1V6NA

Peanut lectin with 9mer peptide (pviwssatg)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6nA00
3AXDA 3WG3A 4TYSA 1LEMA 1WD3A 1BYHA 1VLNA 1HQWA 5GLUA 1UZYA 3WDVA 2FHRA 3JUUA 2D43A 4I30A 3N7JA 4BMBA 4PBOA 2B7YA 4FPGA 1LENA 1F5FA 3ATGA 1DQ1A 3V0BA 5EWSA 1NXD1 3AYDA 5DUXA 3ILRA 4BQ1A 3WUCA 3O0WA 5IK4A 4XJ8A 4ZKTB 4Y1ZA 2PHTA 5CB7A 2JJ6A 3SH4A 2BQPA 2NYYA 2YROA 4Y22A 1C4RA 1N1YA 1LGCA 3RRDA 3PVEA 4M00A 3WDYA 3M2MA 1Q8OA 3T1LA 4AWDA 2ZGNA 1ZA4A 2VUAA 4YW2A 1DQ6A 1MR5A 1QGLA 3B00A 1N3QA 3SH3A 4XMIA 4YGBA 1LTEA 5DUVA 4YW5A 5GZDA 3SH5A 4P9XA 1URXA 1PZ7A 2D7FA 3PVOA 2ZA9A 4FQ4A 2ZGPA 4R9AA 5T50A 1HQLA 4GKYA 2NN8A 1FYUA 4GXLA 5T52A 3WG1A 1MS3A 1NLSA 2ARBA 3ZXFA 3RS6A 1ULEA 1WW5A 2ZKNA 4AGVA 4BLJA 3N36A 4XOGA 3AZWA 4FP3A 1V6KA 1RINA 4LBOA 5KXCA 2SBAA 1Z0HA 5T5PA 1AXKA 4RA0A 5GZCA 1EPWA 1N3PA 5DZFA 4H55A 3A0NA 1B09A 5JOXA 2HYKA 1V6NA 2UWCA 3UL2A 4W65A 4XTMA 3KM5A 4LBMA 3AJZA 4DQAA 5H9PA 1MVEA 1LHWA 3ZSMA 4FPHA 1IS3A 1VAMA 3DGTA 1FATA 5JLVA 5FRAA 4GALA 1S0BA 2W08A 2WSVA 3SITA 4DRRA 3ZSJA 4K1YA 4DFSA 3A0KA 3I8TA 1C1LA 1N3OA 3M3EA 4RL7A 2ZHMA 5HCBA 1JN2P 3ZXEA 1ZM1A 1ULDA 2E53A 5IK5A 4PBPA 1IKQA 1YO8A 2R1BA 1WLCA 1RIRA 1WLDA 3AX4A 4WVWA 1DBNA 2P3JA 2H0BA 3AP4A 2R0HA 4YM3A 2D6PA 4UW6A 1LOEA 4XE9A 2ARXA 3W58A 1LHUA 1J1TA 3WV6A 2ZHNA 5SV8A 1DHKB 3QLQA 1ULGA 4XDQA 4XYXA 4FOYA 4YW1A 1LESA 1SBEA 2E6VA 2EXKA 2ZGOA 4K21A 3FLTA 3IPVB 4FPFA 3PMEA 3AK0A 1AZDA 3ASIA 3LCPA 2I2SA 5CNAA 4D69A 4FOQA 3WCRA 1LHVA 2NMOA 5GZEA 1ULCA 2OVUA 3OYWB 2GDFA 4R9BA 1GZCA 1ENSA 2ZAAA 3AJYA 3B69A 1JYIA 5IK8A 2LALA 3O12A 4Q2FA 3N7KA 4Y1YA 1Q8PA 3UJQA 4HL0A 3WUDA 3IKWA 1MVQA 2E7QA 3INAA 3LSDA 4NO4A 2AREA 4YZ1A 3C2UA 5HCFA 2ZACA 3OY8B 2AH2A 1LEDA 2DU1A 2VU9A 4LBKA 3B9CA 1GBGA 4YZ5A 2GNMA 2OW4A 3AFKA 2D3PA 3MW3A 1V6LA 4Y22B 4Y1UA 3AYCA 3IPVA 1LOCA 2Z42A 3NV4A 4SLIA 5E8AA 1C57A 1JOJA 2ZMLA 1SLIA 2DUPA 1G7YA 4XIKA 3BOPA 4UW3A 2P34A 2WJSA 2GMEA 1F9KA 3NV2A 1DQ0A 5FREA 1SACA 3D4KA 5GLZA 1AX1A 3OYWA 5T55A 5BYNA 1SCSA 4GKXA 2A70A 1KDKA 5T5LA 2ZMNA 1S0IA 1FV3A 2GMMA 2WQZC 1AXYA 5LK5A 1Q8VA 2NMNA 3DUIA 1G9DA 5CBLA 2DUOA 4R9CA 1DLLA 1QDCA 1SFYA 2D6LX 4LBNA 1S0DA 2ZGUA 2VH9A 2OUHA 3VKNA 1DFQA 2ZBJA 3OY8A 4AVVA 1S0EA 1I3HA 1KRIA 1LU1A 3A4UA 2NP0A 3KQRA 4LBQB 2ZGKA 1VAVA 1CQ9A 3N35A 5GJ6A 4YM1A 2ZGMA 2OUJA 1W0PA 1GICA 2A71A 3RQ0A 4XJWA 2ENRA 1QOOA 2A6WA 1WD4A 4FPEA 5H9QA 1G9BA 1RITA 1YXWA 2UU8A 3OBRA 4YFWA 3ILNA 4FPCA 3ZYPA 1DYPA 3FLRA 4JCKA 4YZ3A 4AVSA 1AJKA 2AENA 3M3CA 1HDKA 1N1SA 2YMZA 5GLVA 3MEPA 4Y24A 2JDZA 2D44A 5GZFA 2EAKA 1H30A 5CAZA 1DGLA 4FPYA 1HKDA 3V0AA 1WLWA 2A3XA 2JE7A 5H9RA 1N1VA 1GYKA 3N3HA 2ZGLA 1MS1A 2R16A 2JE9A 2WT0A 3FBYA 4M3CF 1V00A 4Q27A 3VKMA 3OBTA 3POWA 2YV8A 4LBQA 1MZ6A 2GMPA 1WW4A 3WNXA 4XTPA 4YW3A 1G9CA 4GWNA 1ENQA 1AXZA 3JU9A 4ISQA 3HN1A 3AP7A 3R4SA 4P9WA 2DVBA 1G86A 3NV1A 4DRVA 1UN1A 2A5ZA 4UW5A 1Q8SA 1ULFA 1W6PA 1LU2A 4AYUA 1A8DA 1OFSA 2W68A 5IT6A 3WCSA 3N7LA 2ZGSA 1MZ5A 1UMZA 2CWSA 2R1DA 2A7AA 2PHFA 1GNZA 1HLCA 1JXNA 2CYFA 2G4IA 4OZXA 4Y20A 1V6JA 1UL9A 3RMXA 3APBA 1LJ7A 1DQ2A 3IM0A 4C1XA 2VXRA 3TB0A 1GNHA 1MS5A 1LHOA 3O5SA 3TAYA 2DUQA 2V73A 4DPNA 3OJBA 3QCWA 3BODA 1VIWB 4Y1XA 5DZGA 4FPLA 3VKOA 3USUB 4YGDA 2SLIA 4Q8KA 5KXDA 2ZZJA 2ZGQA 4YG3A 5H9SA 4KBBA 5JOYA 1TEIA 1O4YA 4LBQD 3IN9A 1S0FA 4YFZA 1VALA 2Q5TA 4Q26A 2VY0A 2R49A 2GN3A 2TEPA 3FUQA 1JHNA 3WOGA 5JDBA 1MS8A 1DZQA 3O0VA 1CR7A 3CNAA 1S1AA 1IS6A 3MW4A 1APNA 1PZ8A 3AP5A 4AGGA 4XJZA 1D2SA 3MPPG 4P14A 5KXEA 1H9WA 3WG4A 3NWKA 3FLPA 1UPSA 3WHTA 1DQ4A 3PVNA 1LHNA 4XHXA 4HANA 2VW2A 1U0AA 3POSA 3I4IA 3BIWE 2CNAA 2A3WA 4NOTA 1UKGA 5EYYA 2D3SA 1BQPA 1BJQA 4BLIA 5GALA 3T2TA 4AVTA 1LECA 3N7MA 4Q1RA 4PQ9A 3WVJA 1SLAA 2D6OX 1OQ1A 3UJOA 2WSUA 1CPNA 4GA9A 3AYEA 1UAIA 3USUA 3R4UA 5GLWA 4BM8A 1LOFC 1W6NA 5E88A 1W6QB 1GANA 1Y7BA 2D3RA 3W59A 1N47A 4IQPA 3VV1A 2C9AA 2NZ9A 1FAYA 2P3IA 4MYEA 3ZXJA 1SBDA 3U4XA 2NM1A 3AZXA 1FX5A 4U2AA 5JOWA 2ZGTA 5L73A 5GM0A 1WW7A 2DWRA 1QNYA 3GNEA 1GZWB 4YG0A 3ZSLA 5F5QA 1CONA 1BXHA 2PHUA 2WT1A 5DUUA 1SLLA 1QOSA 2A3YA 2EXHA 4M3CB 3WLUA 1UX6A 3HMYA 2AYHA 2ES3A 1ENRA 4Z8BA 2D6KA 3AP6A 4YM0A 3V0AB 1IS4A 4WVVA 2DTWA 4FP2A 2XG3A 1I1EA 5KXBA 2UWBA 2YXSA 3POYA 4FQZA 2UURA 4JC1A 4ATEA 4XMAA 5T5JA 2EXIA 4R9DA 3ZSKA 1G9AA 1GKBA 1SLBA 2DYCA 1WCSA 3WDWA 1JYCA 1KDMA 3V64A 1Q56A 1YIFA 2CY6A 3D6EA 1AJOA 1W6QA 2WT2A 3GALA 4U36A 4F83A 1CPMA 1JBCA 1XQNA 5JOZA 5EXOA 1W6MB 2VW1A 3AXEA 2KM2A 3ZXLA 3WZ1A 1AVBA 1KJRA 2PELA 4YZ4A 4YW4A 5GZGA 4FOVA 5IUQA 1GZWA 4K1ZA 1W6PB 3VUOA 4YLZA 2VW0A 3IMNA 2DURA 2EXJA 4JRAA 4XJUA 4YG6A 1SBFA 4M3CA 1C1FA 2A6XA 4PCRA 1IKPA 3WHUA 4ASMB 3B3QE 5CA6A 3HR9A 1WBLA 4FPKA 2XB6C 5DUWA 1QU0A 2DU0A 5HCAA 1Q8QA 3ZPYA 3M3QA 4Y20B 4ITCA 4XXAA 1AX2A 3OPZA 1UZZA 1FNYA 1YI7A 2DVAA 2P2KA 5DZEA 3B01A 5AVAA 4LBJA 5T5OA 3V65A 4C1WA 1N1TA 3Q9OA 1MS0A 3R05A 4WZFA 1YRZA 3NV3A 5F9TA 1BKZA 4M3CE 2PHWA 1QKQA 3WDXA 3SLIA 1QF3A 1CVNA 1W6MA 1SLCA 1W0OA 2AGSA 5DXDA 3WDTA 4ATFA 1AX0A 3VKFC 2CL2A 4XIOA 4Q1PA 4XBNA 4XHBA 1A3KA 1S0CA 3VKLA 2GNTA 2ZHLA 2YZ4A 2A6YA 1CESA 3ZVXA 2R0FA 1WUVA 1IOAA 1V6OA 2EF6A 4GWMA 3LSEA 2PHXA 1G8WA 2P3KA 2V5YA 3SNMA 2ZHKA 1GZ9A 1DQ5A 1PZ9A 1LOGA 1S0JA 4XBLA 4Y1VA 4DS0A 3ZYRA 4K20A 1G9FA 2DVDA 2E51A 1V6IA 1JUIA 1OKQA 1ONAA 2YY1A 5JVVA 3MW2A 1FNZA 2JECA 1WW6A 1LULA 3T1MA 4M01A 3O0XA 2E7TA 1KJLA 2ZGRA 1MS4A 4UW4A 5T54A 1QDOA 2DVFA 4PF5A 5IK7A 5E89A 3RG0A 1R1ZA 1MS9A 4CTEA 2D6NA 1W6NB 2W52A 2EALA 4YGCA 2DVGA 4XJ9A 2DTYA 2GN7A 3D5OA 3BTAA 4FPOB 1BZWA 2GNDA 1LCLA 2UWAA 4YGEA 1D0HA 2C5DA 1DYKA 1KQRA 4WV8A 2JD4A 4XZPA 5DG1A 1CN1A 1YYNA 4AGRA 3L2YA 4CZSA 1KITA 4FPJA 5JMCA 1SLTA 4Y26A 4ZXKA 1Z78A 3UK9A 3ENRA 2D6MA 2CWMA 3FFZA 1GV9A 4BMEA 2FMDA 1WBFA 4XILA 1W6OB 1H9PA 3RSJA 1JW6A 1X50A 1V6MA 1S0GA 5EYXA 3AZYA 4FOWA 1LOAA 2EIGA 1CIWA 3H0OA 4L8QA 1O4ZA 3PJQA 3AP9A 1A78A 3ILFA 4YZ2A 5DG2A 2PHRA 4XXPA 1F31A 4ISRA 3WDUA 5GLTA 2ZMKA 2LTNA 4P9YA 1QMJA 2GNBA 2JKBA 1QOTA 4LBLA 2RHPA 2ZABA 2AUYA 3FUOA 2GALA 3AZVA 3RMYA 3V0BB 3M3OA 1CJPA 2A6ZA 2ERFA 2P37A 2WKKA 4FVVA 2WNEA 3ZXKA 1FV2A 2W39A 2WLQA 1GSLA 2AR6A 4CRQA 4TZDA 1LOBA 4XJAA 4BOWA 1DIWA 4XBQA 1LODA 3WG2A 3M1HA 1AF9A 1SCRA 2A75A 1W6OA 1LGNA 2DV9A 4YM2A 1MACA 4Q8LA 3SISA 3OGGA 1GLHA 1IS5A 1LOFA 2A6VA 2CTVA 1QNWA 3AYAA 4BPZA 3AZZA 1LGBA
chains in the Genus database with same CATH superfamily
3AXDA 2BFUS 2XUEA 1PK6B 1OH4A 4CDUB 1VLNA 5C4WB 1ZBA2 5GLUA 2FHRA 4H7MA 3TYJA 2D43A 4I30A 4A7KA 1OH3A 3AL6A 1BHGA 1OKOA 4PBOA 3VBUB 1LENA 3ZN5A 1ZZBA 3DYPA 4N53A 2F6BA 3OBAA 5EWSA 5F1RA 2R043 1OLQA 1WLTA 3ZIXA 4BQ1A 4OMDA 4Y1ZA 2PHTA 1PM7A 2JDUA 1ZBE3 5CKNA 1FOD2 1YFUA 2XKPA 1C4RA 4N43B 1RUNA 1GP6A 1LGCA 3MF6A 2B5HA 5J48A 5FZBA 3HN3A 3T1LA 2ZGNA 4YW2A 1DZTA 2K46A 1PO23 1NA1A 4XMIA 2VD7A 5FQ0B 4BQWA 1AR63 5A7WB 4FTEA 1PZ7A 1IZ3A 3WD5A 2OIIA 1AL0G 5T50A 3AC0A 4GULA 5T52A 3VBSC 1MS3A 5C9AB 2QVSB 3PURA 1SPPA 4LO7A 3IDEA 4KU8A 2ZKNA 4W8JA 3FMGA 5CISA 2R042 2O14A 3N36A 2J1TA 1RINA 5KXCA 1ZBE2 4XFCA 1UIJA 1AXKA 4RA0A 5GZCA 3I2HA 5FTTC 2JIJA 2CU5A 2UWCA 4A6SA 5J36A 1ND3A 3KM5A 4LBMA 5A32B 4DQAA 1MVEA 3ZSMA 1PO22 3DPRC 5JR2A 1M4WA 4D6QA 2B9UA 5FLJA 5FRAA 2BWAA 4GALA 4IEQA 2W08A 2WSVA 3PU3A 4EN0A 5BNOC 2QQOA 3SITA 1TVGA 3T4VA 4S2DA 1DZRA 2XONA 3LAGA 4JQRA 1F2NA 2YC4A 4CYDA 4LK6A 1ULDA 2E53A 2EIEA 5A3PA 2CHHA 1RIRA 1WLDA 3AX4A 1COV2 5AC91 4NHLA 4KU7A 2D6PA 1VBC1 4IETA 4XE9A 2G1MA 4OHVA 4XF3A 4AEDA 2ZX0A 2DCTA 3WF1A 2OS2A 3M3IA 3CQOA 3LKJA 4MVTA 4IEXA 4KWUA 1QJY3 1A34A 3WNNA 5AFBA 1SMVA 4QKBA 3WX5A 1S4CA 2RR13 4COZA 1LESA 2E6VA 4NMIA 1HW5A 3H3LA 4AEJA 5I0DA 1RJ8A 5FZ4A 5KC6A 1T6GC 4ARYA 1UZVA 2D5FA 1R64A 4HONA 2BNOA 5FR3A 3AK0A 4LUKA 4K7JA 2I2SA 1XNBA 5CNAA 4RFT0 4BK5A 1RXGA 1AL22 3WCRA 1GUIA 2NMOA 5GZEA 2OVUA 4R9BA 3D0JA 5LA9A 5L9VA 3N7KA 3GJAA 4CXWA 3J26N 2JG8B 3E5QA 1Q8PA 1NCRB 2FBEA 1OFNA 3E6DA 3WUDA 1RL3A 1MVQA 3OEBA 4NO4A 4OUSA 4QT6A 1CX1A 5HCFA 4MLOA 5KWRA 3QBQA 1H1IA 2AH2A 1LEDA 4LBKA 3B9CA 4RGGA 4FO9A 4YW7A 1PNFA 2GNMA 5BV6A 4NHXA 4IERA 2D3PA 2HWD2 2RR12 1MZFA 4Y22B 3AYCA 4YVSC 2Q8OA 2RJLA 1OQDA 5IFTA 4G4FA 2WFF1 2HWC3 1OVSA 2VULA 3VBOC 4BISA 5A6ZA 2VQ0A 2ZMLA 3VL9A 1G7YA 4CDXB 3K4AA 1POV0 4QM9A 1DQ0A 3D4KA 3ZN6B 3OYWA 1YWKA 5T55A 5BYNA 4GKXA 1ODMA 5JSPA 3M70A 4JTNA 3AVSA 2HWE3 5T5LA 5LASA 2GMMA 4WM8B 5LK5A 2NMNA 3DUIA 3S57A 5CBLA 4R9CA 4QAWA 2I74A 4QGLA 4UFMA 1DLLA 1QDCA 4LTAA 4HXCA 2ZGUA 1YEWA 2N7GA 3CLPA 3VKNA 3OY8A 4L99A 1S0EA 4LIVA 4PF1A 4ZS2A 4MXWA 1K5JA 4B4PA 1LU1A 2ZEXA 1AR61 4NAMA 3A4UA 1J59A 3LDBA 1W8HA 3N9NA 1VAVA 3ZIWA 1DG6A 3ON7A 1XNCA 3O1SA 2OUJA 2FDJA 5A6XA 4CE8A 4QKDA 2A6WA 5H9QA 4FPEA 5EP9A 3SEEA 5BPXA 2PXJA 1GR3A 4YFWA 3C7HA 3ILNA 4GB33 1RUE1 3ZYPA 1YIPA 1EY2A 2JENA 2XJTA 3FLRA 4YZ3A 3OD4A 3GYDA 1U12A 3MI8A 4Z82A 3QD6A 2HWE2 2J7MA 3MEPA 4Y24A 1OLMA 2JDZA 4K8FA 5GZFA 5J3UA 4CDWC 1D4M1 4HLTA 5F32A 1RUG3 3KV5A 2IXLA 2CGPA 5J1XA 1V9U3 1HB1A 2A3XA 2JE7A 4C8DA 2ZGLA 4A3XA 4J6GA 4M3CF 2JE9A 3ROUA 5IFPA 4QGMA 4BQ4A 2MEV3 2HEYF 2YV8A 3C7FA 5C8CB 4LBQA 2RM23 5KHKA 3WNXA 1ZZ8A 1PGW2 2NQYA 2E33A 3PL0A 4YW3A 2Y60A 1W3XA 4BZ4A 3POBA 3ZYIB 5FPXA 1AXZA 1NE6A 2IVIB 2D93A 3H8UA 2VZ3A 3AP7A 3I7DA 4J1XA 1G86A 2WC2A 4C90A 5HXMA 1JYNA 2IXIA 2FD8A 4GB32 4UFHA 4E4DX 3OD0A 3TNPB 5FFOC 4K40A 2B42B 4NHMA 3I2FA 3VBSA 4G3YC 1PIV3 5IAVA 1YQ6A 2BYVE 4H3WA 1QJY1 2TBVA 1VBD1 1ASJ2 4EZHA 2CWSA 4PDWC 4HT1T 3KGLA 1RUG2 1JXNA 1V9U2 2CYFA 1YHFA 3AKRA 3NJVA 2G4IA 4HKWA 4Q0UA 2VUDA 4QHOA 1W8ZA 4OZXA 5KC5A 1V6JA 5EJ3A 2WS93 2OPWA 1DQ2A 3IM0A 2MEV2 4Y4YA 4Q4X3 1MS5A 2RM22 1LHOA 4IEUA 4IE7A 4AR2A 1O3QA 4CEWC 3LD8A 2DUQA 3FC0A 4KWLA 1O91A 5J96B 5FJKA 2TUNA 1CJDA 2R061 3DPRA 3GHNA 4Y1XA 1IG3A 2XJUA 3V56A 4AI8A 1X8MA 5JXIA 4YGDA 3GCXA 5BNOA 1HB3A 2WRAA 4I3PA 4E4HA 2QQLA 5I0UA 2XJVA 4YG3A 4KBBA 5JOYA 5HXVA 3MYXA 4MGKE 1O4YA 5F3EA 1PIV2 5L9BA 4XUNA 2FDKA 2HWB3 2Q5TA 2R49A 2TEPA 3P3NA 3WOGA 1MS8A 3FJSA 2ATFA 4LPLA 4RS5A 1CR7A 1EUTA 1VJ2A 3CMGA 4ZPIA 2VOVA 3FHIB 3JB8A 3AP5A 3OCPA 4YVWC 4AVAA 2PLV1 2WWJA 4P14A 1H9WA 3WG4A 2HWC1 2WS92 3MGUA 4HANA 2VW2A 1FPN2 4CUCA 3BIWE 4Q4X2 1UKGA 4XETA 5EYYA 5C3PA 2VZRA 4YARA 1JYWA 5GALA 4AVTA 1LECA 3WT3A 4Q1RA 1O5UA 1RMU1 4J25A 3WVJA 3UJOA 1X9PA 1YLLA 4GA9A 4MGZE 1UAIA 1UNBA 3ACIA 3KB5A 1ULPA 3USUA 4BM8A 1YQ8A 4I09A 4O9EA 4B4RA 1LOFC 2VECA 1M06G 3W59A 1XSRA 4CUGA 2GC0A 3BOWA 4LLFA 1RUD3 2OZ6A 2P3IA 2ZCWA 1VB2A 3HIFA 3HNYM 4QQOA 4RSUA 3ZXJA 4IV1A 2NM1A 2HWB2 3AZXA 4QX1A 5FXXA 1OC1A 4A6OA 2ZGTA 1JODA 5GM0A 2ZXQA 1WW7A 2PMWB 1JZ3A 1GZWB 3KCYA 4MO3M 4LHLA 3ZFEB 2WT1A 1PGW1 2EXHA 4QB1A 1FMD3 1GOFA 1CAVA 4K9SA 3RZZA 4Z8BA 5CFCC 1QHDA 4D8MA 2DTWA 3J7NA 5FZ0A 2XG3A 5KXBA 1CZTA 2VMCA 5FZ6A 3POYA 3RPQA 3OBZA 4AAPA 5FZIA 1X36A 5K7PA 4XMAA 5FPLA 3LDRA 1AYN1 5FLHA 3RFRA 2JXAA 3ZSKA 2E26A 3I2OA 3PMSA 3VBOA 5IVJA 3TNQA 4D3WA 5IVBA 2VO5A 3O1RA 4OHYA 1XNKA 1ACCA 3ECQA 4LJHA 2D5HA 1W6QA 3CHXA 3JB4C 5JIUA 1UU6A 1RUD2 2ARAA 5FZHA 1W6MB 1UIKA 4LKDA 4DUWA 3P1IA 2VNRA 1EAH3 1EP0A 2H6BA 3DV8A 5DAWA 3ZXLA 1AVBA 4BQXA 2KR2A 3OGJA 4MGSA 4C0BA 4EN6B 1JOPA 4FOVA 3M8LA 3U11A 1HN1A 4YLZA 3BCWA 3RWNA 3WF0A 3WW2A 4YG6A 1SBFA 1TME3 1LAJA 4JAAA 3IBMA 5FYTA 4ASMB 1J84A 5CA6A 3HR9A 1TMF3 2C9KA 2XUMA 3WNPA 1WBLA 4FPKA 2XB6C 4WM7C 2DU0A 4AQ6A 4URTA 5F5IA 4BJ0A 2LUWA 4QQ2A 4J1WA 1BBT3 1NZIA 3EB7A 1NAEA 5AVAA 2P2KA 4RQPC 5DZEA 5FMOS 3JD73 3HBZA 1UF2C 5FUPA 4WZFA 2VAUA 3T30A 1G6NA 2PHDA 5F9TA 1OLME 1BVVA 1QKQA 2XVGA 1GWMA 2XJRA 1CVNA 2PA7A 2AGSA 2X29A 2VE1A 3VDAA 3FFQA 1EAH2 2FCUA 2WNVA 4JGYA 4NIHA 2YFZA 4GH4C 1UYPA 2VXJA 4Q1PA 1S2KA 3RZMA 4JKMA 3N9LA 4NR1A 3VKLA 1ZVFA 3HJRA 4CDWA 1TME2 3IZOA 3LGRA 1TMF2 2HEWF 4D7YA 1EYBA 4AHWA 2PHXA 1G8WA 2GC2A 1NZCA 3SNMA 3W5MA 4X8NA 1BBT2 1PZ9A 1IPJA 1S0JA 4XBLA 1OA3A 4AHYA 4DS0A 2PAMA 2DVDA 2E31A 5A70A 3E97A 1F15A 1ONAA 2EICA 4NJ4A 1CAWB 2Q0AA 1WW6A 3JD72 4M01A 2Y0IA 4XF1A 1J3RA 5K4LA 1AR73 1U5IA 4UW4A 1MEC1 4HVQA 4I2OA 1Q5OA 2Y38A 1PVC3 5T54A 4IV3B 3OSDA 5A3WA 4IGOA 4CCNA 4YGCA 3MFAA 5CVRA 1FXZA 2Q4SA 3BTAA 2FMYA 1BZWA 2C26A 4UBHA 4HSJA 3NRUA 5L7OC 1H2MA 2Q30A 2C5DA 2HJIA 2W1UA 1DYKA 1K5MC 1H2KA 5CG8A 4QMAA 5A33A 1BK0A 5DG1A 3FX3A 4AGRA 2ORZA 1SLTA 4Y26A 1S2BA 1C8M2 1Z78A 4EJRA 4OLLA 2VZVA 4LHSA 1W9YA 1KS4A 3OUIA 3UK9A 4CEWA 4FTSA 2NLRA 2XMLA 4RGKA 2B45X 3N9PA 4HK8A 5IVFA 3J8F3 5K8SA 1T6BX 2FMDA 5A7PA 3VBHC 1AR72 1RVF1 1PVC2 3POGA 2VR4A 4FOWA 1O4ZA 1NQJA 3PJQA 1FMD1 2BNNA 3ILFA 5D8AA 4YZ2A 5CU1A 5DG2A 4XXPA 5FBJA 5FP7A 1F31A 3H8XA 3T2OA 1JZ7A 4NN0A 3VBFC 1QQP3 2X5IC 3RZGA 3NJXA 1POV3 4N53B 3AZVA 3RMYA 5FZ1A 4YVWA 2A6ZA 1CAUA 3OGSA 4Z92B 3ZXKA 1DGRA 4AI9A 3BPSA 2W39A 2W94A 4XF0A 1GSLA 3H8OA 1LOBA 4XJAA 1DIWA 4XBQA 5EQUA 5EIYB 3J8F2 5F6KA 5LEJA 2RMU3 4TXWA 2A75A 2TNFA 5FZOA 1LB2A 1MACA 1GMMA 2WQ4A 3SISA 3TOJA 2RS13 4YNIA 2HBUA 1GLHA 1LOFA 4KI5M 5I0TA 3AYAA 2ADEA 1LGBA 3OF1A 1X8EA 3WG3A 3G6JB 1LEMA 5DAQA 1UZYA 2QQNA 3WDVA 1ND2C 1REDA 1QQP2 5A3LA 5JI9A 5A6YA 1F5FA 2G9GA 4KG8A 4CVUA 1JZ2A 2VNGA 3V0BA 1AR83 4JVAA 4A4AA 4NRQA 2P4EA 5A80A 1R082 2XL7A 4MGTA 4R8HA 3AYDA 5DUXA 3ILRA 5CFCA 5J09A 3I3BA 2W9XA 3O0WA 2C6SA 5FWJA 4E2GA 5CB7A 2JJ6A 3VLBB 2YROA 4EE2A 1ZX5A 4E2QA 3T08A 2K2SA 1N1YA 2J1SA 2RMU2 3WDYA 5ACA1 3M2MA 1Q8OA 1ND3B 3KV4A 3QOPA 2VUAA 3WEZA 4XURA 4JHTA 5DDJ1 1N3QA 4AXOA 3SH3A 1POQA 1Y9QA 1RUH3 4AFAA 5FZGA 4EWAA 4IEPA 5IVYA 2ARCA 2IFWA 5DUVA 3SH5A 3K75B 2JDHA 4P9XA 5FV3A 1JZ5A 2ZA9A 4FQ4A 4R9AA 4IEYA 4GKYA 1FYUA 4GXLA 2VBBA 5C70A 2ARBA 3OPWA 3ZXFA 3NJYA 4NHYA 5IVVA 3RS6A 2F4PA 4Q0SA 2ZAHA 3LFIA 4BXSV 4JX0A 1WCDJ 2XLGA 3LA7A 4AGVA 4XOGA 3AZWA 5C3QA 4WM7A 4NRMA 5CIRA 4AEDB 3BVCA 1W9SA 3ZPOA 4RD7A 3NJZA 3MFCA 3GHMA 1KEXA 3LZZA 2C0ZA 4PHZA 1L7RA 2RS51 2HYKA 1V6NA 5JOXA 5K0UC 1NCQC 4W65A 4QX2A 4R4ZA 4MV2A 1CAXB 2XVLA 4BWOA 5JLVA 4QGNA 1YQ2A 3VDDA 4DRRA 4K1YA 4DFSA 1H1MA 2VOKA 3RYPA 2E7AA 1C1LA 2PN5A 4GH4A 5L9RA 4NUBA 3M3EA 2WZPP 3DKWA 1JN2P 4JGZC 4PIYA 5HCBA 3ZXEA 2C4XA 4XUQA 2R1BA 3K46A 4UFJA 3SC7X 5SV5A 3UNPA 2P3JA 2QQUA 5A3NA 1QXJA 2OYZA 4W50A 4M0NA 3W58A 1J1TA 1UY2A 2QQJA 5EJ1B 1JZ8A 4I01A 5JZGC 2OZJA 1DHKB 5AFEA 1KFXL 4OI4A 1JH5A 1P8JA 4XYXA 1ZRRA 4FI9A 4N7UA 2VZUA 4DUXA 3FLTA 5AC93 2QUOA 1VBC3 5FPZA 4QKNA 1AZDA 4NHKA 3ASIA 4JV4A 5A6QA 1CZVA 2XQXA 3A7QA 1WMXA 2Y6GA 3KLSA 1H8TC 2GDFA 3OYWB 5FYCA 2BJSA 1OURA 2QQMA 4RR3B 3B69A 1H4GA 2W46A 1AUYA 4Y1YA 1GOGA 3G7DA 3K2OA 3HPNA 1K5MA 2JDPA 3HNBM 1PX4A 4HL0A 1PX3A 1YJLA 4NROA 3UJQA 4ASKA 4TSVA 3INAA 2XLFA 3LSDA 5DQ0A 1ALYA 4IXLA 4AW7A 3C2UA 3LEIA 3OY8B 1S55A 4ZY9A 2RS11 2VU9A 2ZX1A 3KT1A 3LE0A 1GBGA 4CCKA 3NNFA 1XSQA 4E9KA 1KFUL 3D8CA 1XRUA 3NAPC 4QQHA 5FP4A 4Y1UA 5AC92 2Z42A 5EZWA 1VBC2 3VN4A 2BOIA 4BQ5A 2KD7A 3VBHA 2ETEA 3WQBA 1K42A 1C57A 4TLFA 3GDBA 4XIKA 3ABZA 3KF3A 1AR81 1GP4A 2WA3A 1VMFA 3PJYA 5GLZA 4JKLA 5FREA 2F17A 1AX1A 2XL9A 4CDQC 2BVVA 3NNJA 3USSA 1IGOA 3VBFA 2ZMNA 2X5IA 5FMBA 1FV3A 3BTYA 1AXYA 1Q8VA 2WFF3 2DUOA 4PQQA 4LBNA 4QXKA 1C28A 1VBB1 1S0DA 3VDBA 2VH9A 3RZLA 4QDQA 2ZBJA 5DPNA 3VZKA 2BWCA 4QD2A 1I3HA 2PAKA 3VZOA 3ACLA 1JHJA 1RUH1 1SFNA 5ISLA 2DCKA 4H2AA 5LBCA 2NP0A 3KQRA 4LBQB 3P3PA 1QJEA 5JI7A 2ZGKA 3VZMA 5IYYA 3OB8A 1Z7S1 2ZGMA 1UU4A 2JD9A 2A71A 3AKSA 3RQ0A 2ENRA 4ET7A 1NOVA 1RITA 4YRDA 1PK6C 4AHXA 3W9AA 3FL7A 4JCKA 4KQ7A 3U10A 3UKVA 2AENA 1ND2A 2BZDA 2YMZA 3C3VA 3P6BA 3H7YA 1W0NA 2WFF2 3GBWA 2XH6A 4AZZA 4WZCA 5A3UA 5FY8A 3FHQA 3V0AA 4HFSA 2YHJA 2MNGA 2VTXJ 4QXCA 1RUE3 2ID4A 2VGDA 5D2AA 5H9RA 4XPVA 4UFKA 3OG2A 2ADDA 1MS1A 5B4XA 3VKMA 3OBTA 1UWWA 1D2QA 2YUEA 1MZ6A 4QQPA 1JYTA 4XTPA 2WO7A 3ZYHA 3EYPA 1D4M3 1ENQA 3JU9A 1UY0A 4L97A 5FMDA 4ISQA 4Q0QA 3R4SA 4P9WA 1RUF1 1LKNA 3ACHA 3DPRB 4HPKA 4Z2AA 1ZRDA 3B93A 1DGWA 4WVMA 2WAOA 2ZJCA 1QJU1 1CGPA 4CP9B 5BNOB 1US2A 2GAUA 2Z5WA 4FFFA 3U75A 1AR62 2IVJA 2NPIA 5C9AC 4MGYE 1V0AA 1ULFA 1W6PA 1LU2A 2GU9A 3C7EA 4FXKB 5F6LB 5I8SA 1AR91 5LZ6A 3A21A 2VQAA 3UESA 3WCSA 1YI9A 3AKTA 2WNOA 3H7JA 4RS5B 5FPUA 5I91A 3RZHA 4ZXEA 1GNZA 1HLCA 5FYMA 4CP0A 1F5JA 2RDNA 1Y43B 2O8OA 1RUE2 1OI6A 4Y20A 1UL9A 1H1AA 1OVPA 2JG9B 4EN9B 4C1XA 2DBNA 5LEKA 4AEMA 2VOWA 3FE5A 3JQXA 2YBKA 5FYYA 2BBAA 2ZX4A 5M0TA 1VBD3 1D4M2 2P17A 1NCQA 4DPNA 3U14A 2JEMA 3ZYGA 3LEMA 4A2UA 3NSTA 1OUXA 3PVBB 5CKQA 5LY2A 1SFPA 3VHPA 3USUB 2SLIA 1OQEA 5IW0A 5KHIA 2ZZJA 4BU2A 4QM8A 2IZWA 3WNMA 3K48A 4CCCA 3BN6A 2GH8A 3IN9A 4IV1B 4JGZA 1S0FA 5FY1A 2BGOA 4Q26A 1EV11 2YPDA 2W0XA 1PGL2 2WNUA 3IDAA 1JHNA 5F39A 3RI8A 1UOFA 2R063 3CNAA 2WZR1 1IS6A 2VJXA 3MW4A 1PZ8A 4LITA 2ZEZA 4A3ZA 2YBPA 5ABJC 5FO7B 1CAVB 3MPPG 4BYYA 1HJGA 5KXEA 2YG0A 1UPSA 1US3A 1LHNA 1VE0A 3PVNA 2LM3A 2WL1A 3FN9A 2CNAA 2A3WA 1GQPA 1QJFA 2D3SA 1BQPA 1PM4A 3LEGA 1BJQA 1QJY2 1VBD2 2Q8EA 5IWFA 1WKYA 4PQ9A 3TEXA 2PYTA 3ZR5A 4QU2A 1K45A 4LKFA 3URFA 4D94A 5JWPA 2WSUA 3T09A 3WP3A 1E5IA 2PLV3 4KH9A 2WN2A 3WQ7A 3O1TA 1W6NA 4QPGB 5E88A 3LPGA 1W6QB 1GANA 4UF0B 4IQPA 3VV1A 2C9AA 5TSWA 1FAYA 2VMIA 3I54A 4GJZA 4BA6A 5FXZA 3MPBA 1H8TA 1O5LA 3GZAA 3MLLA 1PHMA 4MOAA 4U2AA 2LW8A 1RUI1 1RHI1 1RMU3 2JG8C 3NVCA 5L73A 1RUC3 2CSGA 3VD7A 2X05A 2R062 3J7MA 3BU7A 2HLEA 4JDOA 2PHUA 2RDSA 2YU1A 2Y6FA 2A3YA 4IEZA 2YC2A 4XQWA 4P9LA 1HJFA 1UX6A 2AYHA 3IAPA 4BIOA 2R7EB 2WIIB 2XLAA 3MIGA 1VB4A 4WVVA 2Q8CA 4FP2A 1NY71 2UY8A 2UWBA 2WN3A 2YXSA 3NAPA 1VMHA 4I0AA 2UURA 4IE0A 3LWCA 2VMGA 1FI2A 2EXIA 2Z2SB 4R9DA 5EHDA 5T5JA 1GKBA 1SLBA 1XC6A 2DYCA 5C8WA 1QJX3 4CDXC 2PLV2 2HWC2 3V64A 2ET1A 1Q56A 2XBO3 4B1LA 1AJOA 3POEA 4IUGA 1ZRIA 3BU0A 1XQNA 2AEYA 1XYOA 3PIJA 3KQ4B 5EXOA 1JTZX 3MUZ1 4JGYB 4CDQA 2WNVB 2K9ZA 3AXEA 4WM8C 3WZ1A 3D3AA 1KJRA 4YZ4A 1RMU2 1AYN3 4TN7A 3KVAA 1IG0A 4AI2A 1ENXA 4K1ZA 1ULOA 3IMNA 4JRAA 5JCTA 5FO9B 2RG4A 5C33A 4PCRA 2VPVA 4LHKA 4IL7A 3ZYJB 5IVEA 2O1QA 3R4DB 5FZ9A 3LPFA 1R1A3 1QU0A 5KR7A 3EXUA 4ITCA 2YC0A 2ZKLA 1AX2A 4TLGA 2AZ5A 5F3CA 5T5OA 4LNVA 3I97A 1N1TA 4LXLA 4NWWA 3S5QA 3W5NA 3R05A 4COYA 2AC1A 5T3NA 4XFFA 2DDUA 1GZTA 4QX8A 4IE6A 2BPA2 4M3CE 2PHWA 3NKGA 3DN7A 3SLIA 4P9IA 4NE9A 3SXWA 2QNKA 2WYSA 1AX0A 2X8KA 3VBRB 3O1UA 3AVRA 1AYN2 4XBNA 2BU9A 5FYBA 5FO8B 4JRLA 2CAVA 3M4FA 1DDLA 1UX7A 3T0AA 3ZVXA 4A44A 2R0FA 4HVRA 1IOAA 1V6OA 5DAPA 5A33B 3LSEA 3HT1A 4ZU5A 5C8CC 1W04A 2P3KA 2FCTA 3HD8B 4Y1VA 2VCCA 3UGGA 3IT8A 3CIHA 4P02B 4X8PA 1WCKA 1Y4WA 5A3MA 1G9FA 3BIEA 3LA2A 1JUIA 1OKQA 3H1YA 5JVVA 2BEOA 3PUSA 4ATEA 5FZDA 5FOBB 3DYOA 3O0XA 2BNMA 5FQ0A 2ZGRA 4UT5A 4ZZ5A 3PUAA 3WINE 4ES8A 2DF7A 1QDOA 2DFCA 2BDRA 4PF5A 4V2VA 3HOBA 1R1ZA 3CJIB 4KWJA 3ALQA 3GJBA 5E89A 3RG0A 3MHZA 1W28A 5D8AB 2XDVA 2EALA 2DVGA 3AKQA 3VD5A 1W9TA 4XDOA 2DTYA 3DL3A 5IAXA 1IQDC 4PLMA 4XF4A 2GNDA 2IC1A 3ZXDA 1X33A 1LCLA 1KGYA 2W3JA 2MPFA 1QY4A 5DN2A 1CWPA 2VBDA 1RJ7A 1KQRA 1MEC3 3EJKA 3FHAA 4WV8A 4FSJA 2UY9A 4GWJA 3KSCA 1CAUB 1W8WA 1WCQA 1YYNA 4YVWB 4C0HA 3PTRB 4FPJA 3ETPA 4D6RA 1RYYA 4M4PA 4N7IA 4XUPA 2J1RA 2D6MA 2R071 1J58A 2CWMA 5A32A 5C5UA 2D97A 1GV9A 3OUJA 4BMEA 4ZHNA 3OEAA 4XILA 1WBFA 1OT5A 1H9PA 1RUC1 2XJSA 1JW6A 5LWBA 4MX3A 3AZYA 3LIHA 1LOAA 4L8QA 1CIWA 3H0OA 5EYXA 1HRI3 5JR7B 2QDRA 2Y0OA 4C91A 3IB3A 1O6UA 3PUHA 4CA9A 3W20A 3N9OA 5GLTA 4P9YA 3RWKX 4LQRA 2GNBA 2JKBA 4AFDA 4AQSA 5BY5A 2ZABA 3O1OA 1CX4A 1MEC2 1SG3A 2CGNA 1RVF3 2GALA 3KWVA 3V0BB 5ABJA 2P37A 1YFXA 2P5BA 4HKLA 2WNEA 2CAUA 4KWKA 2VZTA 1QJX1 5FZCA 4N9HA 5I0RA 2XBO1 3PTYA 3IDBB 1NLRA 3CDZB 3WG2A 3PIGA 1AF9A 1SCRA 1W6OA 2DV9A 4YVSA 2RVAA 4Q8LA 3TEZA 4WBBA 3RVHA 3K51A 3OGGA 5C7GA 2XQRA 1IS5A 4QQLA 1GWLA 4BPZA 3MIDA 2DCYA 4TYSA 2BGPA 3THDA 5FUIA 1X9TA 5J37A 4HETA 3LIGA 3WF4A 3H3ZA 1R1A1 5A1LA 2JG8A 3JUUA 3LA3A 2P6CA 1W8TA 2V4AA 3N7JA 3MICA 4QPIC 2B7YA 4OHXA 4QPWA 3AMQA 3ATGA 1JOBA 1U5XA 1RVF2 2YU2A 1HXS1 4UBGA 1FMD2 3T3YA 2Z4FA 3AMNA 2WUHA 4WM7B 4XJ8A 1QXPA 5FZAA 2YGLA 3HQXA 3ZXAC 5BNNB 1J3QA 2NYYA 4Y22A 5LB6A 3CU7A 5FYVA 3VZNA 2VG9A 4NRPA 2J1EA 1ZZCA 3IMMA 3DECA 3PVEA 4M00A 3ZXGA 1VBA1 2OA2A 1W2TA 4QB2A 4LHNA 4N8MA 2VMHA 2YYOA 1ZA4A 5FWEA 3UKNA 4CDXA 1QGLA 2YGMA 1XE7A 4UAPA 3ZN6A 1LTEA 3DEMA 5A7SA 4EV0A 1REFA 5GZDA 5G05L 2VOXA 2D7FA 3VDDB 2HH9A 1WWYA 2CDPA 2ZGPA 2P3YA 4Q5OA 4WM8A 4BIFA 1HQLA 4Z2WA 2FZ2A 2GC1A 2D98A 2NN8A 3PUIA 5FXWA 3WQ1A 3ZMOA 3NQHA 5ACA3 5FY9A 1U5ZA 2J1AA 5DDJ3 5B2GB 1X82A 3KV6A 2JDYA 2VVFA 2WYFA 3AMHA 4G9SB 4FP3A 1OSGA 4QX5A 4S2HA 3DF0A 1V6KA 3SCHA 4URAA 4O61A 4LBOA 4LLOA 2SBAA 4OUEA 2WQ8A 2DCZA 5T5PA 1E5RA 3B9IA 2B4KA 1UY4A 4QKFA 1N3PA 1R091 4H55A 4LK7A 5IJRA 3UL2A 4XTMA 2ZZQA 3BB6A 3E6CC 3AJZA 4QHBA 4FPHA 1FATA 4AI1A 5FDBA 4W6YA 3MDPA 1UPIA 3A22A 2WWUA 4LA2A 4Y5SA 3ZSJA 2BOJA 3I8TA 1N3OA 2H0VA 2VMEA 2FDGA 2FDFA 2ZHMA 1ZM1A 2RS53 3JXSA 5ACA2 3B94A 1IKQA 4WVWA 3U0ZA 1OUSA 1DBNA 5DDJ2 4UWDA 2H0BA 3WF3A 1K5MB 3AP4A 2R0HA 4I3GA 2ZTNA 4PDWA 4OZOA 1LOEA 1WA4A 5JPNB 1LHUA 5E1RA 5C8CA 5EJZB 4OUMA 3FWEA 3O1VA 5CFDC 4E4SA 4DXZA 1HRI1 2ZOEB 4XDQA 4YW1A 1TE1B 1SBEA 1H2LA 2BUKA 2YBSA 4K21A 5LATA 3ZFGC 4NIGA 3L9JT 4FPFA 3SKVA 4B7EA 2QDNA 3PMEA 4IV3C 5FAXA 1OPOA 2E32A 4AI3A 1OOPC 4GWIA 4D69A 4XUTA 1LHVA 4XAAA 3ZDVA 3B5LB 5DMYA 1GZCA 2RS52 4JZRA 1PNGA 2ZAAA 3AJYA 2PQQA 2LALA 1EPZA 1PMHX 3CJXA 3O12A 4Q4V3 1VRH1 4DXTA 4I0WB 1A8MA 1QJZA 2W5FA 3MIFA 3IKWA 4K3UA 5C6CA 2E7QA 3THTA 2X10A 3KS7A 3K4DA 2EVXA 4AFMA 4P9JA 4Q4W3 4YZ5A 2BTVC 3MW3A 1V6LA 5FPBA 1OHFA 1W2OA 3X29B 3ZFFC 3IPVA 1LOCA 3S7IA 4HZFA 4YSFA 3KVBA 2Q1FA 4O7XA 3RNSA 1DCSA 5C5TA 1JOJA 1DGWX 4AHZA 3BOPA 4UW3A 4CEYC 1F9KA 3NV2A 4EQVA 1NA1B 2JKXA 5C3OA 1SCSA 2BGCA 2A70A 1KDKA 1IQAA 1YFYA 3I2KA 4IW3A 1WMFA 1NG0A 1S0IA 2WQZC 3IIAA 4COUA 4MGIE 3KF5A 1GNYA 4X6RB 5BNPC 1OD3A 1UW8A 1G9DA 1JYVA 1ZRCA 1SFYA 1SPPB 3O14A 1H4HA 1OPMA 2J1VA 2VZPA 2OUHA 1RUOA 3PLQA 4DY5A 4AVVA 2OT7A 1C3HA 3BPZA 3J4UH 1IHMA 1H2NA 2VNOA 1RUJ1 3CKHA 3OGVA 2K0GA 5E16A 5F8PA 4DMIA 5JXJA 2IUWA 5EV7A 3OPTA 1CQ9A 3N35A 4UXAA 5GJ6A 1O3RA 5LK7B 2RS31 1W0PA 4PI2A 5EFUA 4XJWA 1VBB3 4CCLA 1WD4A 4HPKB 2YPJA 3MZHA 3LB9A 2VUCA 1UYZA 2RS12 4FPCA 4PLOA 4RHV3 4LIUA 2AEZA 4CSWA 4Y5TA 4AVSA 4BXFA 3AMPA 3GZEA 2V72A 2WFPA 2AACA 3AFGA 3MF9A 3O1PA 5LBFA 4PIZA 1Y3TA 1ZRFA 1N1SA 1Z7S3 1RTVA 2BRTA 2D44A 4QPIA 4UFLA 1DLCA 3CBNA 2FZ1A 3IIIA 1L7QA 4FPYA 4GMP3 5DAVA 1HKDA 3Q8EA 1XJAA 1WLWA 3OUHA 1AR82 1N1VA 1GYKA 3FZ3A 3N3HA 5AVPA 2WBKA 2R16A 3E6BA 1D4VB 4Q27A 2VCMA 2OX0A 2FCVA 3POWA 5LA0A 2GC3A 4ZU7A 2GMPA 1WW4A 5C3SA 1KXGA 1NX9A 1WCUA 4ASLA 1ND3C 1ZZ6A 4AEKA 2ET7A 3SKJE 4RQPA 4UFIA 5HCHA 1VBB2 4CPBA 2VOTA 2UYBA 3OTFA 1I6XA 4OI2A 3KCXA 4FCAA 1WZXA 3U37A 3ZN4A 1BK1A 4Y33A 5FXVA 1RUH2 3E1F1 1UN1A 2VZ1A 2Y33A 3NW4A 5JXGA 3NO8A 4UW5A 1NE4A 4AYUA 2IWGB 4CXXA 1Z7S2 4IDZA 4JGZB 2V5DA 2W68A 5FY4A 1F8VA 2ZGSA 5JMOA 2WNUB 1MZ5A 1UMZA 4FXGB 5FY7A 2R1DA 1RUF3 3WNKA 3H8RA 1XNTA 5F5AA 2PHFA 3I3MA 1C5HA 1ZZ7A 3HNMA 1QJU3 1BEV3 3D0SA 3CZJA 5CG9A 4GAZA 4OI1A 3WNOA 3APBA 4DXSA 4DXRA 4XFAA 2VXRA 1HB2A 3ZOIA 3ACGA 3MV11 4NPLA 1AR93 5C71A 2VM9A 4QDRA 5DAXA 2Q8DA 2QKDA 2XJPA 5GKAC 2V73A 3OJBA 4QU1A 2IXCA 2CGOA 2A73B 2W1WA 3AMMA 3I2DA 4PIXA 4BB3A 1VIWB 5DZGA 2QQIA 4Q4Y3 2XR4A 1VBE3 2F4LA 4Q4V1 2ZX2A 4LOSA 1W06A 4Q8KA 5KXDA 4MZUA 2WZEA 5H9SA 1E5SA 1O3SA 4FT8A 1O8PA 2ILMA 4IGQA 4YFZA 1VALA 2VY0A 4E2SA 2RV9A 3QH7A 3FUQA 2GN3A 4N9IA 4O9GA 4Q4W1 4XFGA 3ZSEA 4EN7B 1RUF2 1DZQA 4E8CA 1E57A 3ES4A 5IK5A 1VPHA 5L7OA 1QJU2 1PVXA 4AGGA 3M7AA 3TWIA 1B35C 1W39A 2B8MA 3FLPA 3WHTA 1DQ4A 1UQXA 5JUVA 1U0AA 5CFDA 4NOTA 2OPKA 4XFIA 1AR92 1H6YA 1EV13 5LW9A 3NAPB 3ZM8A 3N7MA 1VMJA 4MXWB 2Y6HA 2QQVA 3H42B 3ZFGA 2DBIA 4F3JA 2Y6LA 2D6OX 1OQ1A 2WZR3 2RJ2A 1CPNA 4IV3A 3AYEA 5BXXA 4RFRB 1W03A 2OKXA 4DB5A 3R4UA 4BE3A 1AYM1 3ZKUA 4BCUA 5APAA 3WW1A 5IVCA 1OOPA 4L9BA 2D3RA 1A6CA 1Y7BA 4N90A 5F7UA 5FYZA 2NZ9A 4MYEA 3C7GA 4RR3C 1MQTC 1SBDA 3AKPA 3VGIA 3U4XA 4JKKA 2OXBA 4MGQA 3NNGA 5JOWA 2JWPA 5FKCA 2DWRA 1QNYA 1HV1A 3DCQA 3ZKYA 1F4HA 1BXHA 5FK8A 4CCOA 4CU9A 4META 4GIQA 1QOSA 5FY5A 2D40A 2WABA 5FIXA 4KL1A 4QDSA 3HMYA 5FPVA 2D6KA 2GP3A 4HN1A 1H0BA 1UD1A 3NL1A 1IS4A 4OCTA 3L2HA 3TN91 4HG6B 1EV12 3JBG1 1CZSA 4RHV1 1RUI3 1RHI3 4FQZA 2B46X 3POIA 4P9GA 2WO2A 3UT0A 3ZFFA 2VUJA 5A7OA 5A1FA 2WZR2 3POJA 1G9AA 3QH6A 3RZKA 1WCSA 5FPAA 5DABA 2QE3A 1JYCA 5FZFA 3WDWA 1OA4A 4HSLA 1YIFA 4F83A 5K9YA 5FY0A 2WT2A 4GMP1 1CPMA 1XNDA 4LUMA 4CEYA 4XUOA 1KD7A 1LRHA 4CDUC 5FBZA 5C4WC 3O7OA 2KM2A 1XU2A 1BCXA 3N9QA 2Z69A 5IUQA 4DIQA 4AI0A 5BNPA 3VBSB 3VUOA 3VBUC 2VW0A 2DURA 2EXJA 3ME2A 5A3TA 5I8YA 4Y5Z0 4M3CA 5LBEA 2A6XA 1XOYA 1SDDB 2O0OA 1IKPA 2XOMA 2Z79A 4MH0E 3B3QE 3NNMA 2X09A 1OF3A 1PMIA 1BMV1 5HCAA 5DUWA 4WVZA 3ORJA 3I3EA 3PU8A 5LY1A 4XCAA 1Q8QA 3UGFA 3KV9A 3ZPYA 2HWF1 1RUI2 1RHI2 2YB7A 1J1LA 4N43C 2FQPA 3B01A 4LBJA 4AF9A 4DEQA 2KA3A 4L11A 4C1WA 4INDA 4QXHA 1MS0A 2R32A 4D7SA 2Y34A 3TEWA 3LOBA 1W8FA 3K3NA 4B7KA 4DO0A 4M0HA 1UXXX 1Y9GA 2O8QA 4NIIA 3ZMNA 1BVP1 3F2ZA 1NY72 1QF3A 1SLCA 4RGAA 5DXDA 2VTFA 3BGAA 1BEV1 4MHUA 3WF2A 1PO11 1L7LA 4LE4A 2CL2A 4V2WA 4H7LA 4IESA 1A3KA 1COV3 1S0CA 1ZNPA 3K77A 1T2XA 2ZHLA 2A6YA 2XPJA 1CESA 1FT9A 1WUVA 5FP9A 2EF6A 2Y26A 4GWMA 3KMHA 1OXCA 4X6QB 4Q4Y1 1VBE1 3VD3A 2ZHKA 3S7EA 2Y8KA 1DQ5A 4OMCA 1LOGA 1XYPA 4YYOA 4LO5B 3ZYRA 1MPXA 2CV6A 2E51A 4OYUA 1UKRA 4P5YA 1V6IA 1XXNA 2VL4A 2VC9A 2YY1A 3PNAA 3MW2A 1FNZA 3SEPA 2E9QA 2W91A 1KJLA 5K0UA 4COWA 1JUHA 4BQ2A 4KNCA 5HI0A 2HEVF 2DVFA 1AL23 3LF7A 1XU1A 1MS9A 3D82A 4XQDA 5FLIA 4AQ2A 4UI9L 2WDBA 4K6BA 4CTEA 5LA2A 3ZYFA 2W52A 5FZLA 4P5HA 1WMEA 3IDCB 2PQSA 4XJ9A 1TZOA 4CCJA 2GN7A 3D5OA 4FPOB 5ANQA 4RS5C 5EPAA 2UWAA 3I3DA 4YGEA 1QH6A 5ANNA 4ARXA 4A45A 2BBVA 4MUVA 3ES1A 1ST8A 2JD4A 4OHWA 5FKBA 4OVEA 4XZPA 4CPBD 4LKEA 5ABJB 1CN1A 2JG9C 4LT5A 3ELNA 2XWBB 1OLRA 1KITA 4PJYA 2JICA 2XXZA 1JU3A 4HOOA 2HWD3 4ZXKA 2FDHA 5J98B 3DKQA 1Y9MA 5JZGA 5LA1A 1ZBA1 4Z1VA 1CAXA 5I0SA 5HV0A 5A7NA 1W6OB 3H9AA 3T2QA 4PLNA 4DUVA 4YVSB 4TTGA 2V4VA 5F3GA 3BYWA 4AG4A 3T0DA 1V6MA 3VBOB 4OHZA 2BFUL 2LS6A 4IV1C 5JIAA 1W8OA 1GQHA 2R073 3WDUA 3NMBA 2LTNA 5D1IA 1FOD1 3UV9A 1LR5A 3Q8AA 2VQUA 4A42A 2YDEA 2AUYA 1I9RA 1NCRC 2WA4A 3FUOA 4ZS3A 3MIBA 4FVVA 2ERFA 2R30A 2WKKA 1B35A 4O65A 1UU5A 1NQDA 1FV2A 4LORA 1OD5A 2EAAA 2IFRA 2VZQA 1XNAA 2WLQA 3Q8CA 1ZZ9A 4JTOA 4BOWA 4B29A 4TZDA 2HYXA 1XYNA 5FK7A 4YPJA 2QZ3A 3CL1A 3I2IA 3ITQA 4AE2A 4QX7A 1UOJA 4I02A 4KBZA 4RYDA 4XACA 2JDNA 3VB9A 5F2SA 4YM2A 1NUKA 4QPGC 3EMRA 1H8VA 4BDVB 3RI9A 2QFEA 3S0MA 2W1QA 2CTVA 2GSYA 2R041 4W6XA 4XW3A 4BH9A 1JI6A 4RR3A 3WG1A 1MQTA 2ZPXA 1ZREA 4HBNA 1WD3A 1BYHA 3F95A 2R072 1HQWA 1ZBE1 3I3QA 2CDOA 3GF6A 4SBVA 4OULA 3H1WA 4BMBA 1W3VA 5I93A 4QXBA 4FPGA 1RUC2 1SDWA 3K4ZA 1TQ5A 1DQ1A 4XQ4A 2J22A 1YC61 2PHLA 4AL9A 1JYXA 4CDWB 2Q1MA 2GH2A 3BKZA 1NXD1 1PO21 1SQ4A 3WUCA 4NAOA 5IK4A 4OQ8A 4ZKTB 3T2PA 3SH4A 2BQPA 2UYAA 5JXHA 2VQTA 3IWZA 3KCCA 3DXUA 3I59A 1K12A 3RRDA 5ERLA 2IXKA 1OA2A 4IE5A 4RN5A 4AWDA 3JQWA 3B7MA 2WO3A 1DQ6A 1MR5A 3NKTA 1COV1 1HXS3 3B00A 3N9MA 4KGGA 3VDCA 5IATA 1QJX2 4A41A 4YGBA 2ZEYA 4JGYC 2WNVC 1JU4A 2XBO2 2Y6KA 1URXA 3PVOA 2VZOA 4YW5A 1PK6A 5C4WA 4CDUA 3WP6A 3WR0A 4GMP0 3MIEA 4OFGA 4AAXA 1NLSA 1ASJ3 3KHCA 4FFGA 4JHZA 1VBA3 1ULEA 1VRBA 5FYIA 3VBUA 3GZUC 1WGPA 4QX0A 4BHPA 1WW5A 4I0BA 3T4HB 4PDWB 1XPWA 1PGL1 4BLJA 4LOTA 2BP6A 1EUUA 2ZS6B 1Z0HA 4EN8B 5JSOA 2XHKA 1R1A2 4GJYA 1EPWA 1AL21 3OGRA 1UYXA 4LO6B 4TWTA 4N43A 5DZFA 4AQTA 4CCEA 3A0NA 1B09A 3VD4A 2LRPA 4IEVA 3I49A 2C1FA 4CEWB 3WW4A 5H9PA 1LHWA 1HXS2 1IS3A 1VAMA 3DGTA 3UKTA 3W21A 5CZKA 3IAQA 1S0BA 2RE9A 3PHMA 5FP8A 3VBRC 4LR4A 5A7WA 3A0KA 3HQUA 3HWJA 4MHRA 3VHRA 1R093 1ZYBA 4RL7A 5C9AA 2VTXA 1J83A 4E27A 1VBA2 5KBFA 2RR11 2HWD1 1YO8A 4HK9A 1BLZA 1WLCA 2DFBA 4JDNA 4PBPA 5FP3A 2DCJA 4FAHA 4YM3A 1UZ0A 4UW6A 2ARXA 4IEOA 3WV6A 1FPN3 2ZHNA 1W05A 4ZU4A 5SV8A 3BI3A 2JX9A 3QLQA 3GBGA 1ULGA 2EIDA 4NVPA 1JMUB 4FOYA 2LROA 2ZGOA 2PFWA 2EXKA 3IPVB 1O7FA 4M4RA 2VVEA 4GD4A 4CP9A 3AB0A 3RZJA 3CJIC 3CF6E 5L19A 5FZOB 4F7ZA 5D8AC 3LCPA 3WSOA 1RC6A 1UYYA 4FOQA 4S2GA 4W4ZA 1R092 1ULCA 4NIDA 3MV01 1J3PA 1ENSA 3WP4A 1JYIA 1UMHA 2QCSB 5A3OA 5IK8A 4Q2FA 4GQ7A 4F8AA 3VD9A 1QH7A 4XZUG 3EBRA 2QZ2A 4MSVA 1O8SA 4MXVA 2AREA 2JG9A 4YZ1A 1O3TA 4L0PA 3HBKA 2ZACA 3S5AA 3JCIA 4CUBA 2DU1A 3E5UA 4K8RB 3VZJA 5CFCB 4QPYA 4OQ9A 4ZZ8A 4FTBA 1HV0A 1KS5A 2H6CA 2OW4A 3AFKA 2JDAA 4A7ZA 1GFF2 1VRH3 2HWE1 4IGPA 4YWAA 1STMA 3SQOA 4XF9A 3NV4A 1NXMA 4SLIA 2BERA 2XVKA 3OOXA 1GU3A 1W8NA 2WR9A 1I5PA 5E8AA 1F35A 1HB4A 3POFA 3H3UA 3VL8A 5F37A 1SLIA 2DUPA 4LMFA 3DXTA 1O4TA 4AOCA 2QQWA 2P34A 2QTWB 2GMEA 2WJSA 3RYRA 3SCFA 5A1AA 1HRI2 1SACA 4XC9A 3H50A 5F5CA 4DNYA 1U5YA 2HKXA 2W2IA 1QWRA 3KT7A 4IE4A 4QPIB 4Q0VA 4BQ3A 3ZFEC 4D0QA 5HPOA 5FUNA 1NCRA 1TG7A 3WNLA 2D6LX 4FBFA 4LA3A 3WQ0A 3ZO0B 1RXFA 2E63A 2VMFA 1DFQA 3U78A 1TNFA 4P00B 4GB31 3TEYA 1W8UA 4EYUA 1KRIA 1F4AA 3NNLA 5KHGA 1VRH2 5FZMA 3J9SA 1HX6A 1QEXA 1YUDA 4CU8A 4RQPB 3AL5A 1GICA 4QPGA 3H1MA 1ASJ1 1QOOA 2PTMA 2XHNA 3MO4A 3HT2A 1DP0A 4UF0A 1G9BA 1RUG1 1YXWA 2UU8A 3MIHA 3J7HA 1V9U1 3OBRA 4CCDA 1DYPA 1W2AX 3ZDSA 4JDMA 1RUJ3 1YFWA 4LKSA 1AJKA 5LRSA 1K3IA 3M3CA 2MEV1 1HDKA 1MZEA 1Q3EA 2P6HA 2RM21 1L3JA 5GLVA 3E5XA 1DYOA 5G04L 4GH4B 2RS33 5CYYA 2EAKA 1H30A 1O59A 5CAZA 2IXHA 1DGLA 5FCCA 5I8TA 1WMDA 2YFUA 5BNNC 1OBNA 2G19A 5FJHA 2WT0A 3FBYA 1HRV3 3VZLA 4P08A 1NYWA 1V00A 3THCA 1XB9A 4XAEA 2IXJA 2J1UA 4Q29A 3KZ4C 1PIV1 4DY3A 1G9CA 4LE3A 4GWNA 4YW6A 3HN1A 2DVBA 3NV1A 4DRVA 5FYSA 3VDDC 3FBMA 3EO6A 1RUJ2 4CP2A 5FZ8A 3N4MA 2WS91 1S2EA 2A5ZA 5JAXA 1Q8SA 3RJRA 1DF0A 1FPN1 1XE0A 2L9LA 4Q4X1 3SMHA 4E8DA 1A8DA 1OFSA 5IT6A 2RS32 4CP1A 3N7LA 1C8NA 3U1XA 3BTZA 2VCBA 4AVCA 4DINB 2A7AA 3C7OA 4L2NA 5IHRA 5A7QA 3PDQA 4ES9A 5L7OB 1YQCA 1DU3D 3GGLA 5LCWL 3ZR6A 3Q8FA 1C8M3 3RMXA 4NIAA 1HRV2 1LJ7A 3CO2A 4ONUA 1CIYA 5CFDB 3TB0A 1GNHA 4EROA 4KMQA 5J7MA 5JPMB 3O1MA 3WY6A 2GP5A 1GQGA 3O5SA 3RGBA 3TAYA 3HAGA 4B8EA 2BVBA 2HWB1 3ZFGB 3UGHA 3QCWA 1JS9A 3BODA 1VAKA 2FDIA 3TBDA 1Q43A 1YNAA 2R6QA 4FPLA 4ORFA 3VKOA 1ODNA 5E6HA 3VBHB 2A1XA 2BV4A 2VVDA 3VBRA 1OOPB 4W6WA 3J7LA 3GBFA 3GXUA 2ZGQA 4PI0A 1SEFA 2JDKA 1TEIA 4EWEA 4UYBA 1UOBA 4LBQD 1I5ZA 4D6SA 4A7YA 1XBFA 4KGQA 5JDBA 3O0VA 3VBFB 2RDRA 1S1AA 2QBXA 2X5IB 1APNA 4FFHA 3THPA 1UMIA 2RDQA 4XDPA 4XJZA 2VZSA 1D2SA 2JB4A 4AFCA 2W1SA 3NWKA 3MLKA 4XHXA 4YM1A 5BUVA 1UO9A 3POSA 3I4IA 1RUD1 3T0BA 3K3OA 4CXYA 4BLIA 4NPRA 3QACA 3T2TA 4E4ZA 2QQPA 5FYHA 1D7PM 5C3RA 2Y6JA 4KG0A 3GZTB 3ZFFB 1SLAA 2JIGA 3I2JA 1TNRA 3CJIA 5D21A 5CADA 1W9FA 1NKGA 5GLWA 3WP5A 1QIQA 1VP6A 1W90A 2PAEA 1N47A 4CEYB 3KD4A 4S2FA 2G9FA 2B9VA 2XJQA 4XFBA 3Q8BA 1FX5A 4MADA 5JSRA 2Q1ZB 3GNEA 3ZSLA 2QJVA 3LFMA 4YG0A 5BNPB 1ND2B 1NLQA 3ACFA 5F5QA 1CONA 3LQCA 4Q4V2 1R083 1SHWB 1SLLA 4N53C 2V09A 1AYM3 1REEA 4M3CB 5DUUA 3WLUA 4AVBA 2ES3A 1ENRA 4DOUA 1PGSA 3MBWA 2VNVA 3AP6A 4YM0A 4BK4A 3V0AB 1YJKA 4Z07A 1I1EA 2B39A 5L36A 1GP5A 1EAH1 1UY3A 4Q4W2 2W95A 4JC1A 5FMOL 5HV4A 1IPSA 2JB8A 3VHOA 2MHFA 1AHSA 1KDMA 2W47A 2WINB 3KGZA 4EZ4A 3KHBA 1TME1 2CY6A 4U36A 2Y64A 3D6EA 3GALA 1NA1C 3EHKA 5KHHA 5CKMA 1JBCA 1TMF1 5JOZA 3R6SA 1RB8G 3TN93 4WVMB 3JBG3 1D0GA 2VW1A 2XKOA 1HQNA 1BBT1 2PELA 3CEWA 4YW4A 1HRV1 3U07A 3VHNA 5GZGA 3LDKA 5F3IA 1GZWA 3KT4A 1W6PB 3ZFEA 1HIXA 4XJUA 1AYM2 3JD71 1C1FA 1DGRN 1PMJX 5FZEA 3WHUA 4HVOA 4XEZA 4XVHA 3CZUA 2XWJB 3ETQA 5LBBA 3M3QA 4QWNA 4Y20B 1YCIA 2I07B 4XXAA 5FZ3A 3SCGA 4B3NA 1W2UA 1V70A 3OPZA 3ZX7A 1UZZA 1FNYA 1YI7A 2DVAA 3V65A 3WW3A 3Q9OA 4NWVA 2ZX3A 5K0UB 1NCQB 1YRZA 3NV3A 4XCBA 4PT6A 4AFBA 5BNQA 1BKZA 1JZ4A 2OQ6A 3WDXA 1HN0A 2P1BA 3TN92 3WDTA 1W6MA 1W0OA 2HWF3 3JBG2 4RHV2 4ATFA 3UETA 3VKFC 1C8M1 3S6PA 2VMDA 4XIOA 4XHBA 1ZA7A 4GZ9A 3AM2A 1JZ6A 2GNTA 2ORXA 2RJKA 1OMIA 3DYMA 2YZ4A 1UCXA 1W99A 1RGSA 1YQ5A 2J42A 4LULA 1AR71 1QXRA 3LOIA 3TRSB 5BNNA 1WA6X 1PVC1 2VBPA 4AEDC 2V5YA 2KXLA 4ZONA 1E5HA 1PO13 1GZ9A 4OI0A 4Y3OA 2WLPA 1NT0A 4K20A 3RYKA 5JZGB 5FMCA 3MLJA 3UYJA 2ZEWA 5FZ7A 2JECA 3T1MA 1LULA 5FOJB 1C5IA 2E7TA 1VR3A 3GM8A 4V1PA 1MS4A 3BUCA 3EQEA 1BMV2 3WXPA 1W2NA 2XGXA 2W87A 4R52A 3ZLIA 4CCMA 4FAGA 1CD3G 5IK7A 2HWF2 4QB6A 2D6NA 1W6NB 4QX3A 2X53S 1XE8A 2WNUC 1H8TB 4L92A 2JDMA 1GWKA 1D0HA 1IPKA 3J8F1 4FFIA 2OQ7A 4Y4RA 3U4SA 4CUAA 4HMZA 4B1MA 4HKOA 3RDIA 3C8XA 1UXZA 1B35B 3L2YA 4CZSA 1BEV2 4DEVA 2WWSA 5JMCA 1PO12 2HBTA 4QHZA 3A23A 3I2GA 4DZGA 5LRRA 5B4NA 4UOJA 1H6XA 3P5BA 3ENRA 5KHJA 1SZBA 3R0RA 4LO4B 4NPMA 1CAWA 1GOHA 3FFZA 3GCWA 1W9WA 4HN0A 4AK3A 2WAAA 1QQP1 4BQYA 4XABA 1POV1 3RSJA 2WO1A 1X50A 3BTXA 1S0GA 2WZ8A 2EIGA 4Q4Y2 1VBE2 4COVA 4D7TA 3RJ2X 1R081 2EIBA 1A78A 3AP9A 4JQTA 1MQTB 2PHRA 4CU7A 4ISRA 4XFHA 5FZKA 1ZBA3 5HBAA 2G9ZA 2ZMKA 1LNSA 2BW8A 3JZVA 4CDQB 2QQKA 1QMJA 3PUQA 1QOTA 4LBLA 2RHPA 4EWDA 2RMU1 3S30A 4B4QA 4R4XA 2W92A 4H14A 3HQRA 3M3OA 1CJPA 4Q0PA 2C24A 1UOGA 1OF4A 3B02A 4CU6A 3ST7A 3HVDA 5FYUA 1UZWA 2VCAA 4CRQA 2AR6A 2EA7A 1UY1A 4LEJA 3ZYBA 1LODA 1FOD3 3I59B 4LO8A 4MG2A 3M1HA 3SHRA 4IEWA 1LGNA 2I45A 3MUY1 3BALA 1X7NA 5CEHA 3HEIA 3LEKA 2A6VA 1QNWA 5F2WA 2JE8A 3AZZA 2GZWA
chains in the Genus database with same CATH topology
3AXDA 2BFUS 1PK6B 4CDUB 5C4WB 1VLNA 1ZBA2 5GLUA 2FHRA 4H7MA 3TYJA 2D43A 4I30A 4A7KA 4PBOA 3VBUB 1LENA 3ZN5A 1ZZBA 4N53A 2F6BA 5EWSA 5F1RA 2R043 1OLQA 1WLTA 3ZIXA 4BQ1A 4Y1ZA 2PHTA 1PM7A 1ZBE3 1FOD2 1YFUA 2XKPA 1C4RA 4N43B 1RUNA 1LGCA 3MF6A 2B5HA 5J48A 3T1LA 2ZGNA 4YW2A 1DZTA 1PO23 1NA1A 4XMIA 5FQ0B 1AR63 4FTEA 1PZ7A 1IZ3A 3WD5A 2OIIA 1AL0G 5T50A 4GULA 5T52A 3VBSC 1MS3A 5C9AB 2QVSB 4LO7A 3IDEA 4KU8A 2ZKNA 3FMGA 2R042 3N36A 1RINA 5KXCA 1ZBE2 4XFCA 1UIJA 1AXKA 4RA0A 5GZCA 5FTTC 2UWCA 5J36A 1ND3A 3KM5A 4LBMA 5A32B 4DQAA 1MVEA 3ZSMA 1PO22 3DPRC 1M4WA 2B9UA 5FLJA 5FRAA 2BWAA 4GALA 4IEQA 2W08A 2WSVA 4EN0A 5BNOC 3SITA 4S2DA 1DZRA 3LAGA 4JQRA 1F2NA 4CYDA 1ULDA 2E53A 1RIRA 1WLDA 3AX4A 1COV2 5AC91 4NHLA 4KU7A 2D6PA 1VBC1 4IETA 4XE9A 4OHVA 4XF3A 4AEDA 2ZX0A 2DCTA 3M3IA 3LKJA 4MVTA 4IEXA 1QJY3 5AFBA 1SMVA 3WX5A 2RR13 4COZA 1LESA 2E6VA 4AEJA 1HW5A 1RJ8A 5KC6A 1T6GC 2D5FA 2BNOA 3AK0A 4LUKA 4K7JA 2I2SA 1XNBA 5CNAA 4RFT0 1AL22 3WCRA 2NMOA 5GZEA 2OVUA 4R9BA 3D0JA 3N7KA 3J26N 2JG8B 3E5QA 1Q8PA 1NCRB 2FBEA 1OFNA 3E6DA 3WUDA 1RL3A 1MVQA 4NO4A 4OUSA 4QT6A 5HCFA 4MLOA 5KWRA 3QBQA 1H1IA 2AH2A 1LEDA 4LBKA 3B9CA 4RGGA 4FO9A 1PNFA 2GNMA 5BV6A 4IERA 2D3PA 2HWD2 2RR12 1MZFA 4Y22B 3AYCA 4YVSC 2Q8OA 2RJLA 1OQDA 4G4FA 2WFF1 2HWC3 2VULA 3VBOC 2VQ0A 2ZMLA 3VL9A 1G7YA 4CDXB 1POV0 4QM9A 1DQ0A 3D4KA 3ZN6B 3OYWA 1YWKA 5T55A 5BYNA 4GKXA 5JSPA 3M70A 4JTNA 5T5LA 2HWE3 2GMMA 4WM8B 5LK5A 2NMNA 3DUIA 5CBLA 4R9CA 2I74A 4QGLA 1DLLA 1QDCA 4LTAA 2ZGUA 2N7GA 3CLPA 3VKNA 3OY8A 4L99A 1S0EA 4MXWA 4B4PA 1LU1A 1AR61 3A4UA 1J59A 1VAVA 3ZIWA 1DG6A 1XNCA 2OUJA 2A6WA 5H9QA 4FPEA 5BPXA 1GR3A 4YFWA 3ILNA 4GB33 1RUE1 3ZYPA 1YIPA 1EY2A 2JENA 2XJTA 3FLRA 4YZ3A 3OD4A 3GYDA 1U12A 3MI8A 4Z82A 3QD6A 2HWE2 3MEPA 4Y24A 2JDZA 4K8FA 5GZFA 5J3UA 4CDWC 1D4M1 4HLTA 1RUG3 2IXLA 2CGPA 1V9U3 2A3XA 2JE7A 2ZGLA 4A3XA 4J6GA 4M3CF 2JE9A 3ROUA 4QGMA 2MEV3 2HEYF 2YV8A 5C8CB 5KHKA 4LBQA 2RM23 3WNXA 1ZZ8A 1PGW2 2NQYA 4YW3A 4BZ4A 3ZYIB 5FPXA 1AXZA 1NE6A 3H8UA 2D93A 3I7DA 3AP7A 4J1XA 4C90A 1PGL1 1G86A 2WC2A 2IXIA 4GB32 4E4DX 3OD0A 3TNPB 5FFOC 4K40A 2B42B 4NHMA 3VBSA 4G3YC 1PIV3 2BYVE 4H3WA 1QJY1 2TBVA 1VBD1 1ASJ2 2CWSA 4PDWC 4HT1T 3KGLA 1RUG2 1JXNA 1V9U2 2CYFA 1YHFA 3AKRA 2G4IA 4HKWA 4Q0UA 5KC5A 4OZXA 1V6JA 5EJ3A 2WS93 1DQ2A 3IM0A 2MEV2 4Y4YA 4Q4X3 1MS5A 2RM22 1LHOA 4IEUA 1O3QA 4CEWC 2DUQA 3FC0A 4KWLA 1O91A 5J96B 2TUNA 1CJDA 2R061 3DPRA 3GHNA 4Y1XA 3V56A 2XJUA 4AI8A 1X8MA 4YGDA 5BNOA 4I3PA 5I0UA 2XJVA 4YG3A 4KBBA 5JOYA 5HXVA 3MYXA 4MGKE 1O4YA 1PIV2 2HWB3 2Q5TA 2R49A 2TEPA 3P3NA 3WOGA 1MS8A 3FJSA 2ATFA 4RS5A 1CR7A 1VJ2A 2VOVA 3FHIB 3JB8A 3AP5A 3OCPA 4YVWC 4AVAA 2PLV1 4P14A 1H9WA 3WG4A 2HWC1 2WS92 3MGUA 4HANA 2VW2A 1FPN2 3BIWE 4Q4X2 1UKGA 4XETA 5EYYA 4YARA 5GALA 4AVTA 1LECA 3WT3A 4Q1RA 1O5UA 1RMU1 3WVJA 3UJOA 1YLLA 4GA9A 4MGZE 1UAIA 3KB5A 3USUA 4BM8A 4I09A 4O9EA 4B4RA 1M06G 1LOFC 2VECA 3W59A 2GC0A 3BOWA 4LLFA 1RUD3 2OZ6A 2P3IA 2ZCWA 1VB2A 3HIFA 4RSUA 4QQOA 3ZXJA 4IV1A 2NM1A 2HWB2 3AZXA 2ZGTA 5GM0A 1WW7A 1GZWB 3KCYA 3ZFEB 4LHLA 2WT1A 1PGW1 2EXHA 1FMD3 1CAVA 4K9SA 3RZZA 4Z8BA 5CFCC 1QHDA 2DTWA 2XG3A 5KXBA 3RPQA 3POYA 1X36A 5K7PA 4XMAA 1AYN1 5FLHA 2JXAA 3ZSKA 3PMSA 3VBOA 3TNQA 4D3WA 4OHYA 1XNKA 3ECQA 2D5HA 1W6QA 3JB4C 5JIUA 1UU6A 1RUD2 1W6MB 1UIKA 2VNRA 1EAH3 1EP0A 2H6BA 3DV8A 3ZXLA 1AVBA 4C0BA 3OGJA 4EN6B 4FOVA 3M8LA 3U11A 4YLZA 3BCWA 3RWNA 3WW2A 4YG6A 1SBFA 1TME3 4JAAA 3IBMA 4ASMB 5CA6A 3HR9A 1TMF3 2XUMA 1WBLA 4FPKA 2XB6C 4WM7C 2DU0A 4AQ6A 4URTA 2LUWA 4QQ2A 4J1WA 1BBT3 5AVAA 2P2KA 4RQPC 5DZEA 5FMOS 3JD73 3HBZA 1UF2C 4WZFA 1G6NA 2PHDA 5F9TA 1BVVA 1QKQA 2XVGA 2XJRA 1CVNA 2PA7A 2AGSA 2X29A 3FFQA 1EAH2 4JGYA 2WNVA 4GH4C 4Q1PA 1S2KA 4NR1A 3VKLA 4CDWA 1ZVFA 1TME2 3LGRA 1TMF2 2HEWF 4D7YA 1EYBA 4AHWA 2PHXA 1G8WA 2GC2A 1NZCA 3SNMA 4X8NA 1BBT2 1PZ9A 1IPJA 1S0JA 4XBLA 1OA3A 4AHYA 4DS0A 2PAMA 2DVDA 3E97A 1ONAA 1CAWB 2Q0AA 1WW6A 3JD72 4M01A 2Y0IA 4XF1A 1J3RA 1AR73 1U5IA 4UW4A 1MEC1 4HVQA 4I2OA 1Q5OA 2Y38A 1PVC3 5T54A 4IV3B 4YGCA 3MFAA 5CVRA 1FXZA 2Q4SA 3BTAA 2FMYA 1BZWA 4UBHA 4HSJA 5L7OC 2Q30A 1H2MA 2C5DA 2HJIA 1DYKA 1K5MC 1H2KA 5CG8A 4QMAA 5A33A 5DG1A 3FX3A 4AGRA 1SLTA 4Y26A 1S2BA 1C8M2 1Z78A 4EJRA 4OLLA 3UK9A 1KS4A 4CEWA 4FTSA 2NLRA 2B45X 4HK8A 3J8F3 5K8SA 2FMDA 3VBHC 1AR72 1RVF1 1PVC2 4FOWA 1O4ZA 1NQJA 3PJQA 1FMD1 2BNNA 3ILFA 5D8AA 4YZ2A 5CU1A 5DG2A 4XXPA 1F31A 4NN0A 3VBFC 1QQP3 2X5IC 1POV3 4N53B 3AZVA 3RMYA 4YVWA 2A6ZA 1CAUA 4Z92B 3ZXKA 1DGRA 2W39A 4XF0A 1GSLA 1LOBA 4XJAA 1DIWA 4XBQA 3J8F2 5F6KA 5LEJA 2RMU3 2A75A 2TNFA 1LB2A 1MACA 2WQ4A 3SISA 3TOJA 2RS13 4YNIA 1GLHA 1LOFA 5I0TA 3AYAA 1LGBA 3OF1A 1X8EA 3WG3A 3G6JB 1LEMA 1UZYA 3WDVA 1ND2C 1REDA 1QQP2 5JI9A 1F5FA 2G9GA 4KG8A 2VNGA 3V0BA 1AR83 4JVAA 1R082 2XL7A 4R8HA 3AYDA 5DUXA 3ILRA 5CFCA 5J09A 3O0WA 4E2GA 5CB7A 2JJ6A 3VLBB 2YROA 1ZX5A 4E2QA 2K2SA 1N1YA 2RMU2 3WDYA 5ACA1 3M2MA 1Q8OA 1ND3B 3QOPA 2VUAA 5DDJ1 1N3QA 4AXOA 3SH3A 4EWAA 1Y9QA 1RUH3 4AFAA 4IEPA 2IFWA 5DUVA 3SH5A 4P9XA 2ZA9A 4FQ4A 4R9AA 4IEYA 4GKYA 1FYUA 4GXLA 2ARBA 3ZXFA 3RS6A 2F4PA 4Q0SA 2ZAHA 1WCDJ 2XLGA 3LA7A 4AGVA 4XOGA 3AZWA 4WM7A 5CIRA 4AEDB 4RD7A 3NJZA 3MFCA 3GHMA 3LZZA 2C0ZA 2RS51 5JOXA 2HYKA 1V6NA 5K0UC 1NCQC 4W65A 4R4ZA 4MV2A 1CAXB 2XVLA 4BWOA 5JLVA 4QGNA 3VDDA 4DRRA 4K1YA 4DFSA 1H1MA 2VOKA 3RYPA 2E7AA 1C1LA 2PN5A 4GH4A 2WZPP 3M3EA 3DKWA 1JN2P 4JGZC 4PIYA 5HCBA 3ZXEA 2R1BA 5SV5A 2P3JA 1QXJA 2OYZA 4M0NA 3W58A 1J1TA 4I01A 5JZGC 2OZJA 1DHKB 5AFEA 1KFXL 4OI4A 1JH5A 4XYXA 1ZRRA 4N7UA 3FLTA 5AC93 2QUOA 1VBC3 5FPZA 1AZDA 4NHKA 3ASIA 4JV4A 3KLSA 1H8TC 2GDFA 3OYWB 4RR3B 3B69A 1H4GA 1AUYA 4Y1YA 3G7DA 1K5MA 3UJQA 4HL0A 1YJLA 4TSVA 3INAA 2XLFA 3LSDA 1ALYA 4IXLA 4AW7A 3C2UA 3OY8B 1S55A 2RS11 2VU9A 2ZX1A 3KT1A 1GBGA 4E9KA 1KFUL 3D8CA 1XRUA 3NAPC 4QQHA 4Y1UA 5AC92 2Z42A 5EZWA 1VBC2 3VN4A 3VBHA 2ETEA 1C57A 4TLFA 4XIKA 1AR81 2WA3A 3PJYA 5GLZA 5FREA 1AX1A 2XL9A 4CDQC 2BVVA 3USSA 1IGOA 3VBFA 2ZMNA 2X5IA 1FV3A 1AXYA 1Q8VA 2WFF3 2DUOA 4LBNA 4QXKA 1C28A 1VBB1 1S0DA 2VH9A 2ZBJA 3VZKA 2BWCA 4QD2A 1I3HA 2PAKA 3VZOA 3ACLA 1RUH1 1SFNA 2DCKA 2NP0A 3KQRA 4LBQB 3P3PA 5JI7A 2ZGKA 3VZMA 1Z7S1 2ZGMA 1UU4A 2A71A 3AKSA 3RQ0A 2ENRA 1NOVA 1RITA 4YRDA 1PK6C 4AHXA 3W9AA 4JCKA 4KQ7A 3U10A 3UKVA 2AENA 1ND2A 2YMZA 3C3VA 3H7YA 2WFF2 3GBWA 2XH6A 4WZCA 3V0AA 4HFSA 2YHJA 2MNGA 1RUE3 2VGDA 5H9RA 4XPVA 1MS1A 3VKMA 3OBTA 1D2QA 2YUEA 1MZ6A 4QQPA 4XTPA 1D4M3 1ENQA 3JU9A 4L97A 4ISQA 4Q0QA 3R4SA 4P9WA 1RUF1 1LKNA 4HPKA 3DPRB 1ZRDA 3B93A 1DGWA 4WVMA 2ZJCA 1QJU1 1CGPA 5BNOB 2Z5WA 2GAUA 1AR62 2NPIA 5C9AC 4MGYE 1ULFA 1W6PA 1LU2A 2GU9A 4FXKB 5F6LB 5I8SA 1AR91 3WCSA 2VQAA 1YI9A 3AKTA 3H7JA 4RS5B 5I91A 1GNZA 1HLCA 4CP0A 1F5JA 1Y43B 2O8OA 1RUE2 1OI6A 4Y20A 1UL9A 1H1AA 2JG9B 4EN9B 4C1XA 5LEKA 4AEMA 2VOWA 3FE5A 3JQXA 2ZX4A 1VBD3 1D4M2 2P17A 1NCQA 4DPNA 2JEMA 3ZYGA 4A2UA 3NSTA 3PVBB 3VHPA 3USUB 2SLIA 1OQEA 5KHIA 2ZZJA 4QM8A 2IZWA 3K48A 2GH8A 3IN9A 4IV1B 4JGZA 1S0FA 4Q26A 1EV11 2W0XA 1PGL2 2WNUA 1JHNA 3RI8A 2R063 3CNAA 2WZR1 1IS6A 3MW4A 1PZ8A 5ABJC 5FO7B 1CAVB 3MPPG 4BYYA 5KXEA 1UPSA 3PVNA 1LHNA 2LM3A 2WL1A 2CNAA 2A3WA 2D3SA 1BQPA 1BJQA 1QJY2 1VBD2 4PQ9A 2PYTA 4QU2A 3URFA 4D94A 5JWPA 2WSUA 3WP3A 2PLV3 4KH9A 3WQ7A 1W6NA 4QPGB 5E88A 1W6QB 1GANA 4IQPA 3VV1A 2C9AA 5TSWA 1FAYA 2VMIA 3I54A 4BA6A 3MPBA 1H8TA 1O5LA 3GZAA 3MLLA 1PHMA 4U2AA 1RUI1 1RHI1 1RMU3 2JG8C 3NVCA 5L73A 1RUC3 2R062 3BU7A 4JDOA 2PHUA 2A3YA 4IEZA 4XQWA 4P9LA 1UX6A 2AYHA 4BIOA 2WIIB 2XLAA 3MIGA 1VB4A 4WVVA 4FP2A 1NY71 2UY8A 2UWBA 2YXSA 3NAPA 4I0AA 2UURA 3LWCA 2VMGA 1FI2A 2EXIA 2Z2SB 4R9DA 5T5JA 1GKBA 1SLBA 2DYCA 5C8WA 1QJX3 4CDXC 2PLV2 2HWC2 3V64A 2ET1A 1Q56A 2XBO3 1AJOA 1XQNA 1XYOA 5EXOA 1JTZX 4JGYB 4CDQA 2WNVB 2K9ZA 3AXEA 4WM8C 3WZ1A 4YZ4A 1KJRA 1RMU2 1AYN3 4AI2A 1ENXA 4K1ZA 3IMNA 4JRAA