1V6NA

Peanut lectin with 9mer peptide (pviwssatg)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6nA00
1QKQA 2GN3A 3M3OA 1Z78A 3ZSKA 4F83A 2CY6A 1A8DA 2G4IA 3WDYA 3AP4A 1W0OA 1G9BA 2A3WA 2A70A 2DUQA 1LGNA 3OY8B 1QF3A 1WBFA 2D3PA 1VALA 2WT1A 2JE9A 3B01A 3TAYA 3SH4A 2VW0A 4NOTA 1ULEA 4XHBA 2D6MA 1QMJA 3AJZA 1QU0A 3N3HA 1JW6A 3RSJA 1G86A 1R1ZA 2OW4A 3NV3A 4AGRA 2W08A 3DUIA 4WVWA 3KQRA 2ARXA 2EXKA 4TYSA 5H9RA 1FYUA 1CVNA 1GNZA 1RIRA 3V65A 5E89A 4XJUA 2A6ZA 1JUIA 1ENRA 1OQ1A 2NM1A 2VU9A 4K21A 4YGBA 4Y1YA 3SNMA 4AVSA 1LJ7A 5IK5A 1ULFA 1QOTA 4BM8A 2WJSA 2NMOA 3JUUA 1LOGA 4FPJA 4JC1A 5HCAA 1WCSA 2E53A 2A3XA 1MZ6A 1VAMA 3NV2A 3RMXA 2R0HA 3BTAA 1XQNA 4XOGA 2D7FA 1KDKA 3QLQA 2P3JA 3B69A 4FPGA 4K1YA 2D6KA 2PHRA 1W6OB 4LBQA 2YXSA 4Y20B 1QDCA 3GALA 1ENSA 1B09A 2ZGQA 1DQ6A 1YI7A 3R4UA 4D69A 2ZGOA 1SLIA 4LBKA 4M00A 4WZFA 1G9AA 1U0AA 2WLQA 1FNZA 2V5YA 3BOPA 3OGGA 4Y22A 5T52A 1W0PA 4Y26A 4Z8BA 3O0XA 5GZGA 2WT2A 4Y1VA 1G8WA 4YGCA 4K20A 5GZEA 1AJKA 4FP2A 2DTYA 4FOVA 4XJZA 1UX6A 1GV9A 1S0DA 3WOGA 2AUYA 1WUVA 3MEPA 1SBEA 2NYYA 2D3RA 5DUUA 1IS3A 4ZKTB 2UU8A 5H9PA 3WDVA 1QOSA 4GKYA 5CA6A 1UZZA 2R16A 2D6PA 3SLIA 1LOFA 2RHPA 3A4UA 4Y20A 4YG6A 1W6NB 1W6QA 1WD4A 4P9WA 1MS4A 3ENRA 4PBPA 4YGEA 1C57A 4K1ZA 4YW2A 2VH9A 5DXDA 3PMEA 3TB0A 3ILFA 3WDUA 2UWBA 3FFZA 3ASIA 4SLIA 5BYNA 3AYCA 4LBLA 1N3PA 1SLLA 1GKBA 1A3KA 4HANA 1CONA 1LU1A 1GNHA 3AP6A 3IPVA 3MW4A 5GLTA 2ZGRA 1LU2A 1N3QA 3C2UA 3SISA 2A6VA 3AK0A 1DYKA 3WCRA 5H9QA 1LHVA 2C5DA 2CL2A 3AZXA 1KJLA 4R9CA 2WNEA 3KM5A 4XBNA 1WD3A 3N7MA 5CAZA 2AGSA 1AXZA 4LBNA 1J1TA 4U2AA 1SACA 5T5PA 1OKQA 1QDOA 4M3CE 2ZHKA 1HKDA 1KITA 1KRIA 4FOYA 3PJQA 3SH3A 2DVBA 1GICA 4XDQA 2A71A 1UL9A 2W52A 3USUB 3VKMA 3WNXA 4AWDA 1H30A 4YW5A 1BQPA 1DBNA 3IKWA 5JOYA 1IS6A 5JOWA 3M3EA 4PF5A 1I1EA 2GNDA 3BODA 2ZZJA 2XG3A 4FPLA 3H0OA 5DZEA 2NP0A 1KDMA 2AYHA 2ZGSA 1GZWA 1WLWA 3V64A 3INAA 2TEPA 4IQPA 4LBOA 1MS3A 1YRZA 1LHWA 2DU1A 3N7JA 2JD4A 3VKNA 5KXBA 3VV1A 1LOBA 4GA9A 4YFZA 1HLCA 1C4RA 1S0JA 1CN1A 1DYPA 1MR5A 1V00A 2DUOA 4ISQA 1LHOA 1KQRA 3O0VA 3WG1A 3SH5A 3GNEA 1FNYA 5JDBA 1JOJA 2UURA 3OBTA 4FPCA 1DZQA 4PCRA 2I2SA 5EXOA 5HCFA 4BQ1A 1EPWA 1VLNA 1W6MB 2NMNA 1KJRA 5FRAA 3ZYRA 3WCSA 1Q56A 2ZKNA 5FREA 2ZGMA 3AZYA 2AR6A 1AXKA 4Q8KA 4DPNA 1GBGA 4Q2FA 4C1XA 3NV1A 4YZ2A 2DWRA 2YV8A 2PHFA 1DLLA 1YXWA 2DTWA 1LULA 2ZA9A 3MW2A 4PBOA 1S0BA 3M2MA 1PZ7A 4XHXA 1G7YA 1NXD1 4GXLA 1BJQA 4JRAA 4XMIA 3WUCA 5IK8A 1IKPA 3OY8A 1QNYA 3LSEA 3NV4A 1APNA 1DQ4A 1SLBA 3B00A 5DG2A 1V6KA 3AJYA 3ATGA 1LOEA 3WG2A 1F5FA 1URXA 2FHRA 3AXEA 4W65A 1LHNA 2ERFA 4Q8LA 5H9SA 3ZSMA 4GALA 4XBQA 2ZMLA 2E7TA 1I3HA 4ITCA 2P2KA 4Y24A 4OZXA 1H9PA 1CJPA 4YZ5A 1QOOA 4KBBA 3D4KA 4P9XA 1MZ5A 3WHTA 2D6NA 1YYNA 1S0FA 1N1TA 2UWCA 1BXHA 2ZGKA 1UPSA 4AGVA 5F9TA 2AENA 5GZDA 2ZAAA 2ZHMA 1FV2A 2JJ6A 3ZXKA 2PHUA 1UMZA 1S0EA 3POSA 4YW3A 3N36A 3WUDA 3AP9A 4GWMA 2YROA 3WDWA 4ISRA 3V0AB 4FQZA 2DV9A 2GMEA 2DVAA 2R49A 3MW3A 4R9BA 2D3SA 4XILA 4NO4A 1W6OA 1IOAA 4FPYA 1CPMA 4FOQA 1Q8VA 2ES3A 4Q1RA 2R0FA 3T2TA 5CBLA 1LECA 2D44A 4M3CB 5GLUA 4YG0A 5GM0A 4AVTA 2YZ4A 4U36A 3L2YA 3R05A 5GZFA 2W68A 1SCRA 1SCSA 4Y1ZA 2E7QA 2DU0A 2OUJA 4YM2A 3D6EA 5JOXA 4XMAA 3WLUA 1AX0A 2EXIA 4DFSA 1WW6A 3RRDA 4AGGA 3LCPA 5DUWA 4YM1A 2R1BA 2YMZA 5LK5A 4UW5A 1H9WA 2Z42A 4DS0A 3LSDA 4YM3A 3AX4A 2CNAA 3UK9A 1W6NA 4GWNA 3AYEA 1S0GA 1CR7A 4M3CA 3MPPG 2V73A 1MS1A 1JBCA 2ZMKA 4XIOA 3AZZA 1SLCA 1AVBA 1N3OA 2ARBA 2LALA 4Q27A 3ZXLA 1SBDA 2A3YA 1WW7A 5T55A 3HN1A 3QCWA 1SLTA 2R1DA 1HDKA 4XJ8A 2D43A 2VUAA 1W6PB 1LCLA 5CNAA 2UWAA 4XJAA 1CPNA 4M01A 5KXEA 1IKQA 3AYAA 4GKXA 1FAYA 2JECA 4Y1UA 5HCBA 3WG4A 4FVVA 1GSLA 5EYXA 1PZ8A 4XYXA 1FX5A 2OVUA 1LOFC 5EYYA 2A6WA 3WDXA 4XTMA 1IS5A 1WLCA 3FLTA 3M1HA 5DG1A 5JMCA 2ZGTA 4P9YA 1VIWB 1D2SA 4YG3A 3Q9OA 4I30A 1RINA 3NWKA 2DYCA 4FPFA 2YY1A 1W6PA 1DGLA 2VW1A 3A0KA 4P14A 2ZGLA 3USUA 4BLIA 3FLRA 5JLVA 3W58A 1DQ2A 1GANA 1PZ9A 2HYKA 3ZSJA 3N7KA 4ATFA 1GLHA 3FUOA 2Q5TA 2GNTA 3D5OA 3RQ0A 1MS5A 4XBLA 3VUOA 4YGDA 2NN8A 4XE9A 3WV6A 3APBA 2A6YA 4XIKA 3FUQA 4UW4A 3VKLA 4LBJA 2OUHA 4YLZA 4DRVA 4ASMB 1LGBA 1S1AA 2PHWA 3OBRA 4YW1A 4BPZA 1JXNA 2DVFA 5E88A 3UL2A 1OFSA 2VXRA 2DVGA 1O4ZA 4BOWA 1A78A 4YZ1A 3AYDA 1X50A 1DHKB 1RITA 5T5JA 1S0IA 2E51A 2ZMNA 1V6OA 4MYEA 5KXDA 5IK7A 4L8QA 5CB7A 1Q8SA 2EXJA 2ZHLA 3AFKA 4LBMA 3T1LA 1HQWA 5GJ6A 3WG3A 3WDTA 2WSVA 4UW3A 2A6XA 1Y7BA 1C1FA 1N47A 1AJOA 1MS0A 3U4XA 2DVDA 3A0NA 2DURA 1V6NA 2C9AA 1AX1A 2H0BA 1ULCA 1AXYA 1W6MA 2CWSA 4LBQB 2E6VA 5KXCA 1FV3A 1DIWA 2ZHNA 5AVAA 1V6LA 2A75A 1VAVA 1MVEA 4R9AA 5F5QA 4ZXKA 2A5ZA 3PVEA 3IM0A 3O12A 2P3IA 1GZCA 4Y22B 1G9DA 2P3KA 4YM0A 5DZFA 1JYIA 4XXAA 2GN7A 3B9CA 4Q26A 3I8TA 1Q8PA 1Q8OA 3M3CA 2PHXA 3AZWA 3OYWB 5DZGA 3ZXFA 3ZPYA 4CZSA 3PVNA 5GALA 3OPZA 1LOAA 1LODA 3AXDA 1CESA 3JU9A 1DQ5A 1C1LA 2WT0A 1AZDA 4XJWA 1LEDA 3VKFC 1UN1A 4WV8A 4YFWA 2P34A 1W6QB 3FBYA 2SBAA 5IT6A 2GNMA 3ZSLA 1IS4A 3BIWE 2AREA 2ZBJA 4FPHA 3SITA 1FATA 1GYKA 1HQLA 1N1VA 4FQ4A 1CIWA 4XJ9A 3HMYA 1YIFA 1QGLA 3N35A 3IN9A 1LHUA 1UAIA 2NZ9A 1SLAA 4CRQA 1G9CA 2CYFA 3WZ1A 1LENA 4YW4A 3IPVB 1BZWA 4DRRA 2D6LX 5GLZA 2EXHA 2GALA 3OYWA 1QNWA 3ILNA 1JN2P 2B7YA 3ZXJA 1S0CA 3HR9A 5JVVA 4XZPA 3T1MA 5SV8A 4YZ3A 3V0AA 3ILRA 2JE7A 1N1SA 1YO8A 1GZ9A 1V6IA 4BMBA 3ZVXA 3M3QA 2W39A 5DUVA 2JDZA 4HL0A 4XXPA 3UJQA 1ENQA 4FPOB 5GLWA 3ZYPA 1LEMA 3I4IA 1ZM1A 4RA0A 2KM2A 1JYCA 4LBQD 2AH2A 2EAKA 3ZXEA 5GLVA 5E8AA 2GNBA 1F9KA 4FPEA 3RG0A 4ATEA 2GDFA 4FP3A 5T5OA 3V0BB 3AP7A 2D6OX 1F31A 5L73A 3RS6A 1DFQA 1NLSA 1WLDA 4CTEA 1UZYA 3O5SA 4M3CF 5T54A 4FOWA 1UKGA 2BQPA 1MVQA 4TZDA 3VKOA 4DQAA 4FPKA 1ULGA 3R4SA 1O4YA 1LGCA 1WW4A 4AYUA 3UJOA 4JCKA 2ZABA 1AF9A 4C1WA 2PHTA 2ENRA 2EF6A 3AP5A 1GZWB 2VY0A 4AVVA 1TEIA 1G9FA 2ZGNA 5IUQA 2SLIA 1BKZA 5EWSA 2JKBA 1JHNA 3PVOA 3B3QE 1AX2A 2EALA 3AZVA 3N7LA 1V6JA 2VW2A 1WBLA 5IK4A 3POYA 2WSUA 1ONAA 4PQ9A 4XTPA 4WVVA 3V0BA 2WQZC 1Z0HA 3POWA 2ZGPA 1N1YA 4UW6A 3W59A 1SFYA 1BYHA 4BMEA 3DGTA 1Q8QA 1LESA 1MS8A 1WW5A 2GMMA 2PELA 1LOCA 5T5LA 5T50A 1CQ9A 2GMPA 3CNAA 4RL7A 4Y1XA 2DUPA 2FMDA 3WVJA 5JOZA 5GZCA 3IMNA 2CWMA 1MACA 1V6MA 2XB6C 2LTNA 1DQ1A 1ULDA 3O0WA 1SBFA 4R9DA 2ZACA 1LTEA 2CTVA 2WKKA 3OJBA 4H55A 5DUXA 4Q1PA 4YZ4A 3WHUA 1MS9A 2ZGUA 4BLJA 1D0HA 2EIGA 3FLPA 2A7AA 1DQ0A 2P37A 3RMYA 1ZA4A
chains in the Genus database with same CATH superfamily
2UY9A 2GN3A 2PMWB 3M3OA 1Z78A 3ZSKA 3AMMA 2CY6A 1RUJ2 4MOAA 3WDYA 3VZMA 3KVAA 1TME3 3C3VA 2I74A 3OSDA 5KR7A 3VHOA 4E2SA 1U5YA 1QF3A 3TAYA 2D3PA 1XNKA 2JE9A 4KWJA 4ARXA 3SH4A 1OURA 5FP8A 5L9VA 1ULEA 2VUDA 4AI9A 5FWEA 3RSJA 1K12A 1QMJA 1QU0A 2ZEYA 1JW6A 2B45X 3N3HA 4S2GA 1G86A 4N43B 4B8EA 5I93A 2W08A 3DUIA 4WVWA 2WYFA 3VL9A 4FFIA 4TYSA 1FYUA 1YJLA 3UKTA 5E89A 3VD5A 4QM8A 5FMCA 3R6SA 1JUIA 3HIFA 1ZZ9A 4PIYA 5M0TA 3LDBA 1UY4A 3LEMA 2XVLA 5IK5A 1ULFA 1ALYA 4FPJA 4FTSA 5HCAA 1WCSA 3FE5A 4CCDA 1MZ6A 1DZRA 4XDOA 1S2BA 4QXCA 2GC0A 1XQNA 4XOGA 4DINB 2J1UA 2VOTA 1NCQC 1E5HA 4MHRA 2R073 4B29A 2PHRA 5K0UB 1QQP1 1W6OB 4Y20B 3GALA 2RMU2 5EFUA 4FAHA 4RD7A 2ZGQA 2HEWF 4D69A 3L9JT 2W1UA 1G9AA 2HJIA 2FCTA 3GBFA 4BXSV 3BOPA 3ACIA 1ASJ3 4Y26A 3DYOA 2WT2A 5C5TA 4LO8A 2FCVA 5IFTA 2QQOA 5IVBA 4FOVA 3EYPA 5DAXA 5FQ0B 5FZ6A 2OT7A 1S0DA 1Y9GA 4JHZA 1WUVA 4MGKE 3MEPA 4XFBA 5FLHA 1OXCA 1G6NA 2W87A 3IDAA 3LD8A 3UKNA 2YFZA 2RS12 3CDZB 3I3DA 5H9PA 4GKYA 1QJY3 3DXUA 4WM8B 4CP9A 1AR91 1YIPA 2JDUA 5LA9A 1UZZA 3IDCB 4PDWB 1K45A 5FUNA 3D82A 5I0TA 1CAVB 3U1XA 3NO8A 4YGEA 4HKOA 1W9YA 3ENRA 3S30A 2WNVC 2VH9A 3BIEA 1I6XA 1HRV1 2Q8EA 4EE2A 2GP5A 5FZCA 3ASIA 5ABJC 1C8NA 1AR63 3WP3A 1GKBA 3EQEA 1YWKA 4E27A 1LU1A 3AP6A 4XQ4A 1SMVA 5GLTA 4MGTA 2RM21 1LU2A 5IYYA 2YGLA 1VBE2 3QBQA 2A6VA 3SISA 4ET7A 1EAH3 1POQA 4BCUA 5A7OA 5H9QA 2C5DA 2TUNA 2VZQA 2QCSB 2HEYF 4MLOA 1H2LA 5CEHA 1LRHA 3N7MA 2Y0IA 4BE3A 1K5JA 1MEC2 3I2HA 1R64A 3WINE 2VBDA 2Z2SB 4Q4V2 3ZIWA 1J1TA 5KHJA 2JG9A 4XAEA 3WEZA 1HXS3 1JYNA 1UY1A 3THCA 1YLLA 2ZHKA 2ZTNA 4GZ9A 2H6CA 1KRIA 4FOYA 3PJQA 1J1LA 2VTXA 1U5XA 2W1WA 2Y38A 4XDQA 4LJHA 2BUKA 1D2QA 1UL9A 1WMEA 3D3AA 3VZLA 4AWDA 4YW5A 4AF9A 3BYWA 4A4AA 4XETA 1BQPA 1DBNA 3IKWA 3LDRA 4NHMA 4KWUA 4XQWA 5ACA2 4MUVA 3ELNA 5C9AC 1I1EA 1AYN2 4E8CA 1DGRN 4CDUB 1US3A 3GZEA 4IUGA 4LOSA 3FC0A 1OLMA 4AVCA 1XSQA 3P1IA 4KU7A 2IVIB 4INDA 2XJTA 2TEPA 3INAA 4IERA 4LBOA 3NVCA 1YRZA 1LHWA 1VRH1 2DU1A 3N7JA 3OEAA 3Q8FA 3RYRA 4Z1VA 1XSRA 3VKNA 1H2MA 3VV1A 1E5SA 1BK1A 5EJ1B 4QKBA 1C4RA 3ACFA 4YFZA 3IWZA 3AVRA 1MR5A 2HWB3 4YVWB 3I59A 1LHOA 3PUAA 3ORJA 5JDBA 5C3SA 2Y0OA 1OA2A 2XVKA 5A80A 3OBTA 4RGAA 3ZLIA 2BV4A 3ZKUA 3I2GA 4FO9A 2HKXA 5DAVA 3GHNA 4BQ1A 4IV3B 1XJAA 1W6MB 2NMNA 1KJRA 3ZYRA 4XZUG 1NUKA 3NW4A 5F2WA 3TBDA 1ACCA 4IW3A 4QPIC 3VBHB 2ZGMA 1RUF2 3DYMA 4DXTA 2AR6A 3KF3A 2RS33 4Q8KA 2WO1A 5BNNC 1GBGA 3E6BA 3NAPB 1LB2A 4CCJA 1VRBA 2R32A 3MIEA 2QQKA 2DTWA 5I8SA 3M2MA 4XHXA 3U10A 1HV1A 1UCXA 4XMIA 3MLJA 3WUCA 4JAAA 1IKPA 1QNYA 2VJXA 3NV4A 1APNA 4GH4B 3CJXA 4COUA 1VBC2 2ZOEB 2FZ2A 1Q5OA 5IJRA 5AFBA 3MZHA 1Z7S3 5C3QA 1PO23 1CGPA 3VBFC 3O1VA 1PMIA 3LWCA 4Q8LA 4CU9A 5FZEA 4EN7B 1I5ZA 4Y4YA 4ASKA 5FZAA 1UMIA 3H8XA 4NHLA 1IPKA 1UYXA 2E7TA 2VZVA 4Y24A 4QX8A 2JB4A 4WM7A 3ZFGC 4S2FA 1H9PA 1CJPA 2NQYA 4AVAA 3ZSEA 4NAMA 2ZEZA 4RQPC 2BJSA 3WHTA 3RZMA 3NQHA 4E4SA 1YYNA 2J1VA 1N1TA 1BXHA 4K3UA 3AVSA 4IEUA 1RUG1 2ZAAA 3Q8EA 1Q3EA 1FV2A 3ZXKA 2QBXA 1UPIA 2BRTA 3JCIA 4YW3A 4ES9A 4H14A 3WDWA 1GP4A 2QVSB 3GJAA 2DVAA 2R49A 4R9BA 3BGAA 1HQNA 1NQDA 4KMQA 5K0UA 1W6OA 5G05L 2XLFA 3AC0A 4QX7A 3WP4A 5DABA 5FZ8A 2PAEA 4QT6A 4Z92B 1OVPA 3CJIB 4YW6A 2KXLA 2OZ6A 5GM0A 4Q4Y1 4AVTA 5FBZA 2VZ3A 1F8VA 4Y1ZA 1QJY1 2E7QA 5CISA 5FQ0A 3LB9A 4YM2A 3D6EA 3AMHA 4AFDA 2RJ2A 1AX0A 3MYXA 2BWAA 2ZAHA 5JIUA 4A3XA 5ISLA 3JBG1 3MO4A 3P3NA 4AGGA 1US2A 1OOPB 2R1BA 2YMZA 3J8F2 4YM1A 2IXJA 4CA9A 5B2GB 3AX4A 2CNAA 3HJRA 3BI3A 1J3QA 2B4KA 5FXZA 4NIDA 2ZEXA 2ORXA 4QDRA 3AYEA 4Q29A 4RFRB 4XFFA 5KHKA 1CR7A 2HWF2 1S2KA 3MPPG 5AC91 4LO7A 1EAH1 4CXWA 5F37A 2EVXA 2ZMKA 1AVBA 1TQ5A 1N3OA 2LALA 4OHZA 4Q27A 5DDJ1 1SBDA 1SZBA 1WW7A 5C8WA 2W2IA 1SLTA 1RUC3 1GWLA 2HWD3 2VUAA 5FXXA 3LE0A 3BB6A 3GM8A 2WC2A 3LA2A 3I97A 4W50A 3SEPA 3AYAA 1WA4A 4RHV1 1NCRC 5FUIA 3HT1A 3CL1A 3I2IA 4FVVA 4NIGA 1QXRA 3KSCA 1J84A 5A7PA 4G3YC 4AXOA 1PZ8A 3BU0A 1BMV2 2R041 2OVUA 5EYYA 4PIZA 3WDXA 4XTMA 1D4M3 1WCUA 1OH3A 2ZGTA 1K5MC 3GZAA 2FQPA 3AKPA 4RR3B 5FUPA 3ZN4A 1RINA 1D7PM 2YDEA 3T2QA 1CWPA 2YY1A 1W6PA 4P14A 1EY2A 2ZGLA 3NNJA 5IHRA 5FBJA 3DEMA 4UWDA 1HRI3 3MICA 4Q0UA 1NQJA 2XBO2 1RUI2 2OS2A 5FLIA 1GANA 1PO11 5FZGA 3W58A 1GWMA 4LK7A 4QU2A 2DDUA 2Y6FA 2Q5TA 1QJX1 4P9GA 3RQ0A 5JI9A 1IQAA 5EP9A 5IAVA 2BBAA 2WNUB 4YGDA 2NN8A 5JAXA 1OUSA 3SCFA 5EIYB 3APBA 2BNMA 3E97A 4XIKA 2WZPP 3TN92 3CHXA 1ND3C 1UD1A 3VKLA 1UYZA 2HWB1 4LBJA 2IWGB 4YLZA 1QH7A 5A1AA 2PHWA 3OBRA 4YW1A 1U5ZA 1OC1A 3UGFA 1W9SA 1NAEA 1W8TA 1O4ZA 1TMF2 1A78A 2J22A 3OBZA 2Q30A 4YZ1A 3AYDA 4YVWA 1DHKB 2EIEA 5TSWA 1GZTA 2ZMNA 1V6OA 5JXIA 5IK7A 5CB7A 1Q8SA 2EXJA 4IEVA 2JG8B 4LBMA 1COV3 2DBNA 3FHIB 4JGYB 5GJ6A 5J48A 3PHMA 4J1WA 1C1FA 1AJOA 1T2XA 3MIBA 3N4MA 2J1EA 1DP0A 3U4XA 1M06G 1W39A 2H0BA 1AX1A 1W6MA 2ID4A 3HBZA 1OQEA 3JD72 2E6VA 2VNGA 5KXCA 2PYTA 3ME2A 2C0ZA 4CDXB 2A75A 4ZXKA 1OT5A 3HQUA 4NN0A 3VBHA 3PVEA 5I91A 3OGVA 4V2WA 3NAPA 1NE6A 2VOXA 2P3KA 2XXZA 2GP3A 3WF3A 3RZLA 4XW3A 4BZ4A 5LK7B 3BU7A 1PO21 2VMGA 2GC1A 1FPN2 3QACA 1QJU3 1Q8OA 1VBB3 2PHXA 3AZWA 4CZSA 1AR82 3ZPYA 2EICA 3AKRA 1W03A 3OPZA 5KHGA 1LOAA 2KD7A 3F2ZA 4ZHNA 2ET1A 4CUAA 1TE1B 4DB5A 1HB4A 1XE0A 4PI0A 2RMU3 3VKFC 3POIA 4EWEA 2P34A 3I49A 2VQAA 4NPLA 3TEYA 4UT5A 3DL3A 5A3LA 4I02A 2AREA 3RZZA 2CAUA 2VOKA 2WZR1 4E2GA 1GP5A 2ZBJA 3UKVA 4OVEA 1FATA 1N1VA 3I2FA 4XJ9A 3HMYA 3N35A 3THPA 5JXGA 1SLAA 1G9CA 4HKLA 2CAVA 3IPVB 4N8MA 1RHI3 3VBOC 5FYZA 3OYWA 2GALA 4YYOA 3ZFEC 1JN2P 1ZRFA 2B7YA 2RS13 1HN0A 4AEDB 1AYM1 3SC7X 4UFJA 1NKGA 1KD7A 1UOBA 2BEOA 3EJKA 3ILRA 1VBD3 2G9ZA 2JE7A 4IEQA 4OI4A 3ZM8A 5HCHA 1FOD2 4BMBA 1J83A 5FZLA 2XPJA 2VQTA 1WLTA 2W39A 1PIV1 1RUH1 2JDZA 2LRPA 1FT9A 1OBNA 1C5HA 4FPOB 1H8VA 4N43C 5E16A 3ZYPA 3CJIA 4LHSA 4Q0QA 4XUOA 2W9XA 1SHWB 4Y4RA 3FWEA 5T3NA 4I0BA 4TLFA 1HN1A 4ES8A 5A6YA 1OPOA 3ZYGA 1RXFA 1VBE3 4XCBA 1E5RA 2YBPA 3RG0A 4AK3A 2VBPA 1PMHX 2GDFA 4HFSA 1NG0A 4F8AA 4FBFA 1ZVFA 2XVGA 5L73A 4LR4A 1DYOA 1XYOA 1OOPA 3H8UA 4CTEA 3O5SA 1BK0A 1YQ6A 1MEC3 3VLBB 4FOWA 1UKGA 5FYVA 1MVQA 1S2EA 4FPKA 3R4SA 4Q4V3 1LGCA 4R4XA 4Y5TA 4JCKA 4HXCA 4NHKA 1QWRA 4D8MA 4XFCA 2ENRA 2EF6A 4DZGA 3OUHA 4RHV2 2MPFA 2SLIA 4KBZA 2VE1A 4K9SA 2JKBA 4MG2A 3B3QE 4RGKA 2VMCA 5FYSA 4XF3A 2C24A 1R1A1 2QQVA 2WDBA 4NMIA 4YNIA 4E4ZA 1AL21 1R091 3MPBA 4PQ9A 2YHJA 3OOXA 2TBVA 4IL7A 3C7GA 3IT8A 4ZU5A 2XWBB 3FZ3A 3GCXA 4N53C 5E6HA 5ACA3 3CEWA 2BFUS 4LTAA 1SFYA 1BYHA 2ZJCA 4UW6A 4L97A 3DGTA 4PLNA 4YVSA 3U07A 3VB9A 3CIHA 1CQ9A 4NIIA 4PJYA 1GQHA 5DAWA 5FY9A 4NHYA 2FMDA 4WM8C 5BXXA 2CWMA 5J1XA 1MACA 3PDQA 4PDWC 1UY0A 1PO12 1DQ1A 1NZIA 4R9DA 4BQ4A 2ZACA 3B7MA 1YQCA 3FJSA 4RR3A 2EIGA 1OHFA 1DQ0A 3RMYA 1ZA4A 1QKQA 3H9AA 3UNPA 4MX3A 3AP4A 3THTA 5LEJA 5LY2A 2A3WA 2A70A 3WNKA 1QHDA 1H6YA 2DUQA 1ZYBA 3OY8B 5KHHA 2VW0A 4LIVA 2WNUA 1L7LA 1YJKA 5A32B 3RI8A 3AJZA 2VAUA 4XUTA 1R1ZA 2K2SA 4HETA 1ENXA 3KQRA 2ARXA 2WZEA 2FDIA 5HV0A 4Q4X2 4HKWA 4CUGA 2FD8A 5FY7A 2O8OA 1BBT2 1PVC2 2HWE1 1OVSA 4MZUA 4Q0VA 2VMHA 1RUD1 4PLMA 2BBVA 4K21A 1ENRA 1COV1 2NM1A 2VU9A 1ZA7A 1ZBA1 4BH9A 3NNFA 4BM8A 2WJSA 3JUUA 3FN9A 1LOGA 5LY1A 3KCCA 1VBC3 4Z07A 2G9GA 3RMXA 1E57A 2JG8A 3KGLA 4B4QA 3K51A 4JGYA 2WFF1 2O8QA 4I0WB 4Q4W3 5D8AC 4HBNA 4PIXA 4XACA 4KG0A 1TNFA 1UZWA 2QDNA 1YFUA 3QLQA 2P3JA 4K1YA 2P6HA 4EWDA 3BTXA 4CP9B 4CDUC 2Q8DA 5FOBB 4I2OA 4DXRA 2OX0A 1VMJA 1DQ6A 2VCCA 3R4UA 4B3NA 4LO6B 5HXVA 4C0BA 1SLIA 1CAWB 1XRUA 2XWJB 4WZFA 4BA6A 2WLQA 3OGGA 4Z8BA 5T52A 1G8WA 4YGCA 2DBIA 3ACHA 4P9JA 4OUMA 2DTYA 4XJZA 4CEYC 1BEV1 1GV9A 4KGQA 4ZPIA 2D97A 2NYYA 4LITA 2XJUA 4ZKTB 1WCQA 2VL4A 1ODMA 1VBA1 3JQXA 5AFEA 4OULA 4AFCA 3SCHA 4HT1T 4YARA 4OFGA 3ZN5A 2R16A 2D6PA 4AL9A 1YI9A 2RHPA 1C8M3 4CDQA 3LKJA 5A7NA 4P9WA 2VZSA 3EMRA 4B1MA 3K75B 4K1ZA 3TB0A 4IV3C 1I5PA 1W8OA 4AG4A 1O3TA 2DF7A 3AYCA 1GFF2 4IGQA 2LROA 1RVF1 4LK6A 1C3HA 1SLLA 3VBHC 1JOPA 3CLPA 1RUH2 1O5LA 1CONA 1H4HA 3IPVA 3MW4A 1QXPA 2ZGRA 2JDKA 1N3QA 2WN2A 3C2UA 3S7EA 3T4VA 4AEDA 4R4ZA 2BVBA 4ARYA 2CL2A 3AZXA 3K4DA 3N9QA 5FPAA 1KFXL 3KM5A 1XNDA 3BTYA 5A3NA 5FYMA 4GH4C 1JUHA 1T6BX 2CSGA 1WMDA 3VDDB 3ZYJB 5L36A 3NNGA 2HWF3 1B35B 1XOYA 4D7SA 4AHXA 1AR71 4Q0PA 4QX2A 5JXHA 1SACA 3PIGA 2JDAA 3Q8BA 4LHNA 3H42B 4M3CE 3VHRA 4IEWA 3RZHA 1YC61 3FHQA 3HWJA 1LNSA 4YPJA 4QXKA 1GICA 3KHCA 4XFGA 4XUQA 2W52A 3VKMA 1REEA 1U12A 4IE5A 3IAPA 5JOWA 4BQXA 5I0RA 3M3EA 1GU3A 1W2UA 2P17A 4PF5A 3J7HA 2GH8A 2ZZJA 3HNYM 2BU9A 4HZFA 1OMIA 1VB2A 3H0OA 4FPLA 5DZEA 2GZWA 3VDBA 1KDMA 2XL9A 4IV1A 5CFCB 4QQHA 1ND2C 1RUE2 3MIDA 5LCWL 4JGZB 1V70A 2DCZA 1FMD3 1O3QA 3V64A 2YG0A 3VBRB 5FZ0A 1DU3D 1H2KA 1W9TA 4A7KA 4W6WA 5C3PA 3TEZA 2P1BA 4GA9A 2V72A 4KL1A 1HLCA 1JZ8A 1YEWA 2HWC3 3FHAA 3JB8A 3R4DB 2FCUA 4UBHA 2XBO3 1RUI3 3K3NA 1S55A 2DUOA 4LA2A 2NLRA 1X9TA 3VBSB 4IEXA 1PGW2 3WF1A 3WW1A 1VE0A 2VCAA 3EBRA 2F17A 3WP5A 2VTXJ 4QPGC 3I2KA 4JKMA 3A23A 3TEWA 5I0SA 4PCRA 5EXOA 2A73B 1PX3A 1F2NA 2HBUA 3ZXGA 2MHFA 1QXJA 2PLV1 1EPWA 2YBSA 1VLNA 4S2HA 3SMHA 1Q56A 1MPXA 4ASLA 3DKQA 4WM7B 1TMF3 4XEZA 4DPNA 1PM4A 1REFA 4UFKA 5IVCA 2BNNA 4C1XA 3NV1A 4YZ2A 2VZTA 4AHYA 3JQWA 1NY71 1DGWX 1YXWA 4PBOA 1G7YA 1NXD1 4GXLA 1BJQA 5D2AA 3WQ1A 4A44A 2BZDA 1TNRA 3OY8A 3T30A 4GJYA 3LSEA 1OFNA 1RUD2 2GC2A 3B00A 1K3IA 1V6KA 3AJYA 5A32A 1XPWA 2VZ1A 3AXEA 4W65A 1LHNA 1NE4A 2WYSA 2XH6A 3JD73 4OMDA 1YQ5A 5H9SA 3ZSMA 4E2QA 1LR5A 3WXPA 3CZJA 5F3IA 2WFF2 2WLPA 1P8JA 3N9PA 4ITCA 4OZXA 4KBBA 3D4KA 4Y5Z0 3G6JB 4AQ6A 2W1QA 4AQSA 2D6NA 5CIRA 2IZWA 4Q4W1 4G9SB 4A7ZA 1T6GC 1FPN3 5GZDA 1IQDC 1F5JA 1WA6X 5F5IA 4C0HA 1AR83 1F35A 1H8TC 3UETA 1V9U1 2JIGA 2PTMA 3NL1A 2B9VA 3NRUA 4JQRA 4TN7A 4OHYA 3O1UA 1R083 4OHWA 1JZ7A 4L11A 3N36A 2BFUL 5DMYA 4HVQA 4FFHA 2DV9A 2GMEA 4LE3A 5CFDA 3T0BA 1ZBE1 4NO4A 1X36A 1IOAA 4FPYA 2PFWA 1RYYA 4Q1RA 3T2TA 4CU8A 4PT6A 5CBLA 1LECA 2AEYA 2MEV1 2OIIA 5GLUA 4A2UA 4CU6A 1CAWA 1VBA2 1RMU3 4PQQA 4W6YA 2YZ4A 3L2YA 3UT0A 4GB32 5GZFA 3T3YA 1SCRA 3CQOA 1UY3A 5LBBA 2RDNA 2DU0A 3MLKA 2CGPA 4DXZA 3I2OA 3UGHA 2JDNA 4Q5OA 2ADDA 2EXIA 3KCYA 4RGGA 2GAUA 5A7WA 4IESA 1NXMA 2X5IB 5LATA 1RVF2 4ONUA 5DUWA 4AAXA 5LK5A 4UW5A 1H9WA 2Z42A 3VZJA 1M4WA 1RUNA 1MQTB 2VVDA 4CCLA 2AEZA 3POJA 1S0GA 4M3CA 1DLCA 1JMUB 4AI3A 3KT7A 5F6LB 1UZVA 3GZTB 1NA1C 3RPQA 3LOBA 5EHDA 4C91A 1JBCA 4CPBD 2I07B 4XIOA 4CDXC 3ZXLA 4CP2A 3VD7A 4NRQA 5A3TA 2A3YA 3AKTA 1OI6A 2GC3A 3HN1A 2R1DA 3OTFA 5FTTC 1ZZCA 1W6PB 1LCLA 1MZFA 2QKDA 4HVRA 4LO4B 4AI0A 5KXEA 2R063 4L99A 3MV01 2RS52 4O61A 3ZOIA 3POBA 3LA7A 3ZXDA 4LLFA 5HCBA 5J36A 3VDDA 3WG4A 3WX5A 1B35A 3AKQA 2LS6A 2BERA 2WA3A 1SQ4A 3VDCA 5A1LA 4XYXA 1DDLA 1WLCA 3K4ZA 5DG1A 5JMCA 4P9YA 1VIWB 4Y3OA 3PVBB 3ZN6A 2VCMA 1UY2A 2OYZA 1DZTA 3KD4A 3Q9OA 4I30A 4KG8A 3NWKA 3I7DA 3KZ4C 4FXGB 3BOWA 3DPRA 4CEWC 5JLVA 2UYBA 3HT2A 5A3OA 5FFOC 3UESA 4CVUA 2VECA 2YC0A 1FMD1 5FY0A 2YYOA 3N7KA 4AEDC 1EV12 2IXIA 2WS92 4IEZA 3WR0A 1H4GA 4XBLA 5CFCA 3LF7A 5FK7A 3OGSA 4JGZA 3WV6A 2HWC1 4BJ0A 4XAAA 1W06A 3RJRA 3VBRA 4ASMB 1LGBA 4I0AA 3THDA 4BPZA 1TME1 3QD6A 5E88A 2E7AA 4MGQA 3UL2A 4PI2A 2MNGA 2XR4A 5JZGC 1OFSA 2DVGA 2HBTA 3GZUC 4HSJA 4BOWA 3RWKX 4ZU7A 3HD8B 2HYXA 3VBSA 5T5JA 3MFAA 5C4WB 4AQ2A 4E4DX 3U78A 3ZMNA 1PK6C 2ZHLA 4BK5A 1EP0A 3WG3A 3WDTA 1HQWA 3J26N 2WZ8A 4UW3A 2A6XA 2Y6JA 4XFIA 1KXGA 1Y7BA 3LFIA 5FY4A 5LB6A 1VPHA 3AM2A 3C7FA 3GXUA 1XNBA 3CU7A 1BBT3 1PVC3 1ULCA 3VZNA 1Q43A 1DIWA 5AVAA 1V6LA 4R9AA 3H1MA 4JV4A 3IM0A 4KWKA 2P3IA 5L7OA 1W2AX 3M7AA 3MLLA 5DZFA 1QQP2 2AC1A 2CGNA 3B9CA 4Q26A 4RS5B 2R071 3MBWA 3OYWB 3O1OA 1UXZA 3KV5A 2Y34A 3VBUA 1LODA 3AXDA 2IFRA 3CKHA 3JU9A 2XJRA 1DQ5A 2PA7A 1O3SA 5FYTA 1AZDA 2VQUA 1ASJ1 3AFGA 4WV8A 4LA3A 1OA3A 1KFUL 4X8NA 2ZX3A 2GNMA 4EJRA 3TRSB 1ZZ8A 4BDVB 1LKNA 3SITA 1UW8A 4CXYA 1JU3A 1R081 4BQ3A 1AR92 1ULPA 3B5LB 3KF5A 3OGJA 1LHUA 1PNFA 1UAIA 1VMFA 2YUEA 3WZ1A 2X8KA 5FYYA 2Q1ZB 4YW4A 5DAQA 1BZWA 1HB1A 4H7LA 2D6LX 4LE4A 4LKSA 2QE3A 5L9BA 1QNWA 3ILNA 4DEVA 2YPJA 2X10A 3KT1A 3ZXJA 1S0CA 1JZ4A 1HRV2 5JVVA 2BOJA 3WNLA 3FBMA 1HJGA 1H0BA 5SV8A 4B7KA 3WNMA 4YZ3A 3ZYFA 4DMIA 4AEJA 1JU4A 5FWJA 2FBEA 1N1SA 1DG6A 1RMU1 2QUOA 2XQRA 2DFCA 2IUWA 2RM22 2WO3A 3WW3A 1AR61 5JCTA 4KI5M 3K48A 1JZ6A 4HONA 4OI1A 1BVVA 2VXJA 1QJEA 2RR13 3ZDVA 4OZOA 1GMMA 4ATEA 2LW8A 4FP3A 4IE7A 2XQXA 3J4UH 4N9IA 3AP7A 1UQXA 2IFWA 2F4LA 2X5IA 3W9AA 1WLDA 3KB5A 1XNTA 1IZ3A 1I9RA 3B02A 3GF6A 2PXJA 1UZYA 3E6DA 4B4PA 4M3CF 3C7HA 3E1F1 3MGUA 4TZDA 4YVSB 1HXS1 1MQTA 1SFNA 4AYUA 4Z2WA 4NIAA 2W95A 4LT5A 3NSTA 4DXSA 2W0XA 3ZIXA 1GZWB 4AVVA 4O65A 1TEIA 4HK9A 4R52A 4XFHA 4UOJA 1JHNA 2R061 1AX2A 2XDVA 3PIJA 2EALA 3BALA 1GR3A 1ONAA 2CDOA 4JZRA 3V0BA 2WQZC 3ZR5A 2ZX0A 3H7YA 2ZGPA 4BMEA 1J59A 1VRH2 5F8PA 2JICA 3P6BA 1WW5A 5T5LA 1LOCA 5T50A 2GMPA 3LEIA 4GMP3 1ODNA 3J7MA 5BV6A 1RUE3 5CG8A 2EAAA 3N9NA 1HJFA 3E5QA 2WL1A 4XF9A 1X33A 2DCJA 1VAKA 2Y64A 2C4XA 4RSUA 2LTNA 3O0WA 1ULDA 2R7EB 1SBFA 5BPXA 1LTEA 4EN9B 5DUXA 4Q1PA 4QX1A 3WHUA 1D0HA 4UFHA 3MHZA 2JG9C 3LOIA 2XJVA 4GAZA 1RUJ3 4F83A 1A8DA 5LBCA 4YRDA 1EUTA 4D6QA 3SEEA 1SG3A 2H6BA 4I3GA 3WNOA 4D6RA 1LGNA 2VULA 4BHPA 2JDPA 1VALA 5LRRA 2E63A 3C8XA 3T0AA 2WNVB 4XHBA 2D6MA 4QGMA 2RS31 4I01A 1W2TA 4C90A 2BGPA 3GGLA 1GQGA 3POFA 5H9RA 2EXKA 2X09A 3OEBA 5ABJB 2ZX1A 1Y43B 1GNZA 1UU5A 4HSLA 1HB3A 5FYBA 3V65A 4NR1A 4EROA 4QXHA 1QY4A 4KNCA 1YHFA 2H0VA 3PTYA 5EJ3A 2A6ZA 1OQ1A 3SNMA 4AVSA 4Y1YA 3OD4A 2QQLA 2CGOA 4W4ZA 4CYDA 4JKKA 5F5AA 3O1RA 4XVHA 1Z7S1 2NMOA 4JC1A 4MGIE 5E1RA 4UFLA 5C4WA 2A3XA 2BDRA 5CYYA 3BUCA 2UYAA 4D0QA 4XURA 2Z4FA 5D21A 4XQDA 1KS5A 2VOWA 4D3WA 1STMA 3WF4A 3B69A 4FPGA 2D6KA 4UXAA 5FP9A 5IVEA 4CDWB 1RUG2 5KHIA 2YXSA 4CPBA 3PUIA 4CDQB 5CFCC 1B09A 5I8YA 1YI7A 4JGZC 3SQOA 3ETQA 4LBKA 3OPTA 1U0AA 2V5YA 4Z82A 1PMJX 1QJZA 4IDZA 1W0PA 2W46A 1W2OA 4I09A 4Y1VA 5GZEA 4K20A 1AJKA 4RS5A 2YU1A 3R0RA 2BVVA 2BYVE 4O9EA 4YW7A 1UU4A 3O14A 5C71A 1UX7A 5C9AB 2AUYA 4H2AA 3MUZ1 4NROA 1SBEA 3SXWA 5DUUA 5A6QA 1DGRA 1IS3A 2UU8A 4Q4Y2 1D4VB 4HN1A 5FKBA 3K2OA 1QJY2 1YFXA 2VGDA 3B94A 4J25A 1J3PA 3SLIA 3OD0A 1HV0A 1W6NB 1MS4A 3HQRA 2JWPA 2Y8KA 1C57A 2W94A 4P5HA 2D40A 3JB4C 3JBG2 3PMEA 4O7XA 5DXDA 2Z69A 3ILFA 4GB33 3WDUA 2UWBA 3FFZA 4SLIA 3WD5A 1OKOA 4JDNA 1N3PA 3W21A 2DCYA 1WKYA 1A3KA 4HANA 1ZX5A 4WM7C 1GNHA 4UYBA 1PGSA 5AC92 3AK0A 4MXVA 5ANNA 3TNQA 4HVOA 2VNVA 4QQ2A 3WCRA 1EAH2 1LHVA 4R9CA 2WNEA 3T09A 3OG2A 4XBNA 5KC6A 5HXMA 1WD3A 4QB2A 5DDJ2 4CXXA 5CAZA 2AGSA 2XKOA 5IAXA 2RR11 4X8PA 4MSVA 1AXZA 3MF6A 4IV1B 4LBNA 4CCCA 2P4EA 4LUMA 4IGOA 5K0UC 4U2AA 4ZXEA 1RUC1 5BNNB 2HWD1 3ZX7A 3A7QA 4URTA 4D7TA 1QDOA 1KITA 1WMXA 5B4XA 3ZR6A 4AOCA 4CUCA 1W28A 3OGRA 3AB0A 5FYCA 2X29A 3SH3A 4XUNA 3KV4A 5K8SA 1RUOA 2OA2A 5LEKA 2R042 2WO7A 4KU8A 3USUB 2XHNA 4OCTA 1XB9A 2RS53 4OLLA 1JYXA 5JOYA 1X8MA 3P5BA 3RYPA 1AYN3 4JQTA 4Y5SA 1QJFA 4IEYA 3VBFB 2GNDA 3BODA 2Q1FA 4NPMA 1CZTA 1D4M1 1IPSA 2ILMA 5L19A 2JEMA 4KH9A 1F15A 1H1MA 1HB2A 3EO6A 3ZFGB 1GZWA 3MI8A 4PLOA 2VC9A 1UU6A 4NPRA 5F39A 1MS3A 2XMLA 4BXFA 2KR2A 5F32A 1CJDA 1HRI1 1POV3 1QJX2 2JD4A 3LZZA 2Y6GA 4COWA 5FK8A 3POGA 1LOBA 4BQ2A 2FDGA 1Y3TA 5F7UA 4CUBA 4J1XA 1V00A 5LBEA 2ETEA 4GWJA 2QFEA 3H1YA 2ZPXA 2HWB2 4EZHA 3DV8A 1KQRA 2WS93 3LQCA 5JPNB 2QDRA 3PURA 1JTZX 1JI6A 3LIHA 4FPCA 5C70A 1DZQA 1SPPA 3O7OA 2I2SA 4CP1A 3UYJA 1W2NA 3HNBM 1W99A 5FP7A 1MQTC 1RUJ1 5FRAA 2B9UA 3J7NA 4OHVA 4AQTA 3I3MA 3IDBB 3I2JA 1RUF3 3KVBA 2E9QA 4JTOA 1AXKA 1JZ3A 1WWYA 3CF6E 2G19A 1W8FA 4Q2FA 3IMMA 2Q8OA 5LWBA 1DLLA 3MW2A 1LULA 1S0BA 2WRAA 4JRAA 3ZYIB 3NMBA 1SLBA 1H1IA 2WA4A 4JRLA 1UXXX 2PAMA 2IC1A 3BCWA 3ATGA 4GULA 1LOEA 2WNVA 1F5FA 2JDYA 1URXA 2FHRA 3ACLA 4QPWA 3P3PA 2ERFA 2YB7A 4P9IA 1PO22 3MFCA 5CFDB 5ABJA 5HPOA 2YFUA 5C3OA 2ZMLA 4JVAA 5FP3A 4A41A 4LLOA 1QJU1 2E32A 2V4AA 1VBB1 4YZ5A 3SCGA 3AMQA 2UY8A 3WNPA 1MZ5A 1QQP3 4K8FA 1S0FA 3PLQA 2ZGKA 2EA7A 1OD5A 3AL6A 3CZUA 4AGVA 3WF0A 3DCQA 5A33B 1ZZ7A 2VO5A 3GBWA 5F5CA 2WIIB 4HOOA 1ST8A 2RMU1 2QQMA 2ZS6B 3A22A 2WZR2 2VMDA 2PHUA 3GCWA 3POSA 1OLRA 4YVWC 5A7WB 2CHHA 3WUDA 3AP9A 4ORFA 2YROA 4CCOA 4CU7A 5IK8A 4AI2A 5BY5A 3PUQA 3V0AB 3PUHA 3I3EA 4BQYA 4CDWA 4XILA 5BNOB 2RE9A 1CX4A 4GJZA 4R8HA 1W8NA 1CPMA 5A3PA 1Q8VA 1AYM2 1K5MB 1NLQA 1GOHA 2R0FA 5F1RA 5F3CA 1RHI1 1UIJA 2Y6KA 3DF0A 4M3CB 1AR93 2VOVA 3D8CA 4BB3A 2RS11 4U36A 3R05A 3OUIA 2W68A 4LHLA 4HN0A 3WF2A 4BQ5A 1PIV2 1OLQA 1VBD1 3E5UA 3KWVA 4KWLA 4NHXA 3NNLA 5LA2A 3WLUA 5JOXA 1A8MA 5C9AA 1PX4A 3NAPC 1TG7A 4PF1A 4EQVA 1W8HA 2RDRA 4FFFA 3EB7A 3RFRA 1BCXA 1GOGA 3J8F3 2PAKA 2FMYA 1REDA 2XHKA 2RDSA 4H7MA 4DS0A 3LSDA 4QB1A 2FDFA 4NWWA 1ND3B 1W6NA 2K9ZA 3I3BA 4GWNA 3TOJA 1OD3A 4XC9A 2XONA 1YFYA 1VBE1 2L9LA 1UYPA 2E26A 5F2SA 5A7QA 5FPXA 1D0GA 1UOGA 2Z5WA 3WY6A 1GQPA 3HOBA 1X9PA 4BISA 3ZN6B 5A3UA 3ETPA 4QPYA 4COVA 2JENA 1MEC1 3KV9A 5A6XA 3QCWA 2BW8A 2Y6LA 2GU9A 3DPRB 4QX0A 4RN5A 1W05A 3ROUA 2UWAA 5B4NA 5BNQA 4Q4V1 4RS5C 2BWCA 5J37A 4M01A 5JWPA 3H1WA 3U14A 4LOTA 4MADA 2W1SA 3LFMA 2JECA 1R1A2 3BTZA 5J96B 2B5HA 2DFBA 1AL22 1R092 1GSLA 2QQNA 3FFQA 4XUPA 5FZDA 3ZMOA 1XYNA 3HQXA 1NX9A 3T4HB 3RZKA 1O3RA 2A6WA 5BNNA 4QM9A 5ACA1 4IEPA 2HEVF 3DXTA 1D2SA 1AYN1 4KQ7A 5FDBA 3ACGA 3CJIC 4YG3A 2DYCA 4FPFA 1XNCA 1DGLA 3USUA 1OSGA 1VRH3 3ZO0B 5A3MA 1UOFA 2Y26A 1HRI2 4ZY9A 3VBFA 5DN2A 1NLRA 5FZKA 3FUOA 2GNTA 3D5OA 1MS5A 1POV1 1JYVA 2IXHA 1JOBA 1OOPC 3ZFGA 3TN93 5BUVA 2JD9A 3C7OA 2A6YA 2Q4SA 1OLME 3FUQA 5LZ6A 2VMFA 2OUHA 3WNNA 1S1AA 1WMFA 4LO5B 4LQRA 3VBOB 3VZOA 1RC6A 2VXRA 2Y33A 4J6GA 4TWTA 4LPLA 3U37A 3ZFEB 5L7OB 2IXLA 1PVXA 1X50A 5IFPA 1O7FA 3ON7A 4MYEA 2CDPA 2HWE2 3V56A 5BNPB 3KLSA 2ORZA 1XU1A 3AFKA 1RUF1 2WSVA 3VBUB 1COV2 1N47A 4JTNA 4K40A 4L0PA 5BNPA 4QX5A 1ZBA2 5FCCA 4HMZA 3WSOA 2DVDA 3A0NA 2RVAA 2DURA 1V6NA 3E5XA 2C9AA 2WAOA 4YVSC 1AXYA 5FYUA 4LBQB 1FV3A 2JDHA 2ZHNA 1VR3A 2RDQA 1VAVA 1MVEA 3NNMA 2QQJA 1CZVA 4BQWA 1VBC1 4Y22B 3PUSA 1SDDB 5CVRA 1G9DA 4IE6A 1L7RA 4LEJA 5FZMA 4FSJA 4X6RB 2GN7A 3KGZA 4RR3C 4DEQA 3I8TA 2DCKA 4D94A 3ALQA 4CCEA 2C1FA 3WW2A 1QJU2 1VBB2 3PVNA 1X82A 4EN0A 3VHPA 2WBKA 2XKPA 5FXWA 5JUVA 2D5FA 2FDKA 4O9GA 2PHLA 1KEXA 1RUG3 4CP0A 4S2DA 4OUEA 4XJWA 5FO7B 1UN1A 4I3PA 1BEV2 3KS7A 2RV9A 1W6QB 3SKJE 2WNUC 1PGL1 2SBAA 4CSWA 1ULOA 1W8UA 3M4FA 3BIWE 5FJHA 3S6PA 3ZSLA 2ZX2A 2YBKA 4QQLA 1TZOA 1NZCA 1A6CA 1GYKA 1HQLA 2VD7A 4WVMA 1RJ8A 1YIFA 1QGLA 2RJLA 3IN9A 4N53B 1RB8G 2ZKLA 5A33A 2OPWA 4DRRA 3GJBA 2Y60A 4ZS3A 4NE9A 1RHI2 2WWUA 1NCRA 2WFPA 1IG3A 4Q4Y3 1C8M1 4IEOA 3HR9A 4DUXA 3H8RA 4FTEA 4XZPA 3T1MA 1VMHA 1CAUB 3ITQA 3BPZA 3BKZA 5A70A 3V0AA 4D6SA 1FOD3 1YO8A 1GZ9A 1LAJA 5BNOA 1VBD2 3BVCA 4MO3M 3ZVXA 2JG8C 4AFAA 1SEFA 4JGYC 1JS9A 1W9WA 3JBG3 4XXPA 1K5MA 1ENQA 4TXWA 4M0NA 1LEMA 1ZM1A 4RA0A 4WBBA 3RVHA 4NUBA 1Y9MA 3J8F1 4Z2AA 5E8AA 1CAXB 4AFBA 2GNBA 1F9KA 5AC93 1AR72 5A6ZA 3F95A 2HWF1 5T5OA 3V0BB 4K8RB 4M4PA 2D6OX 4QXBA 4TSVA 3RS6A 1DFQA 5DDJ3 1IGOA 1UYYA 1E5IA 4YWAA 4COZA 5T54A 2BQPA 2XJQA 3HNMA 2ZX4A 3J9SA 4JKLA 3VKOA 4QWNA 1ND3A 1GWKA 1ULGA 1WW4A 4W8JA 3UJOA 2ZABA 3LDKA 4C1WA 5K9YA 2Y6HA 2PHTA 4N9HA 4RHV3 4CDWC 2D98A 1PHMA 1RGSA 2YGMA 1G9FA 4MVTA 2VQ0A 4QKFA 1BKZA 5IUQA 3DECA 5EWSA 4CDQC 1WCKA 4IE4A 1BLZA 5LA1A 5FIXA 3MV11 4GQ7A 3AZVA 1ZRDA 3CBNA 2VW2A 2R043 3OCPA 1WBLA 5IK4A 2WWJA 4OMCA 5FO9B 3IDEA 4JDMA 5IVVA 3FL7A 1BMV1 1Z0HA 5D8AB 3POWA 3HEIA 1N1YA 4OHXA 3W59A 2VNRA 5DAPA 1Q8QA 1K42A 1MS8A 2GMMA 5IWFA 2D5HA 3HAGA 3CNAA 4RL7A 4Y1XA 5EPAA 5F3EA 4A6SA 1UWWA 3T2OA 4UAPA 3U11A 5FMOL 5JOZA 3B9IA 1FXZA 2XJPA 5C3RA 1PO13 4AEKA 3ES4A 4W6XA 1V6MA 4HPKB 5FY5A 1AHSA 1QJX3 2OZJA 2XBO1 1RUI1 4L9BA 2CTVA 2WKKA 4H55A 1HX6A 5J98B 1MS9A 3X29B 4LKEA 4BLJA 4CEYB 4HG6B 2X05A 3LPFA 2P37A 5FZ3A 2PLV2 1YQ2A 1WZXA 1JODA 1XYPA 2YC2A 2G4IA 1DCSA 4WZCA 5FZHA 1W0OA 2VZRA 3TN91 4AHWA 1G9BA 4WVZA 3VZKA 1PM7A 4GWIA 3URFA 3HPNA 4N7UA 1WBFA 2WT1A 2ZXQA 4V1PA 3RWNA 3B01A 2O1QA 2AACA 5IATA 5FPBA 5CG9A 4AI8A 2ET7A 4NOTA 2W47A 3CO2A 4DY5A 3PJYA 3WT3A 2O14A 1NY72 5GKAC 5FXVA 1OQDA 1TMF1 2OW4A 5IW0A 4AGRA 3NV3A 4Q4X3 1XE8A 2XGXA 3T2PA 1CVNA 1RIRA 4IV1C 5JIAA 3ST7A 4G4FA 4XJUA 3VBOA 4QQPA 1H6XA 1F4HA 3ZFEA 4B7EA 1WGPA 3MUY1 4YGBA 3U4SA 3VL8A 4DOUA 1LJ7A 3IIIA 1QOTA 1W0NA 4AR2A 4EN6B 1BHGA 2E53A 1W9FA 1VAMA 3JD71 3NV2A 3PNAA 3Q8CA 4META 3S5QA 3ZFFB 5A3WA 1RL3A 1W8ZA 2R0HA 2XUMA 3BTAA 3NKGA 4AAPA 5C8CB 1U5IA 3AMNA 4QU1A 4YSFA 5LA0A 1RXGA 3OF1A 2D7FA 1KDKA 4Q4W2 4AI1A 5FPLA 5FV3A 3LEGA 4N43A 1GP6A 4V2VA 4DUWA 2F4PA 2PQQA 3IZOA 4NRMA 4LBQA 5C7GA 1QDCA 1Y9QA 1FPN1 1V9U2 2XL7A 3TYJA 1C5IA 1ENSA 3RZGA 1O4TA 1AR81 1F4AA 2ZGOA 2K0GA 4ZS2A 1UIKA 4M00A 1OPMA 2ATFA 1FNZA 4Y22A 1J3RA 1KS4A 1W3VA 3O0XA 5GZGA 2RJKA 1ZBE2 1PGL2 4FP2A 2IXKA 2O0OA 5FMBA 2WZR3 2G9FA 3K3OA 1UX6A 2VZPA 4D7YA 2J1TA 2MEV2 3WOGA 4AEMA 2D3RA 5LBFA 3MF9A 4H3WA 3M8LA 3KQ4B 1QOSA 3WDVA 4MHUA 1ND2B 5C5UA 5CA6A 1O5UA 1H1AA 1YQ8A 2IXCA 5FLJA 3M3IA 1LOFA 3A4UA 4Y20A 4YG6A 1AYM3 3VD4A 1W6QA 1WD4A 1C8M2 2W92A 4PBPA 4NVPA 1YFWA 2VVEA 4YW2A 5I0UA 3K4AA 4EWAA 2JX9A 4ZZ5A 1NYWA 5BYNA 3N9MA 2CU5A 4LBLA 1XXNA 1O6UA 2QTWB 5LASA 1PIV3 1RUH3 5K7PA 4N53A 3HBKA 5G04L 1FOD1 3VD9A 2WQ4A 5D1IA 5JXJA 2B39A 1DYKA 2JE8A 4QPGB 2VBBA 1CAUA 3MIGA 1KJLA 2JXAA 4JDOA 5IVFA 4WM8A 2ZZQA 4PDWA 4BWOA 4FAGA 2VCBA 1CAVA 5A7SA 4FTBA 5SV5A 4AHZA 1O91A 2YC4A 4OUSA 2QQWA 4QD2A 2QQUA 5CFDC 5T5PA 3RYKA 1OKQA 4TTGA 1YCIA 4QKNA 3W5NA 1HKDA 5JR2A 2VPVA 1CAXA 2DVBA 4K6BA 5I8TA 3K77A 4EZ4A 2A71A 2JB8A 3WNXA 1H30A 1S4CA 5JMOA 1NCQB 1IS6A 1VB4A 1R1A3 1YNAA 1AL23 1R093 4N7IA 4P00B 3UGGA 2XG3A 3T0DA 1GUIA 5FZ9A 4DY3A 5FZ4A 4L92A 2NP0A 4N90A 2WN3A 1SPPB 4BIOA 2AYHA 5BNOC 2ZGSA 3OBAA 4A6OA 1WLWA 3LIGA 1ZZBA 2EIBA 4IQPA 3H8OA 1L3JA 1FMD2 1UKRA 2WINB 3ZXAC 4Q0SA 2PQSA 2VMIA 4LXLA 3U75A 2F6BA 4GMP0 5KXBA 2N7GA 1H8TB 1S0JA 2V5DA 4E8DA 4XABA 1XBFA 4QHBA 3NKTA 1CN1A 1DYPA 3W20A 2HWC2 5FMDA 5D8AA 3U0ZA 4JX0A 4BIFA 3ABZA 4ISQA 4CCMA 2BNOA 3O0VA 4QGNA 3SH5A 3GNEA 1FNYA 3WG1A 1TME2 4AW7A 4CDUA 1JOJA 2UURA 4QDQA 5FKCA 3USSA 3VGIA 2BPA2 2OQ6A 1J58A 3LA3A 2BGCA 4MGYE 4QAWA 1JYTA 2WQ8A 5HCFA 4M0HA 4HPKA 5EQUA 3VDDC 5LRSA 1B35C 3DYPA 3WCSA 2C26A 3AKSA 2ZKNA 3HVDA 4UFMA 2FZ1A 4OYUA 5FREA 5FO8B 4LORA 1UOJA 2VVFA 3AZYA 4UF0B 1XU2A 2K46A 4CEYA 4FXKB 2VMEA 1FI2A 2W3JA 3NJVA 2CV6A 3SKVA 5IVYA 2DWRA 3O1PA 2YV8A 2PHFA 5L9RA 4OI0A 1UMHA 2ZA9A 2HWE3 4FFGA 1PZ7A 3H50A 3OPWA 4Q4X1 3N9LA 1RUD3 4EYUA 3DPRC 1BBT1 1PVC1 1DQ4A 2NPIA 5DG2A 1ZBA3 3WG2A 1UNBA 3ES1A 2HLEA 4FCAA 2OPKA 4IV3A 1NA1B 1JH5A 5FZOB 4GALA 2R072 4OQ8A 1RTVA 4XBQA 2WFF3 1I3HA 2XUEA 2P2KA 4E9KA 1QOOA 1ZRRA 4P9XA 5K4LA 2LUWA 1CD3G 3N9OA 1OF4A 2UWCA 3I3QA 1VJ2A 3VBRC 1UPSA 5F9TA 4ZU4A 1ASJ2 2AENA 4LULA 1QIQA 5IVJA 2Z79A 4QQOA 4CCNA 5FZ1A 3PL0A 2ZHMA 2VTFA 3B93A 4GH4A 3ZFFA 3GBGA 2JJ6A 1KGYA 3NJXA 1XC6A 5FP4A 2J42A 1UMZA 1S0EA 5FZFA 3RI9A 3VBSC 4C8DA 5C8CA 4RFT0 5CKMA 1R082 4E4HA 3LEKA 4GWMA 5JI7A 4GIQA 4ISRA 3PU8A 1EUUA 4FQZA 1W8WA 4MXWB 3M70A 4F7ZA 1BEV3 2A1XA 1W04A 3MW3A 4HK8A 3SHRA 3WW4A 2D3SA 1ZREA 4FOQA 1W3XA 2ES3A 1VBA3 2D44A 1IPJA 3H3LA 1JHJA 4YG0A 3QH7A 4DO0A 3IBMA 3JXSA 4CEWB 5FAXA 1RMU2 1SCSA 5KC5A 2OUJA 1AR62 2P3YA 4XMAA 4NRPA 2QZ3A 2J7MA 5EJZB 5L7OC 4DFSA 3VHNA 1RVF3 4NIHA 1WW6A 2ARCA 3RRDA 1UO9A 4BU2A 3IIAA 3LCPA 1ND2A 5BNPC 2P6CA 3NJYA 4GD4A 4YM3A 1AUYA 3ZKYA 1O8SA 2OXBA 3MIFA 3POEA 3BN6A 4X6QB 3UK9A 2VUCA 3VBUC 3KV6A 5C6CA 1EYBA 1ZZ6A 2AZ5A 4FI9A 4QHZA 4CE8A 5J3UA 1PNGA 4QPIB 4B1LA 2V4VA 2V73A 5JZGB 4MV2A 2Q1MA 5CZKA 1MS1A 3AZZA 5FPUA 1SLCA 4XFAA 2ARBA 4IE0A 1CX1A 5FYHA 1AR73 1HXS2 4K7JA 2V09A 5T55A 4F3JA 2R6QA 1HDKA 1PK6B 4NJ4A 2D43A 4XJ8A 5FOJB 3E6CC 5CNAA 4P08A 4QPGA 2OQ7A 4XJAA 1CPNA 3T08A 1QEXA 1IKQA 3H3ZA 4GKXA 5FYIA 1FAYA 2R062 5CU1A 3VDAA 1NT0A 2BP6A 4Y1UA 4TLGA 5JPMB 3QH6A 4AZZA 5EYXA 2HH9A 3L2HA 2WUHA 4XCAA 1FX5A 4XPVA 1IHMA 2WO2A 4L2NA 3H7JA 1LOFC 4QDSA 5FZIA 4COYA 5HV4A 1IS5A 1OUXA 1WCDJ 3FLTA 3M1HA 4RQPB 2VUJA 5J7MA 3PTRB 5HI0A 2WNOA 4A3ZA 2BGOA 5FY1A 1YUDA 2B8MA 1EPZA 2QQPA 3S5AA 4XDPA 2VW1A 3A0KA 3ZYHA 4P9LA 4GMP1 4HLTA 4BLIA 3FLRA 1RUE1 1BVP1 1NCQA 3GHMA 3MIHA 1DQ2A 1PZ9A 2WR9A 2HYKA 1EV13 3ZSJA 2WWSA 3QOPA 2FDJA 5JSPA 1POV0 4ATFA 4B4RA 1GLHA 2PN5A 2X5IC 3VUOA 2E31A 1H2NA 2VR4A 4XE9A 1DGWA 4UW4A 1W90A 1PGW1 4DRVA 4LMFA 5FJKA 3RGBA 2FDHA 1JXNA 3PU3A 2DVFA 1CZSA 2Q0AA 1H8TA 2OKXA 3OB8A 2PLV3 1JYWA 2G1MA 4FT8A 2RS32 1L7QA 1O8PA 2XLGA 4QHOA 2YPDA 3S7IA 5J09A 2J1RA 1RITA 4A45A 3WP6A 1S0IA 2E51A 5KXDA 2X53S 3WQ0A 2XJSA 4L8QA 3TNPB 4XF4A 2JDMA 3T1LA 1AL0G 5ERLA 1OH4A 2IVJA 1HW5A 1MS0A 1OF3A 2VM9A 2C6SA 2XLAA 3EHKA 4EN8B 3LPGA 1Y4WA 1Z7S2 2RG4A 2CWSA 4NWVA 4DIQA 4MH0E 1MZEA 3I54A 4LNVA 4JHTA 2W91A 4UBGA 3JZVA 4UF0A 4XF0A 5F6KA 5F5QA 3S57A 2A5ZA 5EV7A 4M4RA 4WVMB 3O12A 5ANQA 1GZCA 4A7YA 4DUVA 2DCTA 4YM0A 2EIDA 3HN3A 3LGRA 1JYIA 3NJZA 3BPSA 4XXAA 2Q8CA 2WAAA 1Q8PA 3M3CA 3ZXFA 5FY8A 5DZGA 1NCRB 2VNOA 2QNKA 3A21A 5GALA 1ZRIA 2GH2A 2KA3A 2P5BA 2WABA 3RJ2X 1CESA 1C1LA 4BYYA 2ADEA 5FMOS 5FPVA 4DNYA 2WT0A 3TEXA 2J1AA 3ZDSA 3KCXA 1NA1A 1LEDA 1V9U3 2ARAA 4UI9L 5FZOA 4YFWA 1A34A 4QKDA 2JKXA 5JSOA 3DKWA 3FBYA 3FMGA 4QMAA 4CDXA 5APAA 1IS4A 4LHKA 3VN4A 4IETA 3RNSA 5LW9A 1ZNPA 4FPHA 3W5MA 4FQ4A 4EV0A 2J1SA 1CIWA 1HIXA 1ZBE3 1UF2C 2QZ2A 4AFMA 1V0AA 2QJVA 2NZ9A 3FX3A 2C9KA 4LUKA 4CRQA 2CYFA 4LKFA 4XF1A 1LENA 3UV9A 2MEV3 2E33A 4MGSA 4IGPA 5GLZA 2EXHA 5CKNA 1HRV3 2W5FA 4AE2A 1C28A 1NOVA 4SBVA 3O1TA 5F3GA 3DN7A 3AMPA 3ZYBA 5EZWA 5C4WC 1GNYA 4ZONA 4MXWA 3D0SA 4GB31 1V6IA 1QH6A 2RM23 1SDWA 3M3QA 5DUVA 5FZBA 4HL0A 4BK4A 3UJQA 3O1SA 5GLWA 3AL5A 3I4IA 5KWRA 1X7NA 2JG9B 2KM2A 3IB3A 5DPNA 1SFPA 4AVBA 4CEWA 1XNAA 3OUJA 1JYCA 2PHDA 1TVGA 2AH2A 2EAKA 3J7LA 1RJ7A 3LAGA 4LBQD 4Y33A 5GLVA 3ZXEA 1UZ0A 2R30A 2JIJA 2RR12 5FZ7A 4ZZ8A 4IXLA 2I45A 1GOFA 3KT4A 3Q8AA 5C33A 4FPEA 1JZ5A 2BOIA 3G7DA 3C7EA 1ZRCA 1RUC2 1F31A 2HWD2 4OI2A 3VD3A 1NLSA 2B42B 4P5YA 2TNFA 3ZFFC 3MDPA 4QB6A 2BTVC 2GSYA 5C8CC 1O59A 4PHZA 4OQ9A 2XOMA 4DQAA 4MGZE 1O4YA 4RYDA 3K46A 5CKQA 4CCKA 4P02B 1AF9A 2D93A 4QGLA 4QPIA 3ECQA 4UFIA 3GYDA 1XE7A 1IG0A 2VY0A 3AP5A 5JZGA 3RZJA 2ZGNA 5KBFA 3WQ7A 2VZOA 2RS51 3PVOA 1D4M2 4KGGA 4LIUA 3N7LA 5FR3A 1V6JA 5DQ0A 3POYA 2WSUA 1PK6A 4XTPA 5AVPA 2LM3A 3I2DA 4WVVA 5FPZA 2VG9A 3KHBA 5CADA 3I59B 1JZ2A 3IAQA 3O1MA 2QQIA 3D0JA 3WQBA 1LESA 2B46X 2PELA 3CMGA 1VP6A 4NAOA 4QX3A 3TWIA 4URAA 5A1FA 5I0DA 4A42A 1OA4A 4LKDA 2DUPA 3WVJA 1X8EA 5GZCA 1CIYA 5JR7B 3IMNA 5JSRA 5HBAA 2XB6C 4RQPA 2VZUA 3PMSA 1DF0A 5IT6A 3OJBA 3EXUA 3H3UA 3KMHA 3GDBA 2YU2A 1EV11 4YZ4A 2ZGUA 3S0MA 2WS91 2ZCWA 2A7AA 3FLPA 3RDIA 2ZEWA 3ZPOA
chains in the Genus database with same CATH topology
2UY9A 2GN3A 3M3OA 1Z78A 3ZSKA 3AMMA 2CY6A 1RUJ2 3WDYA 3VZMA 1TME3 3C3VA 2I74A 3VHOA 4E2SA 1U5YA 1QF3A 3TAYA 2D3PA 1XNKA 2JE9A 4KWJA 3SH4A 1ULEA 3RSJA 1QMJA 1QU0A 3N3HA 1JW6A 2B45X 4S2GA 4B8EA 1G86A 4N43B 5I93A 2W08A 3DUIA 4WVWA 3VL9A 4TYSA 1FYUA 1YJLA 3UKTA 5E89A 4QM8A 3R6SA 1JUIA 3HIFA 1ZZ9A 4PIYA 5IK5A 2XVLA 1ULFA 1ALYA 4FPJA 4FTSA 5HCAA 1WCSA 3FE5A 1MZ6A 1DZRA 1S2BA 2GC0A 1XQNA 4XOGA 4DINB 1NCQC 2R073 4B29A 2PHRA 5K0UB 1QQP1 1W6OB 4Y20B 3GALA 2RMU2 5EFUA 4FAHA 4RD7A 2ZGQA 2HEWF 4D69A 3L9JT 1G9AA 2HJIA 3GBFA 3BOPA 1ASJ3 4Y26A 2WT2A 4LO8A 4FOVA 5FQ0B 1S0DA 4MGKE 1WUVA 4XFBA 3MEPA 5FLHA 1G6NA 3UKNA 2RS12 5H9PA 4GKYA 1QJY3 4WM8B 1AR91 1YIPA 1UZZA 3IDCB 4PDWB 3D82A 5I0TA 1CAVB 3NO8A 4YGEA 4HKOA 3ENRA 3S30A 2WNVC 2VH9A 1I6XA 1HRV1 3ASIA 5ABJC 1C8NA 1AR63 3WP3A 1GKBA 3EQEA 1YWKA 4E27A 1LU1A 3AP6A 4XQ4A 1SMVA 5GLTA 2RM21 1LU2A 2YGLA 1VBE2 3QBQA 2A6VA 3SISA 1EAH3 4BCUA 5H9QA 2C5DA 2TUNA 2QCSB 2HEYF 4MLOA 1H2LA 1LRHA 3N7MA 2Y0IA 4BE3A 1MEC2 3WINE 2Z2SB 4Q4V2 3ZIWA 1J1TA 5KHJA 2JG9A 1HXS3 1YLLA 2ZHKA 2ZTNA 2H6CA 1KRIA 4FOYA 3PJQA 1J1LA 1U5XA 2Y38A 3VZLA 4XDQA 2BUKA 1D2QA 1UL9A 1WMEA 4AWDA 4YW5A 4AF9A 4XETA 1BQPA 1DBNA 3IKWA 4XQWA 4NHMA 5ACA2 4MUVA 3ELNA 5C9AC 1I1EA 1AYN2 1DGRN 4CDUB 3FC0A 4AVCA 4KU7A 4INDA 2XJTA 2TEPA 3INAA 4IERA 4LBOA 3NVCA 1YRZA 1LHWA 1VRH1 2DU1A 3N7JA 3RYRA 4Z1VA 3VKNA 1H2MA 3VV1A 1BK1A 4YFZA 1C4RA 3IWZA 1MR5A 2HWB3 4YVWB 3I59A 1LHOA 5JDBA 2Y0OA 1OA2A 2XVKA 3OBTA 4RGAA 4FO9A 2HKXA 4BQ1A 3GHNA 4IV3B 1W6MB 2NMNA 1KJRA 3ZYRA 3NW4A 3TBDA 4QPIC 3VBHB 2ZGMA 1RUF2 2AR6A 2RS33 4Q8KA 5BNNC 1GBGA 3E6BA 3NAPB 1LB2A 2R32A 3MIEA 2DTWA 5I8SA 3M2MA 4XHXA 3U10A 1HV1A 1UCXA 4XMIA 3MLJA 3WUCA 4JAAA 1IKPA 1QNYA 3NV4A 1APNA 4GH4B 3CJXA 4COUA 1VBC2 2ZOEB 2FZ2A 1Q5OA 5AFBA 3MZHA 1Z7S3 1PO23 1CGPA 3VBFC 1PMIA 3LWCA 4Q8LA 4EN7B 1I5ZA 4Y4YA 4NHLA 1IPKA 2E7TA 4Y24A 4WM7A 3ZFGC 4S2FA 1H9PA 1CJPA 2NQYA 4AVAA 3ZSEA 4RQPC 3WHTA 4E4SA 1YYNA 1N1TA 1BXHA 4K3UA 4IEUA 1RUG1 2ZAAA 1Q3EA 1FV2A 3ZXKA 1UPIA 3JCIA 4YW3A 4ES9A 4H14A 3WDWA 2QVSB 2DVAA 2R49A 4R9BA 5K0UA 1HQNA 1NQDA 1W6OA 2XLFA 3WP4A 2PAEA 4QT6A 4Z92B 3CJIB 2KXLA 2OZ6A 5GM0A 4Q4Y1 4AVTA 5FBZA 1F8VA 4Y1ZA 1QJY1 2E7QA 5FQ0A 3LB9A 4YM2A 3D6EA 3AMHA 4AFDA 1AX0A 3MYXA 2BWAA 2ZAHA 5JIUA 4A3XA 3JBG1 3P3NA 4AGGA 1OOPB 2R1BA 2YMZA 3J8F2 4YM1A 2IXJA 5B2GB 3AX4A 2CNAA 1J3QA 5KHKA 3AYEA 4Q29A 4XFFA 1CR7A 2HWF2 1S2KA 3MPPG 5AC91 4LO7A 1EAH1 2EVXA 2ZMKA 1AVBA 1TQ5A 1N3OA 2LALA 4OHZA 4Q27A 5DDJ1 1SBDA 1WW7A 5C8WA 1SLTA 1RUC3 2HWD3 2VUAA 3BB6A 2WC2A 3LA2A 3AYAA 1WA4A 4RHV1 1NCRC 3HT1A 3CL1A 4FVVA 1QXRA 3KSCA 4G3YC 1PZ8A 1BMV2 2R041 2OVUA 5EYYA 4PIZA 3WDXA 4XTMA 1D4M3 2ZGTA 1K5MC 3GZAA 2FQPA 3AKPA 4RR3B 3ZN4A 1RINA 2YDEA 2YY1A 1W6PA 4P14A 1EY2A 2ZGLA 1HRI3 3MICA 4Q0UA 1NQJA 2XBO2 1RUI2 5FLIA 3W58A 1GANA 1PO11 4QU2A 2Q5TA 1QJX1 4P9GA 3RQ0A 5JI9A 1IQAA 2WNUB 4YGDA 2NN8A 5JAXA 3SCFA 3APBA 2BNMA 3E97A 4XIKA 2WZPP 3TN92 3VKLA 1ND3C 1UD1A 4AXOA 2HWB1 4LBJA 4YLZA 2IWGB 1QH7A 2PHWA 3OBRA 4YW1A 1U5ZA 1O4ZA 1TMF2 1A78A 2Q30A 4YZ1A 3AYDA 4YVWA 1DHKB 5TSWA 2ZMNA 1V6OA 5IK7A 5CB7A 1Q8SA 2EXJA 4IEVA 2JG8B 4LBMA 1COV3 3FHIB 4JGYB 5GJ6A 5J48A 3PHMA 4J1WA 1C1FA 1AJOA 3MIBA 3U4XA 1M06G 1W39A 2H0BA 1AX1A 1W6MA 3JD72 3HBZA 1OQEA 5KXCA 2E6VA 2VNGA 2PYTA 3ME2A 2C0ZA 4CDXB 2A75A 4ZXKA 4NN0A 3VBHA 3PVEA 5I91A 3NAPA 1NE6A 2VOXA 2P3KA 4XW3A 4BZ4A 5LK7B 3BU7A 1PO21 2VMGA 2GC1A 1FPN2 3QACA 1QJU3 1Q8OA 1VBB3 2PHXA 3AZWA 4CZSA 1AR82 3ZPYA 3AKRA 3OPZA 5KHGA 1LOAA 2ET1A 1TE1B 4DB5A 2RMU3 3VKFC 4EWEA 2P34A 2VQAA 3DL3A 5A3LA 4I02A 2AREA 3RZZA 2CAUA 2VOKA 2WZR1 4E2GA 2ZBJA 3UKVA 4OVEA 1FATA 1N1VA 4XJ9A 3HMYA 3N35A 3THPA 1SLAA 1G9CA 4HKLA 2CAVA 3IPVB 1RHI3 3VBOC 3OYWA 2GALA 4YYOA 3ZFEC 1JN2P 1ZRFA 2B7YA 2RS13 4AEDB 1AYM1 1KD7A 2BEOA 3EJKA 3ILRA 2JE7A 1VBD3 4IEQA 4OI4A 1FOD2 4BMBA 2XPJA 1WLTA 2W39A 1PIV1 1RUH1 2JDZA 1FT9A 1C5HA 4FPOB 1H8VA 4N43C 5E16A 3ZYPA 3CJIA 4Q0QA 3FWEA 5T3NA 4I0BA 4TLFA 4ES8A 1OPOA 3ZYGA 1VBE3 3RG0A 4AK3A 2GDFA 4HFSA 1NG0A 4F8AA 4FBFA 1ZVFA 2XVGA 5L73A 4LR4A 1XYOA 1OOPA 3H8UA 4CTEA 3O5SA 3VLBB 1MEC3 4FOWA 1UKGA 1MVQA 4FPKA 3R4SA 4Q4V3 1LGCA 4R4XA 4JCKA 4NHKA 1QWRA 4XFCA 2ENRA 2EF6A 4DZGA 4RHV2 2MPFA 2SLIA 4K9SA 2JKBA 3B3QE 4XF3A 1R1A1 4YNIA 4E4ZA 1AL21 1R091 3MPBA 4PQ9A 2YHJA 4ZU5A 2TBVA 4IL7A 3IT8A 2XWBB 3FZ3A 4N53C 5ACA3 3CEWA 2BFUS 4LTAA 1SFYA 1BYHA 2ZJCA 4UW6A 4L97A 3DGTA 4PLNA 4YVSA 3U07A 1CQ9A 4PJYA 1GQHA 2FMDA 4WM8C 5BXXA 2CWMA 1MACA 4PDWC 1PO12 1DQ1A 4R9DA 2ZACA 3B7MA 3FJSA 4RR3A 2EIGA 1OHFA 1DQ0A 3RMYA 1ZA4A 1QKQA 3H9AA 4MX3A 3AP4A 3THTA 5LEJA 2A3WA 2A70A 1QHDA 2DUQA 1ZYBA 3OY8B 5KHHA 2VW0A 5A32B 2WNUA 3RI8A 1YJKA 3AJZA 1R1ZA 2K2SA 4HETA 1ENXA 3KQRA 2ARXA 4Q4X2 4HKWA 2O8OA 1BBT2 1PVC2 2HWE1 4MZUA 4Q0VA 2VMHA 1RUD1 4PLMA 2BBVA 4K21A 1ENRA 1COV1 2NM1A 2VU9A 1ZBA1 4BH9A 4BM8A 2WJSA 3JUUA 1LOGA 3KCCA 1VBC3 4Z07A 2G9GA 3RMXA 1E57A 2JG8A 3KGLA 4B4QA 3K51A 4JGYA 2WFF1 2O8QA 4I0WB 4Q4W3 5D8AC 4HBNA 4PIXA 4KG0A 1TNFA 2QDNA 1YFUA 3QLQA 2P3JA 4K1YA 4EWDA 4CDUC 5FOBB 4I2OA 1DQ6A 3R4UA 4B3NA 4LO6B 5HXVA 4C0BA 1SLIA 1CAWB 1XRUA 2XWJB 4WZFA 4BA6A 2WLQA 3OGGA 4Z8BA 5T52A 1G8WA 4YGCA 4P9JA 4OUMA 2DTYA 4XJZA 4CEYC 1BEV1 1GV9A 4KGQA 2D97A 2NYYA 2XJUA 4ZKTB 1VBA1 3JQXA 5AFEA 4OULA 4AFCA 3SCHA 4HT1T 4YARA 4OFGA 3ZN5A 2R16A 2D6PA 1YI9A 2RHPA 1C8M3 4CDQA 3LKJA 4P9WA 4K1ZA 3TB0A 4IV3C 4AG4A 1O3TA 2DF7A 3AYCA 1GFF2 1RVF1 1C3HA 1SLLA 3VBHC 3CLPA 1RUH2 1O5LA 1CONA 1H4HA 3IPVA 3MW4A 1QXPA 2ZGRA 1N3QA 3C2UA 3S7EA 4AEDA 4R4ZA 2BVBA 2CL2A 3AZXA 1KFXL 3KM5A 1XNDA 4GH4C 1JUHA 3VDDB 1WMDA 3ZYJB 5L36A 2HWF3 1B35B 4AHXA 1AR71 4Q0PA 1SACA 4LHNA 4M3CE 3VHRA 4IEWA 3HWJA 4QXKA 1GICA 4XFGA 2W52A 3VKMA 1REEA 1U12A 5JOWA 5I0RA 3M3EA 1W2UA 2P17A 4PF5A 2GH8A 2ZZJA 4HZFA 1OMIA 1VB2A 3H0OA 4FPLA 5DZEA 2GZWA 1KDMA 2XL9A 4IV1A 5CFCB 4QQHA 1ND2C 1RUE2 3MIDA 4JGZB 1V70A 2DCZA 1FMD3 1O3QA 3V64A 3VBRB 1DU3D 1H2KA 4A7KA 4W6WA 4GA9A 4KL1A 1HLCA 2HWC3 4UBHA 3JB8A 3R4DB 2XBO3 1RUI3 4LA2A 1S55A 2DUOA 3VBSB 2NLRA 4IEXA 1PGW2 3WW1A 3EBRA 3WP5A 4QPGC 5I0SA 4PCRA 5EXOA 2A73B 1F2NA 3ZXGA 2MHFA 1QXJA 2PLV1 1EPWA 1VLNA 4S2HA 3SMHA 1Q56A 4ASLA 4WM7B 1TMF3 4XEZA 4DPNA 1REFA 2BNNA 4C1XA 3NV1A 4YZ2A 4AHYA 3JQWA 1NY71 1DGWX 1YXWA 4PBOA 1G7YA 1NXD1 4GXLA 1BJQA 5IK8A 3WQ1A 1TNRA 3OY8A 3LSEA 1OFNA 1RUD2 2GC2A 3B00A 1V6KA 3AJYA 5A32A 3AXEA 4W65A 1LHNA 1NE4A 2XH6A 3JD73 5H9SA 3ZSMA 4E2QA 1LR5A 3WXPA 2WFF2 2WLPA 4ITCA 4OZXA 4KBBA 3D4KA 4Y5Z0 3G6JB 4AQ6A 4AQSA 2D6NA 5CIRA 2IZWA 4Q4W1 4G9SB 4A7ZA 1T6GC 1FPN3 5GZDA 1F5JA 4C0HA 1AR83 1H8TC 1V9U1 2PTMA 4OHYA 3NL1A 4JQRA 1R083 4OHWA 4L11A 3N36A 2BFUL 4HVQA 2DV9A 2GMEA 4LE3A 5CFDA 1ZBE1 4NO4A 1X36A 1IOAA 4FPYA 2PFWA 4Q1RA 3T2TA 5CBLA 1LECA 2MEV1 2OIIA 5GLUA 4A2UA 1CAWA 1VBA2 1RMU3 4W6YA 2YZ4A 3L2YA 4GB32 5GZFA 1SCRA 2DU0A 3MLKA 2CGPA 4DXZA 2EXIA 3KCYA 4RGGA 2GAUA 4IESA 1NXMA 2X5IB 1RVF2 4ONUA 5DUWA 5LK5A 4UW5A 1H9WA 2Z42A 3VZJA 1M4WA 1RUNA 1MQTB 2VVDA 1S0GA 4M3CA 4AI3A 3KT7A 5F6LB 3GZTB 1NA1C 3RPQA 3LOBA 4C91A 1JBCA 2I07B 4XIOA 4CDXC 3ZXLA 4CP2A 2A3YA 3AKTA 1OI6A 2GC3A 3HN1A 2R1DA 3OTFA 5FTTC 1ZZCA 1W6PB 1LCLA 1MZFA 2QKDA 4HVRA 4LO4B 4AI0A 5KXEA 2R063 4L99A 2RS52 3LA7A 3ZXDA 4LLFA 5HCBA 5J36A 3VDDA 3WG4A 3WX5A 1B35A 3AKQA 2WA3A 1SQ4A 4XYXA 1DDLA 1WLCA 5DG1A 5JMCA 4P9YA 1VIWB 3ZN6A 3PVBB 2OYZA 1DZTA 3KD4A 3Q9OA 4I30A 4KG8A 3NWKA 3I7DA 3KZ4C 4FXGB 3BOWA 3DPRA 4CEWC 5JLVA 2UYBA 3HT2A 5FFOC 2VECA 2YC0A 1FMD1 4AEDC 2YYOA 3N7KA 1EV12 2IXIA 2WS92 4IEZA 3WR0A 1H4GA 4XBLA 5CFCA 4JGZA 3WV6A 2HWC1 3RJRA 3VBRA 4ASMB 1LGBA 4I0AA 4BPZA 1TME1 3QD6A 5E88A 2E7AA 3UL2A 2MNGA 5JZGC 1OFSA 2DVGA 3GZUC 4HSJA 4BOWA 4ZU7A 3HD8B 3VBSA 5T5JA 3MFAA 5C4WB 4AQ2A 4E4DX 3ZMNA 1PK6C 2ZHLA 1EP0A 3WG3A 3WDTA 1HQWA 3J26N 4D7SA 4UW3A 2A6XA 4XFIA 1KXGA 1Y7BA