHRA 1ZM1A 4WVZA 1R091 1IS4A 2MPFA 3MPBA 3BOPA 4RS5A 3JBG1 5T55A 1EPWA 3B69A 5L7OC 4B29A 2Q8OA 4AFCA 3ST7A 4LA2A 5KXBA 3OPZA 4HSLA 4NVPA 1BQPA 1W6QB 2PYTA 1CAXA 3RYKA 4M01A 3L9JT 3NKTA 2XL7A 2DVBA 1VBD1 4LBKA 2R6QA 4FPCA 1RC6A 4YGBA 1AR83 4QPGA 1MEC2 4YVSB 3VBUC 4AEDB 4AW7A 5L19A 1RMU3 1TNFA 2VOXA 2WS91 4AQ2A 1TMF3 1H4HA 1ENXA 2UWCA 4D3WA 1UKGA 3PVOA 1WMDA 4MXWB 1H2KA 1C28A 2XHKA 3VKLA 2E63A 1SDWA 3MIEA 3HT1A 3NVCA 1REDA 3OYWA 5A32B 2XGXA 3DPRB 4MVTA 3E5UA 3INAA 1GLHA 3FFZA 3NAPB 2R1DA 4Y5Z0 5JPMB 2D3RA 4J1WA 1IKPA 1QNWA 1LGNA 4BIOA 5JOXA 1PO21 3EO6A 3VZNA 1RUC1 1GZWA 1C8M2 5BV6A 3BTAA 5JZGA 4LUKA 3TNPB 1OSGA 4XFHA 1OA3A 1VBB1 1IS3A 4XILA 5F9TA 4IEVA 1DQ6A 2HWF3 5J09A 3ZXLA 1E57A 4WBBA 3VZOA 2WNVB 3FLTA 4AHWA 1O5UA 4BHPA 2HWD3 4K7JA 1QH7A 2ZABA 1AL21 1RHI3 3I8TA 2XLFA 4QT6A 3N36A 4BMBA 4AYUA 3FE5A 1A8DA 3MLJA 1ZYBA 4GH4B 5EYXA 3WG2A 4Q4V2 4HL0A 2PHTA 1B09A 5H9RA 1I3HA 1CGPA 1S2BA 1YJLA 5ACA2 1AYN3 1W6QA 4IESA 2ZGPA 1F9KA 2DFBA 1FYUA 2ZGKA 2IXJA 2GZWA 3THPA 1QJY1 2AUYA 3ALQA 2JG9A 3ZYJB 4CTEA 1ZX5A 5ABJC 1MR5A 1AXKA 2EXJA 4AEDA 2GNTA 2H6CA 5T3NA 5BYNA 3AMHA 4HPKB 1OQDA 1SBFA 4XBQA 4P9WA 1JHNA 1DYKA 4XIKA 1H30A 3NV2A 1R1A1 4I0BA 4MXWA 2XVLA 1Z7S1 4EWAA 1G6NA 1AR73 4HN1A 1XYOA 4H7LA 5CBLA 4LO8A 4IEQA 1KQRA 3AKSA 5A32A 1G9CA 1B35B 1UD1A 1N1TA 5CNAA 1JYIA 1IOAA 3DPRA 4Z92B 3UKTA 4UW5A 4Z82A 1LOGA 1PIV2 4OHVA 1Z0HA 4E27A 3NAPA 3J8F3 1OQEA 3ZYRA 5FCCA 2XVGA 3VZJA 3E6CC 2OZ6A 2HWC3 4YW1A 4GB31 2OUHA 1S0CA 5JIUA 1WLWA 4RHV1 3PHMA 4N43B 4H14A 4QX5A 5JAXA 2D40A 4M0HA 1HKDA 1DGLA 2ET1A 3LSDA 4FPLA 1OOPB 2GC1A 1X36A 4ZU7A 1UL9A 3S30A 1YWKA 5KXEA 1CAVB 4LBQD 2IXIA 2ZMKA 4YG0A 2NM1A 2VW1A 4IXLA 2GC2A 2Z2SB 2IFWA 5BPXA 5CG8A 1TE1B 3A4UA 1WMFA 1YO8A 4YG3A 5C9AB 3SCHA 1FAYA 1ZZ8A 3SMHA 1AF9A 1VBC2 3L2HA 5BNNB 4IQPA 1PK6B 2R062 5J37A 1KFUL 5JI9A 1MEC3 4INDA 3CU7A 4GH4A 4PIXA 2HEVF 1UN1A 2DCYA 1S0GA 2D5FA 1NCRC 4BWOA 3NSTA 3CF6E 4QQOA 2XG3A 4H3WA 1RJ8A 4L2NA 1RUG2 5FFOC 2LTNA 3TBDA 2B46X 2RM22 1MS1A 4KG8A 4AI1A 4P5HA 2ZHKA 5IT6A 1Q8SA 4FPOB 3WX5A 4FSJA 1MS8A 2B42B 4KU7A 4HPKA 3FC0A 1AYM2 2V09A 4WVWA 2R1BA 5GJ6A 4ZXKA 3BCWA 2PHXA 4JDMA 3VBOB 4OHYA 1C8M3 1D4M1 4EWEA 3KGZA 4YFZA 1HXS2 2VOKA 1VJ2A 4GMP0 4LULA 3ROUA 2YY1A 4IEWA 3O14A 1LR5A 1B35A 2ARBA 2DF7A 2EXHA 4OZXA 1NY71 4JQRA 1T6GC 5FTTC 1SFNA 3S7EA 1HQLA 2CWMA 4DRVA 4JGYC 4NPRA 3MIFA 4IETA 3VLBB 1H2LA 1AL0G 3BOWA 4YSFA 4LTAA 2BWCA 2D43A 2ES3A 3R4UA 3S6PA 2HWB1 4CDUC 1JBCA 2XBO2 5BXXA 1D0HA 2KM2A 2WQ4A 2VOVA 4YFWA 4Q4V3 2XKPA 5IUQA 1LOFC 1OOPA 5CAZA 2UU8A 5JMCA 2DV9A 1CAVA 4LBQB 4C91A 3SHRA 3ZYIB 3WDUA 1R1ZA 4NN0A 5ACA3 4DFSA 2QDNA 3RQ0A 4B4PA 4DZGA 2HWE1 1C3HA 1CQ9A 2LALA 4OHXA 1VBA2 2KA3A 4XF9A 4CDQC 3SNMA 1FX5A 1UX6A 4F8AA 5BNNA 2UY8A 1PK6A 1LODA 1AXZA 4IERA 5J48A 1TME1 3AYCA 3B3QE 1LGCA 4KQ7A 4AEKA 5J7MA 1FV3A 2A75A 2DYCA 2ZZQA 4DB5A 3VHOA 2R0HA 1SACA 3AZZA 1WBLA 1QJX1 2BQPA 1OQ1A 3O0VA 3VL9A 5JCTA 5EV7A 1SCSA 1I5ZA 2X53S 1H2NA 4A2UA 3QLQA 1G9AA 3ETQA 1U0AA 1W6PB 5GZGA 3TWIA 3ILRA 1KS4A 3VZMA 5CFCC 1AXYA 5FOBB 1DQ2A 1DYPA 2CAUA 4KGGA 3TOJA 3LAGA 1PIV3 4KWKA 1KJLA 2SBAA 2BYVE 5AC92 4QGMA 4AVAA 1UAIA 2GU9A 2DCZA 1GYKA 1EV11 2A7AA 4OI1A 3WP5A 3LWCA 1XNBA 1RUI1 1BEV2 4N7UA 1PHMA 3H9AA 1ZZCA 5A3MA 1J3QA 3VBOA 1OLQA 4XW3A 4Q29A 5GZFA 4D7YA 4Q4Y1 4L8QA 4W6YA 1LGBA 3LA3A 2VY0A 4N53C 5T5OA 1NG0A 4JRLA 5KHJA 1QDOA 3WP3A 1V9U1 2FZ1A 4HN0A 2YUEA 2PA7A 5KHKA 1LOEA 4B3NA 4JVAA 4X6RB 2A6ZA 5KHGA 2WNEA 3WW4A 3AX4A 4J6GA 2AZ5A 2CGOA 3MF9A 5J96B 1FOD1 1VBC3 4Y24A 1KRIA 2B5HA 2R063 3VHNA 1XE8A 1FPN1 1NE4A 2GN7A 3EHKA 1KDKA 4BLIA 4EN8B 1YXWA 4NHKA 2R16A 3AP9A 2VECA 4XFIA 2A6YA 4LBQA 4C1WA 4WVMA 2AENA 4CEYB 2RJLA 5K7PA 1SMVA 2Y26A 1DU3D 1GZ9A 2JEMA 4N7IA 4AGGA 4GWMA 4QPYA 2ZX1A 2RM23 3O5SA 1VBE2 1XNDA 2ZHMA 2QKDA 4YVWB 3B94A 3QH7A 1K5MB 2D6KA 3AFKA 1LOBA 1DG6A 1UZYA 1VAKA 2JX9A 2LUWA 3AKTA 4BPZA 1AJOA 5JWPA 2ZHLA 2VVEA 2DUOA 1ND3B 2OIIA 4NO4A 4WM8C 1AYM3 1PNGA 3ZXJA 1YNAA 4XQ4A 3AKQA 4PDWB 4X8NA 4A7KA 3ECQA 3WG3A 1J3PA 1YFUA 2ARXA 4HT1T 2LM3A 5EXOA 1HXS3 2O0OA 1W6PA 4XF1A 4XF4A 1X8MA 5D8AB 4Q0UA 3JB4C 2ZJCA 1RUJ2 3VKNA 3DKWA 3DF0A 1YFYA 5C8CB 1COV2 1DZRA 4MGZE 4AQTA 1HQNA 1NA1B 1QY4A 3VBUB 1ONAA 4RR3A 1SLIA 2DTWA 2HEWF 4MUVA 3GALA 3ZFEB 4GIQA 4B7KA 5BNPC 3VBSC 1LEDA 2JDZA 3T1LA 2I45A 1QDCA 1CONA 1ZBA2 3POYA 3SH4A 3CJIC 2WL1A 5DZGA 1NZCA 2Z5WA 3NJZA 3OBRA 3ZVXA 5CFDC 1CPMA 2XBO3 1QJU2 3BU7A 3IDEA 1LOCA 4XFCA 5HXVA 1H0BA 4H7MA 3WZ1A 4GMP3 2R073 1RITA 1JYCA 1VR3A 3D0JA 3ZYPA 1CAWB 4FQ4A 2WT1A 1WGPA 4XJ8A 1RB8G 1VBA3 2WNUB 4NOTA 1RJ7A 3K48A 1OLRA 1YJKA 4Q1PA 4UBHA 4FTSA 4D7TA 5LRRA 1S0IA 3IM0A 2ZAAA 5HCBA 4CYDA 5EZWA 5I8TA 4FTBA 1NLSA 1OHFA 4Y1YA 2Z69A 3AFGA 4IV3C 3U4XA 2W68A 3FUQA 1XE7A 4QPIB 4QGLA 1N3PA 2PLV2 2D6PA 4XTPA 4CEYA 1GZCA 4YZ4A 1MS0A 3WUDA 1ZZ9A 4A7YA 2PAKA 1H8VA 1ZBE1 4RS5B 4XJWA 3QD6A 4HVQA 2WKKA 1W0OA 3V65A 3VKMA 4XFAA 1WLCA 4Q2FA 3FLPA 4YVWA 1K5MA 1VRH1 4QQPA 1GICA 1X82A 1RUF3 4XFBA 4HK9A 5AC93 1I1EA 3RMXA 4Q0SA 3WQ7A 2PHWA 1ND3A 1BBT1 2HEYF 2HWD2 4M3CB 2YPJA 1RHI2 3X29B 4PDWA 1R092 1QOOA 4AVVA 1HIXA 5SV8A 1C1FA 3ZFGC 1JN2P 4HBNA 4CDXC 4C1XA 1WW5A 3JBG2 3M1HA 1V6MA 4CDWC 4YW4A 2DVFA 5D8AA 2NLRA 2RS13 2RHPA 3ZSJA 2B9UA 3PJQA 1J1TA 2WA4A 1QHDA 5BNOC 5C8CA 4FTEA 1G9FA 4YM0A 2I07B 5DDJ1 2E53A 1MS5A 5BUVA 3LA2A 1NA1A 1W6MB 3VBUA 2ZZJA 2GNBA 4JCKA 1H9WA 2OW4A 4XJAA 2ZPXA 2EF6A 4XYXA 1DHKB 4R8HA 4XHXA 2XJTA 3ZFEA 1VBD2 2X5IC 3MGUA 1WCDJ 3M7AA 1AR81 3IN9A 5K0UC 2QUOA 5D1IA 3V0BB 5JOWA 1ULDA 2Q1MA 4L97A 1TMF1 2WS92 2YGMA 1PGW2 1N3QA 1YUDA 3KLSA 1DIWA 2UY9A 3RS6A 2BFUL 3HWJA 5EFUA 2ET7A 2K2SA 3AP4A 3H1YA 4XF3A 4MGIE 5GZDA 3ZX7A 3ES4A 3D82A 3KCCA 3WDXA 1GZWB 5GM0A 3FMGA 4P9GA 5JZGB 5GKAC 4DPNA 1D4VB 2GMEA 2FHRA 5KXDA 4YM2A 1NOVA 1CAWA 5FQ0B 3JU9A 3V64A 1ND2B 5DUVA 3ZIXA 2ZACA 2WNUA 1VBE3 5KC5A 5IK8A 3OD4A 4L99A 3RNSA 3H3UA 3JUUA 2GAUA 3URFA 4L92A 4R9DA 5I0UA 4C0HA 3PVEA 4COWA 3N7JA 1PO22 1RUC2 1RUE1 1IS5A 2GDFA 3AZYA 3L2YA 4QPIA 3M4FA 1S0EA 1REEA 4QQ2A 5C4WC 4CEWC 1O3RA 1RUH1 4YZ1A 3SXWA 4QM9A 1VBB2 2AH2A 1C57A 4AFBA 1RUJ3 4KNCA 3BALA 3U10A 1COV3 3KGLA 1QXPA 4CP0A 3OBTA 3EXUA 3UKNA 1NXMA 5H9SA 2BTVC 1ZVFA 3M3CA 5FO9B 2YMZA 5FREA 4LO5B 4R4XA 2VMGA 3WW1A 4BQ1A 1DLLA 4M3CA 2B7YA 1ZBA3 2JG9B 1PM7A 3LOIA 4YGDA 1O5LA 3VKOA 1VB4A 3WLUA 1DGRN 1QJU3 3GBGA 1RUD3 1LULA 5CU1A 4DS0A 5AFEA 2D6NA 4WM7C 3CLPA 3TB0A 4BLJA 4NR1A 3NV3A 5DZEA 4WZCA 3LA7A 3RG0A 4KGQA 1S0BA 3E6BA 3WDVA 1W6MA 2ZA9A 2SLIA 4MXVA 5DG2A 5C33A 1QJY2 2JG8C 2JE9A 2ZX4A 1MS9A 2ZGQA 4FXKB 3APBA 4FOVA 3V0BA 4FBFA 2RR12 1U5YA 3P3PA 1NCQB 2A3XA 3JZVA 3KB5A 3GF6A 4MGYE 2TNFA 4LT5A 4Q4W1 1VP6A 5JOYA 1Z7S2 2PLV3 3CO2A 4P9IA 2ZBJA 1A8MA 2W0XA 4LO6B 4Q27A 2VW2A 2N7GA 5FQ0A 1ND2A 4PJYA 4DXZA 1HV1A 4AWDA 5L73A 3M3QA 2PHRA 1MZ5A 2HWC1 4KL1A 3MEPA 1UW8A 4IEYA 1HRI2 4GB32 1QOSA 3W59A 1S0DA 3N7LA 4RHV2 4XMIA 2GMPA 3WP4A 1R093 1QGLA 4JDOA 2XJPA 1W39A 3PLQA 4HZFA 4RQPC 5GLUA 3VBHC 3ZDSA 1PGL2 1ZRDA 3D0SA 3JBG3 2E7TA 3VBRC 1QQP2 2GNDA 1A6CA 3R4DB 1AX1A 2R49A 1BZWA 3C3VA 1EY2A 3KM5A 4FXGB 3U11A 3MLKA 4EN0A 4GXLA 1VBD3 4S2GA 1MEC1 2UURA 4YW5A 1HRV1 1OMIA 4QGNA 3O0XA 4BA6A 2WS93 2R32A 1SQ4A 2WLQA 1ASJ2 1POV1 1FATA 3RJRA 4QPGC 4XHBA 2A70A 3GZTB 3WP6A 5FO8B 3SH3A 2CGNA 4LO7A 3JD71 3T2TA 3QOPA 1Q56A 1H1AA 4UW6A 2VNGA