1V6NA

Peanut lectin with 9mer peptide (pviwssatg)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
232
structure length
232
Chain Sequence
b'AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Structural plasticity of peanut lectin: an X-ray analysis involving variation in pH, ligand binding and crystal structure.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 51
structure length 232
sequence length 232
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1v6nA00
3AP6A 2UURA 4XDQA 5GZFA 3SNMA 2KM2A 5H9QA 4CRQA 1DLLA 2ZGSA 5DXDA 1OQ1A 3ZSLA 4FPLA 2ZZJA 1DQ0A 1BXHA 5T52A 4M3CA 1V6LA 1ONAA 1IKQA 2CTVA 2AREA 3MW2A 1LHUA 2XB6C 1I1EA 1A8DA 4YM0A 1AXKA 2OW4A 3ZXEA 4BM8A 1LCLA 3BTAA 1QNWA 3ZYRA 1BYHA 2VH9A 1GSLA 3AJYA 1U0AA 4R9BA 5EYXA 1HKDA 2P37A 1W6OA 4FQZA 2DWRA 2E7QA 3PVEA 1WD4A 2CWMA 2GALA 2ZGTA 1F5FA 1JBCA 1LHWA 1MS5A 5CA6A 1WBFA 1W6PA 2EXIA 1ENRA 5H9SA 4BLJA 5GZEA 3GNEA 4WVWA 3M3OA 1G9BA 2UU8A 3BOPA 1SCSA 2A6ZA 5T5OA 3DGTA 4Q1RA 2ZBJA 3W58A 1RIRA 3APBA 1PZ9A 4GWMA 3RS6A 4XMIA 3V65A 4MYEA 2D6KA 5EYYA 4YFWA 5IT6A 1JUIA 5AVAA 2C5DA 2R1DA 2DYCA 2SBAA 3IPVA 3WUCA 4AGGA 2OVUA 1CIWA 1AX1A 2R0HA 2A3XA 1SLAA 2EF6A 2R0FA 3IMNA 4FPYA 3R4UA 3C2UA 4NO4A 2AYHA 2PHXA 4YZ5A 1SLBA 5CAZA 1LHVA 4DRRA 5GLVA 5JOYA 2A3YA 2LTNA 3VV1A 2EXJA 2H0BA 3FUQA 2VUAA 5GLWA 2E53A 3M2MA 2EXKA 1GV9A 3FUOA 4AVSA 3AYEA 4XIOA 1N3PA 1V00A 3N7JA 1QKQA 2E6VA 2DUPA 3N7LA 1DFQA 1QOOA 1ULFA 2JE9A 4FOYA 3OY8A 1S1AA 2R49A 4GA9A 1G9DA 2GMMA 3M3CA 1QU0A 2ZMKA 5JVVA 3WG3A 1YIFA 2ZGNA 3WDTA 4D69A 3WG4A 1SBEA 2SLIA 1A3KA 4GALA 1W6QB 2NMOA 3WHUA 2D43A 1KDMA 1LOCA 3ZXLA 3WUDA 3AK0A 1PZ8A 3WDYA 5IK7A 3ZPYA 4YG3A 4Y1ZA 5E8AA 3B01A 3USUB 4YW1A 5GJ6A 1ENQA 4AGVA 1FNZA 1Z78A 3AZVA 1DQ6A 4XJ8A 3ZSMA 4FP3A 2ZHMA 4LBQA 1TEIA 2UWCA 4U36A 4XJWA 1D2SA 1WLDA 3SLIA 4ZKTB 3ZSJA 1W0PA 2VY0A 4FPEA 1LOFC 3D5OA 1LHOA 5DZEA 3WZ1A 1NXD1 2UWAA 5JDBA 4XXPA 3VKMA 1AJKA 3AXEA 1VALA 3N36A 5HCFA 3T2TA 1UN1A 1MS0A 3R05A 2P34A 2GMEA 5CB7A 3WDUA 2A6YA 1O4ZA 3JU9A 1LEMA 4P9YA 4W65A 1JYCA 4CZSA 1LOGA 4ISQA 3KM5A 2JE7A 1GYKA 1AF9A 2ZMNA 2A7AA 1LU1A 4BQ1A 3R4SA 3A0NA 1LECA 4BLIA 5IK5A 2DVAA 1J1TA 4YM1A 1HQLA 3VKOA 2YXSA 1QOSA 2ZABA 1FYUA 3M3EA 4YGDA 5F9TA 4YGEA 4Q8LA 4Y22A 2ZGUA 1CPMA 1IS4A 1OFSA 4YM3A 1YRZA 2ZHNA 5CBLA 1GZWA 3ASIA 4Y1VA 1IS5A 4DPNA 1WW5A 4XHXA 3OBTA 1AXZA 1C57A 1QOTA 1QF3A 3VKFC 2YZ4A 1UPSA 4UW6A 4ATFA 3PVNA 1UZZA 5JOXA 3O0WA 3OBRA 1XQNA 2V73A 5T5PA 2PHRA 4IQPA 3IM0A 4M3CB 4FPCA 3RMYA 1GKBA 2W39A 1H9WA 4JCKA 2ZKNA 1B09A 2ZMLA 2WNEA 5KXEA 4P9XA 4LBMA 1N1VA 4AVTA 1IKPA 1AJOA 3O0XA 1YO8A 4YGCA 1VLNA 5KXBA 1BZWA 2AR6A 2DTWA 3V0AB 5T5JA 2GN7A 4L8QA 5GM0A 1JN2P 1N1YA 4GKXA 2PHTA 1N1SA 2WT0A 3LSEA 4Q1PA 3RRDA 3TAYA 4R9AA 2ES3A 1H9PA 4M01A 3FLPA 4WVVA 3B3QE 1GICA 1LOBA 3IKWA 3N7KA 3UL2A 4LBNA 1QGLA 2D6PA 3O0VA 1IOAA 3IPVB 2VW2A 1DYKA 2E7TA 3NV3A 5GLZA 1LOAA 1GZ9A 1EPWA 4AWDA 1C1FA 3ZYPA 5KXCA 5HCAA 4UW5A 1YXWA 1Z0HA 2DVGA 3AZYA 3SISA 1Q8OA 3AX4A 3N35A 2Q5TA 5IK4A 1H30A 3TB0A 1GZCA 3ZXKA 2GNBA 1MS4A 1LHNA 1LEDA 2GDFA 2GNMA 2DV9A 3AFKA 4HANA 1AZDA 4XTPA 1ULGA 3RSJA 3D6EA 2ZGOA 3W59A 3OY8B 4Y1UA 2AH2A 5T50A 2DVDA 1CN1A 2WT2A 3HN1A 4ITCA 1DQ4A 4M3CE 4FPHA 1DIWA 1DQ5A 4GXLA 1DHKB 5LK5A 3T1LA 3ZXFA 1G9CA 4K20A 1ZA4A 2WSVA 4Y20B 2YMZA 2DVFA 3POSA 2D3RA 2A6WA 4XTMA 1SLTA 1DYPA 2ZAAA 2GN3A 1N1TA 1BQPA 4YGBA 2AENA 2JECA 3PMEA 1F9KA 3IN9A 1SCRA 4LBQD 3ZVXA 2DURA 4Y26A 1LJ7A 4WZFA 4GKYA 4XJ9A 4FPGA 2W08A 1CPNA 4LBKA 2EALA 3AP4A 1KJRA 3WOGA 4LBLA 3ENRA 4XYXA 1C4RA 3RQ0A 1W6MA 4WV8A 2PHFA 1OKQA 1ULCA 3OYWA 4FPFA 5H9PA 1S0GA 5CNAA 4PQ9A 1WW7A 2WLQA 3V0BB 1JYIA 5EWSA 1SFYA 5FRAA 5T5LA 2ZGLA 5JLVA 4TZDA 1QDCA 3PVOA 3B69A 1W6QA 2V5YA 5GLUA 4YZ1A 3UJQA 5T54A 4K21A 4YW5A 3AZWA 3NV2A 4YFZA 2VW0A 4BMEA 5FREA 3I4IA 4XE9A 4C1XA 3OPZA 5JOWA 1VIWB 2DUOA 3ILFA 3KQRA 5DUXA 3D4KA 1WD3A 4FP2A 4RA0A 3NV1A 3FBYA 3AZXA 5GZDA 3ILRA 1MS1A 3WCRA 1WCSA 1LGCA 4P9WA 4XHBA 5JMCA 1GZWB 2VW1A 5F5QA 1LU2A 1UZYA 1G9AA 1LGBA 2ARXA 3WG1A 1W0OA 2DVBA 2P2KA 2I2SA 3NWKA 2C9AA 4ASMB 4OZXA 2OUJA 4FPKA 1WUVA 4YZ4A 3UK9A 4FOWA 4DRVA 3DUIA 1LGNA 1V6OA 5E89A 3WG2A 1DGLA 1ULDA 1WLWA 3VUOA 3RMXA 2RHPA 3UJOA 2WQZC 1YI7A 1CONA 4NOTA 1LTEA 1RINA 1KRIA 1ZM1A 3AZZA 1UL9A 3SITA 1W6OB 3LCPA 5DZGA 2UWBA 4R9CA 1S0CA 2DU0A 2G4IA 3MEPA 1N47A 1W6PB 3MW4A 4UW3A 2NMNA 4Z8BA 1Q8VA 2Z42A 4PCRA 1QDOA 2GNDA 4RL7A 1AVBA 4BOWA 1DZQA 1LENA 1SLLA 1W6NA 2DU1A 2A5ZA 1N3OA 5DUVA 1MS9A 2ZGQA 4ZXKA 4AGRA 2FMDA 3V64A 3VKLA 1CJPA 1O4YA 2GNTA 1AX2A 4XIKA 1Q8PA 2D6MA 1IS6A 1ENSA 1NLSA 2R1BA 2P3IA 2P3KA 3AP7A 3INAA 1UKGA 4Q26A 4PBPA 2NYYA 2VXRA 1WW6A 4YG6A 1S0IA 3GALA 3ILNA 5IK8A 2JJ6A 2NZ9A 4K1ZA 1V6KA 4XZPA 3A4UA 3QCWA 5GLTA 1HLCA 4FVVA 4YLZA 1S0DA 3ZXJA 1JXNA 1MVQA 2D3PA 2EXHA 1VAVA 1V6MA 5DZFA 2CL2A 4XBNA 1DQ1A 1JHNA 2DTYA 3WVJA 3V0AA 2CWSA 4FQ4A 4LBOA 3JUUA 3AYCA 1A78A 1KITA 1BJQA 1Q56A 2XG3A 1SACA 3SH5A 4YW3A 1GBGA 4XJUA 5BYNA 1APNA 3FFZA 4K1YA 3WDVA 2ZACA 2ZGKA 3AP5A 1JOJA 3BODA 3RG0A 2JD4A 4Q27A 4H55A 1MS3A 4XXAA 1KDKA 3AP9A 1UAIA 1C1LA 2CNAA 3AJZA 4LBJA 4XILA 1RITA 3MW3A 2D6OX 4XJAA 3WLUA 1FNYA 2D6NA 3SH4A 4PBOA 3ATGA 1G8WA 2YV8A 3O12A 4XMAA 4C1WA 4XBLA 1GNHA 4M00A 4SLIA 2EAKA 1MS8A 2AGSA 4YW4A 3ZSKA 1WLCA 4R9DA 1SBFA 1CVNA 3POYA 4JC1A 1G9FA 3L2YA 4YW2A 1BKZA 1LESA 3WNXA 2PHWA 4BPZA 5GZGA 2LALA 2ZGRA 4HL0A 1GLHA 1SBDA 2WT1A 2A3WA 3OGGA 4AVVA 4M3CF 5E88A 1W6MB 2ERFA 3AXDA 4ATEA 1F31A 4I30A 4LBQB 4Y1XA 2D44A 3OYWB 3N7MA 4F83A 1FV2A 1Q8QA 1FV3A 1MR5A 4YZ2A 3HMYA 1HQWA 1WW4A 3WDWA 2YY1A 1KJLA 2NP0A 1LULA 1HDKA 4Q2FA 4JRAA 1SLCA 2JDZA 2WJSA 1FX5A 1URXA 2GMPA 4U2AA 4Y1YA 2D7FA 2DUQA 4Y20A 5GALA 3WV6A 3VKNA 2P3JA 1X50A 1AXYA 1MZ5A 1YYNA 2ZHLA 2PELA 2YROA 3MPPG 4YG0A 3N3HA 2TEPA 4UW4A 1I3HA 3QLQA 2D6LX 4ISRA 1MZ6A 1GANA 3WCSA 1MVEA 2PHUA 3NV4A 1D0HA 1WBLA 1UX6A 2D3SA 3M1HA 5HCBA 5IUQA 1S0FA 2A71A 1ULEA 3Q9OA 4GWNA 5GZCA 1S0BA 4FPJA 3USUA 3U4XA 1V6NA 2B7YA 4FOVA 1G7YA 1LOEA 5JOZA 2W68A 2NM1A 1Y7BA 2VU9A 5L73A 3SH3A 3O5SA 1MACA 4CTEA 1DQ2A 2ZA9A 1S0JA 4DQAA 4KBBA 4PF5A 5DUWA 3BIWE 1QNYA 1FAYA 2WKKA 4Y22B 5DG1A 3V0BA 2ZHKA 5DG2A 5T55A 2AUYA 2ZGMA 3AYAA 1N3QA 2NN8A 4BMBA 4P14A 2WSUA 4AYUA 3PJQA 1UMZA 4DS0A 2W52A 5DUUA 1SLIA 1Q8SA 2CY6A 5KXDA 3M3QA 3T1MA 2A6VA 1DBNA 2A6XA 1V6JA 1VAMA 1R1ZA 3I8TA 3HR9A 4Q8KA 4FPOB 2JKBA 1CR7A 4XOGA 4XBQA 3WDXA 1FATA 1LOFA 1JW6A 3OJBA 3FLTA 3LSDA 2A70A 2ENRA 3B9CA 4YZ3A 2HYKA 2EIGA 5EXOA 5H9RA 1IS3A 1QMJA 2ARBA 2BQPA 1PZ7A 3FLRA 4FOQA 3AYDA 4Y24A 2FHRA 1GNZA 3WHTA 2OUHA 4TYSA 1G86A 3POWA 1CESA 1V6IA 1KQRA 2A75A 4XJZA 4DFSA 4YM2A 3H0OA 5SV8A 2R16A 3CNAA 1AX0A 3A0KA 2ZGPA 1W6NB 1LODA 3B00A 1CQ9A 2CYFA 1S0EA 2E51A
chains in the Genus database with same CATH superfamily
2UURA 5GZFA 4MGSA 3G7DA 1HRI2 1DLLA 2R071 2ZGSA 4QM8A 2WQ4A 2RR13 1J58A 3CDZB 3MUY1 3QH6A 4FPLA 4META 3U4SA 4O7XA 3B9IA 5LZ6A 5FK8A 3MW2A 1I1EA 1A8DA 1SPPB 4PI2A 3ZFGB 1AXKA 3BTAA 3HJRA 4MH0E 1OLQA 4P00B 3VHOA 3JB8A 4OHYA 3PHMA 4FQZA 2DWRA 3JCIA 5CKMA 5K0UC 1W9TA 1COV1 1Q43A 3WF4A 1GUIA 1MS5A 1DZRA 1L7QA 1NAEA 1WBFA 3U1XA 5F37A 2EXIA 1TME3 4HMZA 4DO0A 4WVWA 3M3OA 1FOD1 1G9BA 1J3PA 1PM7A 1HRV3 2XVGA 2IFWA 5K0UB 1VPHA 1W3VA 3SXWA 5A3LA 5EJ1B 3APBA 1PZ9A 4GWMA 3RS6A 4XMIA 4BCUA 2JG8A 2V09A 3EYPA 4A2UA 4E4SA 1D4M1 4YFWA 3ROUA 5HV4A 4HSJA 4GMP0 2DYCA 2HEYF 1GP4A 3T08A 4IV3A 5JMOA 2BFUS 2R0HA 5LB6A 2YB7A 2JKXA 4A42A 2EF6A 3TNPB 5HPOA 3BYWA 3IMNA 4B29A 1H1MA 5F8PA 1NOVA 2I45A 1RUF3 4YZ5A 4JDMA 3UKVA 1CD3G 2VG9A 3ABZA 1CZTA 4K8FA 3AFGA 4F3JA 4NHMA 4CEWC 1YFUA 2RJKA 3FUQA 3S7IA 5HV0A 1VBC3 2EXKA 2GP3A 3FUOA 3NNJA 3AYEA 3T0AA 3WP3A 3NJXA 4TN7A 3I2JA 3VHRA 3ZMOA 1QKQA 3ACFA 5K4LA 4QU2A 5L36A 4R8HA 1RUH1 1AL22 2E6VA 4NPLA 3WF0A 3T0BA 5JVVA 1QU0A 4CEWB 3BN6A 3WG3A 3CMGA 1YIFA 2BNMA 2MNGA 3WDTA 3MF6A 1R093 1SBEA 3T2QA 2RDSA 1HV0A 1W6QB 3HT2A 1J83A 1SFNA 1LOCA 3WT3A 3ZXLA 4MGYE 4OVEA 2BBAA 3K3NA 4OUSA 5ACA1 1X9PA 4BISA 2BPA2 1F4AA 5FZBA 4YG3A 1MEC3 4XFFA 2PN5A 5FUPA 1BEV2 3ZYFA 2VZVA 2WZR3 2ATFA 5E8AA 4XACA 4AGVA 1CX4A 4XJ8A 4QXKA 3E6DA 4FP3A 5F5IA 2Q8OA 1TEIA 2QZ2A 5E1RA 1D2SA 2VQUA 5LY2A 3W9AA 2YFZA 3SLIA 2JDHA 3QD6A 1OA3A 1AYM1 1CAXA 4GQ7A 3KGZA 4FPEA 2PFWA 1W8OA 5DZEA 4HKWA 1W39A 3C7HA 1B35C 3P3PA 4HT1T 2UWAA 3WP4A 4K40A 3VKMA 1XNCA 3N36A 4CCLA 2OS2A 2EA7A 4IEQA 3PURA 2P34A 4Q4Y1 5CB7A 1QJFA 1LEMA 2X5IC 4W65A 2Y6FA 3PU3A 4KWUA 5CEHA 3BTXA 2VNGA 3KM5A 4BH9A 2W3JA 4IW3A 5A1FA 1AF9A 4PLNA 2Y38A 2A7AA 3UNPA 1S55A 2XGXA 5FZEA 5JXJA 2HWD1 3ZIWA 3I2KA 1RC6A 2VTXJ 4DINB 2DVAA 2X5IB 3VBSA 5F1RA 1QOSA 3LEGA 4IGOA 3WW2A 1AYN3 1FYUA 3M3EA 4YGDA 4J1XA 5DAPA 3THTA 2R32A 1PVC2 4CCCA 1CPMA 4MV2A 1Z7S2 1OFSA 5CBLA 4HK9A 3VZNA 1HB2A 1VR3A 1POV0 1HN1A 4DPNA 1WW5A 5DDJ2 5JR7B 3DYPA 1J84A 1C57A 5F6KA 2XVLA 2YZ4A 5A6ZA 1W8WA 2D40A 5F32A 3S5QA 5T5PA 1W2NA 2PHRA 2HEVF 4S2HA 3A23A 2W39A 2Y6HA 1H1IA 4JCKA 2AEZA 2BYVE 2ZKNA 5J48A 4CUCA 2VMHA 2PA7A 3POIA 1UOFA 4AG4A 4HPKB 1WMFA 1UF2C 1XYOA 1NZCA 3FHQA 3PUQA 4AVTA 2VR4A 1W9YA 4LPLA 3TBDA 2VNOA 1QQP2 3SCGA 3O0XA 5DQ0A 5FO7B 1OURA 3OD0A 2BDRA 2PLV2 2WN3A 1UY2A 2DTWA 2Y6LA 5DAXA 3MLLA 2RE9A 5FY7A 5T5JA 3V0AB 3NO8A 3W5NA 1JN2P 1N1YA 3JD72 4NJ4A 3BPZA 4QPIC 3AVRA 4WM8C 3WP6A 4D7SA 4AEJA 5JSOA 3TEZA 3TAYA 2GH8A 1DDLA 4WVVA 4D8MA 3FLPA 2JDUA 3B3QE 2KXLA 3IKWA 2VZ3A 1OPMA 3CLPA 4LBNA 3O0VA 5FP4A 1QEXA 3I2OA 4UF0A 4QGNA 1EPZA 3NV3A 2ZJCA 3AMPA 1LOAA 4QPIB 1E5RA 2W47A 4WM8B 1ASJ3 4X6QB 5CISA 2W46A 3VBOA 4QDQA 2ZZQA 2D93A 2Q0AA 4UW5A 3AZYA 2DCTA 5FFOC 5AC91 5C8WA 5LEJA 2RV9A 1H30A 5LBCA 1A6CA 1GZCA 5FYTA 1GNYA 4HANA 1H8TA 2DV9A 4ZU7A 1VBB3 1UY3A 2DCJA 1W2AX 2VL4A 4XTPA 1ULGA 4NHKA 4LE4A 3RZJA 4RYDA 4XQDA 3OY8B 2AH2A 4MO3M 1QJZA 1VRH1 3NW4A 5JIAA 2IXIA 3GJBA 3HN1A 4MXVA 2JDAA 1DQ4A 1LKNA 1HRI3 4GWJA 1DIWA 4AXOA 1DHKB 1JI6A 2XBO1 2WNUA 3T1LA 1G9CA 5C5UA 4RQPC 2WSVA 3ZIXA 2YMZA 2DVFA 1OUXA 3QH7A 3WF2A 2YBKA 4XTMA 4BQ5A 5KHGA 3POFA 4KL1A 4B3NA 1O8SA 2ZAAA 4RS5C 1N1TA 1BQPA 2RS33 3M8LA 2DCKA 4QXCA 1ZZ6A 3MO4A 4QB6A 2WFF3 4H7LA 1NY71 4RQPB 1RHI3 3NVCA 4HETA 3VBUB 3VL8A 1LJ7A 4XJ9A 5FXWA 5A3MA 2XKOA 4RS5B 2W08A 4LBKA 2EALA 3WOGA 1ZA7A 3ENRA 4XYXA 3WNMA 2WAAA 4Q0QA 2PHFA 4FPFA 2W95A 1JH5A 1JZ3A 4N7IA 5FJKA 5CNAA 4PQ9A 2W94A 3USSA 1OOPA 1XJAA 3AL5A 3WNOA 4IESA 2ZGLA 3VD9A 3MUZ1 1QDCA 4HG6B 1A34A 4ASKA 3TN92 1R64A 1QJEA 2LS6A 1PO12 5FKCA 1W8NA 3LAGA 1FPN1 1JU4A 4L92A 3WQ1A 3UGGA 4SBVA 4HKOA 4LXLA 5FMOS 3TWIA 4KU7A 3NV2A 4QPWA 2VW0A 1PGL1 3I4IA 4QDRA 4LUKA 1E5SA 3ES4A 4CA9A 5FP9A 1ZBE2 4UXAA 4KGGA 4WM7B 3VN4A 1RUD2 3WW4A 1RUI3 3AZXA 5GZDA 3ILRA 1AL23 5FZGA 2VCCA 1YLLA 3ZYHA 5FZ8A 5JMCA 2RR11 1HV1A 1XE7A 5J98B 3CIHA 3EQEA 3MLJA 4A7YA 5JI9A 2VW1A 2VVDA 1W28A 5FZCA 4QHBA 3QOPA 2ARXA 1NX9A 1W0OA 1JZ6A 4IUGA 3DPRC 1OVPA 4DIQA 4IL7A 1UYZA 3J7HA 5LBFA 4CDQA 3ETQA 5A3NA 2J1VA 2C26A 2VVEA 4DRRA 4YZ4A 2BNNA 2P3YA 3UK9A 4DRVA 2VUCA 3QBQA 2HYXA 4MZUA 1ULDA 3KZ4C 1BEV3 1K5JA 3LDBA 4XCBA 2NLRA 3C8XA 3UJOA 5LRRA 3SC7X 3DPRB 1CGPA 4MGIE 4YPJA 1TME1 3Q8CA 5ISLA 5FWEA 1F2NA 4OLLA 1RINA 4AAXA 3OEBA 1GU3A 2P17A 1UY1A 1HRV1 4D3WA 1UL9A 2KR2A 3UGFA 1W6OB 2XUMA 2RDRA 2RS12 1W2OA 2PHLA 4XQWA 4MGTA 1W90A 4D94A 5BNPC 3LB9A 3LA2A 2WBKA 3NAPC 2W9XA 3N9PA 5JSPA 5EJZB 3HVDA 1W6PB 4AHWA 5IFPA 2NMNA 1MQTC 1BK0A 1UW8A 2GNDA 4LA2A 1AVBA 5A33B 1W6NA 2DU1A 3BTYA 2ZGQA 1RUF1 5A3TA 2DCZA 2FMDA 5BNPB 5KC5A 3NAPB 4GJZA 1ENSA 1OD5A 3J26N 4A7ZA 3SCHA 4Q26A 3INAA 5FCCA 1UKGA 1MQTB 2GH2A 1VBC1 2XKPA 2YDEA 3V56A 1AR82 2NYYA 2EAAA 4PBPA 4E27A 1WW6A 3DKQA 3LPFA 1S0IA 3ILNA 4BHPA 3I49A 4YW6A 5IVYA 1UYPA 1V6KA 2WR9A 3ZXJA 2P6HA 2XOMA 4FVVA 3SQOA 1MVQA 2YHJA 4A7KA 5C9AC 1VAVA 1R091 1V6MA 4QPGA 5DZFA 5LA9A 1Z7S3 3ZN6A 2R063 4CDWA 1ZRFA 3KQ4B 1W8HA 3A7QA 4BIFA 5JPNB 4LBOA 3SH5A 3ZR5A 1E57A 1KITA 4EN0A 5DDJ3 1CAVA 3ALQA 1GBGA 1CAUA 4BZ4A 4E2GA 3EBRA 2ZGKA 2VBDA 1MEC1 3ZDVA 2YPJA 5LASA 3SKVA 5FDBA 1POQA 4W50A 4QQHA 1KDKA 2WZR1 2CNAA 1C1LA 3AP9A 3L9JT 4J25A 4BA6A 2V72A 3CJIC 3RZKA 2HLEA 3NNMA 5FZ7A 3EHKA 1ZREA 4WVMB 1UIKA 3MYXA 5A3WA 1KFUL 2YV8A 4XMAA 4C1WA 2B42B 1OPOA 3KLSA 4M00A 4SLIA 2AGSA 2GC0A 1SBFA 2XJQA 4JC1A 4MHRA 2ORXA 3VBUA 1RUE2 1QQP3 3CJIB 4NIIA 1AR92 3VDAA 2V4VA 4BPZA 4DXTA 3POJA 2RM22 2LALA 4HL0A 1H2LA 1GLHA 4G4FA 4M3CF 4CU6A 2ERFA 1WMXA 2PLV3 2VOTA 1YEWA 2K9ZA 3FL7A 3GYDA 3LFIA 3OYWB 3N7MA 4PI0A 3T09A 4F83A 5C3OA 3JD73 3O14A 1YWKA 5CZKA 5CU1A 1HQWA 1WW4A 2A1XA 3GCXA 3SKJE 4Q0UA 4YARA 4NR1A 3U11A 4V2VA 1SLCA 4PLOA 3UKNA 2WINB 2RG4A 2WJSA 2QQIA 2AACA 4Y1YA 4E4ZA 1UYXA 5D8AB 2DUQA 2WWJA 2XJTA 1UO9A 4HN0A 3O7OA 3U75A 5LK7B 5JCTA 3MIDA 4X6RB 3VHPA 1MZ5A 1H2NA 2PELA 1T6GC 1AYN1 5FZFA 1UOGA 3WX5A 4ARYA 4B1LA 5JAXA 1H2MA 2BVBA 2VZ1A 3WCSA 3KVAA 5IUQA 4CCNA 3O1MA 2A71A 4OI0A 5GZCA 3U4XA 4FPJA 2W91A 5LBBA 2B7YA 2FDKA 1G7YA 2W68A 4AQSA 1Y7BA 2JG9A 5DMYA 2WYSA 4JDOA 1MACA 1O3QA 4OMDA 4P08A 1S0JA 4LA3A 1H2KA 3J4UH 1YIPA 2WKKA 2O1QA 3V0BA 3KV9A 2HWB2 3OUJA 2E33A 2G9ZA 4JQRA 5DG2A 3AYAA 2R042 1PO22 2NN8A 5T55A 5DABA 4BMBA 2WSUA 2RS52 4EN9B 3K4DA 4DS0A 2PAKA 3H8UA 5EPAA 1ND2A 1SLIA 1VMHA 4DZGA 1YI9A 3T1MA 3Q8EA 2OT7A 2Q4SA 4LITA 2A6XA 3Q8FA 3ZXAC 1VAMA 1YFXA 1R1ZA 2VMIA 3I8TA 3LOBA 1ZZ9A 1NE6A 3HR9A 1CR7A 3AL6A 4XOGA 5JI7A 2J1RA 4QKDA 5ERLA 5FLJA 4IEYA 4RGKA 1RVF2 1NA1A 3RZGA 2EIGA 2BVVA 3CQOA 5H9RA 3RWKX 3OUIA 4XCAA 2D5HA 3IIAA 2XL9A 2FDIA 4YRDA 2ZEWA 1PX4A 2FHRA 2P1BA 1GNZA 2X29A 1K5MC 4WZCA 5A32B 1CESA 2JIJA 1T2XA 2JB8A 1KQRA 2A75A 3K48A 1GP5A 3BGAA 3CNAA 1Q5OA 3RGBA 3A0KA 4O9EA 2HKXA 4ZS3A 5I0TA 2KD7A 3RI8A 1AUYA 1ASJ1 1CQ9A 2CYFA 1PO13 2WRAA 1S0EA 4I3PA 2VMGA 4AR2A 3VBFB 4XDQA 1K5MB 4XUNA 3SNMA 4IEVA 4CRQA 5FZIA 5FZHA 2ZZJA 3KCYA 1XNBA 4IE4A 1WCDJ 4D7TA 5T52A 4M3CA 1V6LA 1ONAA 2Z2SB 2JWPA 4BQWA 5FMBA 2G1MA 3J7NA 1ZBE3 5CVRA 1VBB1 1JZ2A 4EZHA 4MG2A 3ZXEA 2XH6A 4ZONA 3I54A 3ZYRA 1BYHA 2VH9A 1RUG3 1U0AA 3ECQA 2YGLA 2P37A 1HRI1 2ZGTA 1F5FA 1JBCA 2AZ5A 5CA6A 1ENRA 4BLJA 3DF0A 3GNEA 5A6QA 3D0SA 3BOPA 4BXFA 3WQ7A 2RS31 2XPJA 2DFCA 4Q1RA 4Y4YA 3BKZA 1IPJA 1W2TA 2IUWA 1QJU2 4IV1A 3V65A 4HKLA 4MYEA 2BFUL 2WFF1 1RHI1 3KT1A 3T4VA 1F4HA 4CCDA 3IDEA 3IPVA 2Y0OA 2BTVC 3WUCA 3VD4A 1REFA 1AX1A 4Q4V2 2A3XA 4XDOA 1FMD2 2R0FA 1HJGA 1UD1A 5FP7A 4FPYA 3MPBA 2WO1A 3DL3A 3C2UA 4NO4A 1UNBA 4Y4RA 1SLBA 4JKMA 2B8MA 2CAVA 2J7MA 4J6GA 4OULA 2VTXA 4XFHA 1L7RA 4NROA 2EXJA 1XU2A 4HN1A 3GHMA 3UGHA 4A45A 2VUAA 3M2MA 2F4PA 1GV9A 4XIOA 1SQ4A 1N3PA 3FX3A 1V00A 1QJY2 5G05L 4CCOA 3D82A 3N7JA 4ET7A 2JEMA 3FC0A 3N7LA 2WLPA 1DFQA 1NCRA 1ULFA 5C33A 2XDVA 3I97A 3NSTA 4A6SA 2ZPXA 1A3KA 5FP8A 3UESA 1O6UA 5EP9A 4IEZA 2JDKA 1KDMA 2DDUA 4A41A 4N8MA 4Z82A 2VTFA 3URFA 2VD7A 3AMMA 1RUI1 4JGZC 3ZPYA 1AL21 1VB4A 4DXSA 2VQ0A 4KH9A 5B2GB 1OF4A 3B01A 4CCJA 5JR2A 1ENQA 5C8CA 1FNZA 2WC2A 3AZVA 4KU8A 1HX6A 2ZHMA 4MLOA 4JGZB 2UWCA 4JAAA 4L97A 4N7UA 2DF7A 1CAWB 4JGYC 4N53C 1WLDA 4BK4A 4XETA 2VOKA 4LUMA 2WNVC 4QAWA 4AI2A 1W0PA 1LHOA 3B02A 1BEV1 2HWE3 1F15A 3NNLA 5FV3A 5KHHA 4RFRB 1CZVA 4QGMA 4BQYA 5APAA 1UN1A 1ND3C 1HIXA 2OQ7A 3AKSA 3PUHA 2O0OA 3R05A 2I07B 4JGYB 4N53B 4P9IA 4COWA 5CFCA 1O4ZA 1AR62 4DY3A 5FPBA 2WNVB 1YJKA 4LO5B 3ORJA 4XUOA 5JZGA 4CZSA 5FYHA 5F2WA 1NKGA 1XPWA 3LIGA 4ISQA 3JQWA 5IVVA 1UU6A 1QY4A 2MEV2 2IXJA 3LZZA 1LU1A 2ET7A 1AR93 3NJZA 4BQ1A 4EV0A 2QCSB 4Q5OA 4PIXA 5I0RA 3CL1A 3MBWA 3VKOA 2YXSA 4XF9A 2ZABA 3CBNA 4YGEA 4NUBA 4Q8LA 2QVSB 4PIYA 4LO8A 2LUWA 4Y22A 3RI9A 4DMIA 2HEWF 3IDCB 1JTZX 5LW9A 3WF3A 4CDUA 1YRZA 2JXAA 1RMU2 3ASIA 1UMHA 2ILMA 3NQHA 4Y1VA 3VZOA 4PLMA 4C0BA 1UZ0A 4XHXA 3O1PA 4DOUA 4CU7A 2WS92 4ATFA 3UETA 3ZSEA 3N4MA 5FOBB 4Y3OA 4AEDC 2PXJA 3I59A 3ZOIA 3ZXGA 5JOXA 3ACHA 4AI9A 4IQPA 4GMP3 3ELNA 3KT7A 2ZX3A 1YCIA 4Z1VA 2W5FA 4BDVB 1Z7S1 5FWJA 2R061 5KHJA 1B09A 4C91A 1DU3D 5KXEA 2P4EA 3C7OA 1TMF2 4AEDB 5DDJ1 2W0XA 4EWDA 3IT8A 2JG8C 1AJOA 3ZKUA 2RMU3 3OB8A 3LA3A 3RDIA 5KXBA 5J37A 5HI0A 1PO23 4IV3C 1ACCA 3ACGA 3EO6A 5JUVA 2GN7A 4QX8A 4L8QA 5FKBA 4DUWA 3H1YA 2XJRA 2YGMA 4M01A 1H9PA 2CAUA 5JXHA 1GICA 2W1UA 1QGLA 1WLTA 4WBBA 2VW2A 1QQP1 1V0AA 2E7TA 4IV3B 4OCTA 5BNNA 4LLFA 5GLZA 1H4GA 1SPPA 4Q4W3 2PLV1 2QQNA 3ZYPA 5LA0A 5KXCA 3JD71 5A6YA 1EY2A 2VC9A 4A3ZA 3SISA 3OBAA 5G04L 2PQQA 3AX4A 4RHV2 4EYUA 2CV6A 3TB0A 3ACLA 3MIGA 2GNBA 4Y5Z0 1VBE3 1UMIA 1DCSA 4Q4X3 4C0HA 2VCBA 4EN8B 1U12A 4UFLA 1ZBA3 2C24A 2QDRA 2VBBA 3W59A 1C8M2 4CUAA 4Z92B 1O3SA 5LY1A 5C6CA 4ITCA 3VHNA 2NQYA 1ZNPA 1EP0A 2J1UA 4GXLA 3HD8B 3OF1A 3I3QA 3QACA 1W8FA 3SMHA 1BBT2 2D3RA 2WNOA 5FZ1A 4NIAA 2R7EB 1VRBA 3ZFFC 3DN7A 3JBG3 4GD4A 3JB4C 5A7OA 1PK6A 4YGBA 2AENA 5FQ0A 4UBGA 5IVFA 2GC2A 3ZVXA 3LF7A 1REDA 4L2NA 4OHWA 4NVPA 1EUUA 3FJSA 1CPNA 3WNLA 1XOYA 1PMJX 4N43C 5IW0A 5JSRA 3H8RA 1NCQA 2E31A 3E5QA 1OKQA 3LQCA 5H9PA 3MICA 1S0GA 2W1SA 3H8OA 5EWSA 3NRUA 4NRQA 5FRAA 3MHZA 1POV3 4TZDA 2WFPA 2GZWA 1W6QA 4URTA 4N43B 5FMOL 2J42A 5GLUA 4FI9A 4Q4V3 3VBSC 4EN6B 1OQEA 1VJ2A 3AZWA 2LRPA 4L99A 4YFZA 4NIDA 1OSGA 4BMEA 3ZR6A 1V9U3 2Y6JA 3OUHA 3MDPA 4NWWA 5FREA 1DGRA 1B35B 1REEA 1X33A 5A7WB 3VZMA 1XE0A 4C1XA 5JXGA 3OPZA 1VIWB 3VBSB 3DECA 2VPVA 2ZAHA 2ID4A 5DUXA 1WD3A 4FP2A 1PO11 3LEMA 1QJY3 1ULOA 3FBYA 4AFBA 4BXSV 3WNPA 1AR72 2ADDA 5T3NA 1WCSA 1FI2A 1LGCA 3POGA 4XHBA 4B7EA 1UX7A 4FO9A 5FYIA 2VUJA 2VM9A 4BQXA 2PMWB 3ZX7A 1ZBE1 4S2DA 2DVBA 1PGW2 5I8SA 4ASMB 5C3RA 2WO3A 3WW3A 1RUG1 1WUVA 4FPKA 3DUIA 4L11A 4N9HA 4E8DA 1UU4A 3IAPA 1WLWA 3RZZA 5FZMA 1SEFA 3NNGA 2HWC2 2RHPA 4HVQA 3KF5A 3EMRA 4HOOA 1YI7A 1UY4A 4LKFA 4NOTA 1IQDC 1LTEA 2X5IA 4KI5M 4XEZA 1LR5A 4COVA 1C5HA 3AZZA 1F5JA 1JZ5A 3VD5A 4QDSA 5A3PA 1BMV1 1IGOA 3VDDA 1D7PM 4CEYC 2VVFA 1W9FA 4E2QA 3MIEA 2BP6A 2PAEA 3MEPA 5A3UA 3FHIB 1N47A 1EV12 5C7GA 3OOXA 4HK8A 4RL7A 4XVHA 4UFMA 3JZVA 4BU2A 3VBOC 3BPSA 1SLLA 1AR63 2A5ZA 4QGLA 1D0GA 1MS9A 1COV2 4QT6A 3LEIA 4ZXKA 1S2EA 3I7DA 4CEYB 1RXGA 2W92A 3V64A 2GNTA 2OYZA 2W87A 1XE8A 2D6MA 1IS6A 1NLSA 4QX7A 2R1BA 1GOFA 2F17A 1YHFA 4J1WA 1FOD2 3CHXA 3IDBB 3VBOB 2BOIA 2YYOA 3G6JB 4IEXA 1UCXA 4RR3A 3I2DA 4NRMA 3ACIA 4K1ZA 1D4M2 1YQ5A 2P5BA 3A4UA 1YQ6A 3QCWA 1DF0A 4GH4C 5EFUA 5GLTA 4CXYA 1JXNA 1QJX3 1HXS2 2Q1ZB 5CFDA 4I0AA 4I09A 5I0DA 3IB3A 2EXHA 2WNUC 2OXBA 3S30A 1DQ1A 1RMU3 2RVAA 2VECA 2DTYA 2WZPP 3V0AA 3WP5A 2QDNA 3DCQA 3JUUA 2XG3A 3E5UA 4R52A 4F8AA 2WS93 4GH4B 2B9VA 2QQJA 1ZZ8A 4MHUA 3FFZA 3THCA 2R30A 2XVKA 4NIGA 2VO5A 2C0ZA 2WNUB 4ORFA 4H55A 1MS3A 4LBJA 3THDA 2EIDA 2NPIA 3RZMA 5FY1A 1RITA 2LROA 3MW3A 4XJAA 4JTNA 1DLCA 4BWOA 1RUC2 3A22A 3HQRA 2TBVA 3O12A 2D5FA 1TMF3 3VZLA 4CCEA 3R0RA 4HXCA 3MF9A 3ZSKA 2EAKA 3H1MA 5FYBA 1OOPC 4RN5A 3POYA 1NT0A 1QIQA 1G9FA 3L2YA 3GZTB 3VZJA 2HWE1 4D6SA 3D3AA 1YQCA 2WT1A 3OGGA 3M7AA 3ZFEA 4ATEA 3RZLA 4LBQB 5D2AA 2TNFA 4DUXA 1FV2A 1FV3A 1OOPB 1ZRRA 5FMCA 3NJYA 3WINE 4CPBD 2GC1A 3HMYA 3LOIA 1HDKA 1R082 1M4WA 1VBA2 1J3RA 1UQXA 1AR91 4TTGA 5GALA 3WV6A 3VKNA 5FZOA 2BGCA 4AI8A 1W04A 1ALYA 1YYNA 3U10A 4ES8A 5IAXA 3N3HA 3ZYGA 1I3HA 2D6LX 1OH4A 1GANA 2OQ6A 1MVEA 2PHUA 2QQWA 4XPVA 3DEMA 2D3SA 4AFAA 2ZTNA 4RHV3 1S0FA 1W99A 4Y33A 1S0BA 3USUA 4FOVA 5EQUA 5BY5A 5IVJA 2W1QA 3ZLIA 2VU9A 3SH3A 2YPDA 1QWRA 2Q1FA 3KV4A 3UV9A 2ZA9A 4JDNA 1DGWA 3SEEA 1C8M3 5DUWA 3BIWE 4GMP1 2WDBA 4JVAA 4Y5TA 3T3YA 3OEAA 5FAXA 2HWD2 2CGNA 2VBPA 1CZSA 2Y60A 2YUEA 1K42A 2FDJA 5BNOA 1UMZA 1Q8SA 2CY6A 1LRHA 4O65A 3M3QA 2F4LA 4URAA 1RUOA 1DBNA 3GZUC 2EIBA 4OFGA 1V6JA 4MOAA 3WSOA 1T6BX 4UAPA 4ES9A 4Q8KA 4FPOB 2JKBA 3WDXA 2BU9A 3BALA 4XBQA 2RMU1 1ZX5A 1LOFA 3OJBA 4PT6A 1NYWA 4D6QA 3B9CA 2EIEA 4CP9A 2HYKA 1PO21 4AI0A 2VMEA 4NMIA 1IS3A 3T4HB 3WF1A 5FYZA 2BQPA 4WM7A 3WY6A 1QHDA 2D97A 3UKTA 2WAOA 1FT9A 4INDA 3AYDA 3WHTA 4NN0A 1G86A 2TUNA 3POWA 5CKQA 4DEQA 5KWRA 3VZKA 4TLGA 4DFSA 1GWKA 4YM2A 5SV8A 4CU9A 2XQRA 2CSGA 2ZGPA 4OMCA 1W6NB 3BOWA 3PUAA 4Q4W1 5FY9A 1ZZCA 5TSWA 4AHYA 5J1XA 3E6BA 2ZEXA 4N9IA 3K75B 3MZHA 2FDGA 2E51A 1JHJA 3AP6A 1YC61 2V4AA 3IAQA 4QQOA 5DXDA 3ZSLA 3CO2A 1OQ1A 4LHNA 4DXRA 5C70A 2FZ1A 4FTEA 1HB4A 4XF1A 4QPGC 1DQ0A 1BXHA 2J1EA 1UXZA 4QWNA 4CDWC 2Z4FA 2AREA 1VBE1 5FY8A 3BU7A 5FUNA 3TYJA 4CVUA 4Q4X1 1MZFA 4FCAA 5FPZA 5CYYA 1CX1A 1DGRN 5C4WA 1ZBA1 3LIHA 1W03A 2QTWB 3RJ2X 3U37A 1KXGA 1GSLA 2QUOA 1W6OA 1YUDA 2E7QA 3PVEA 4W8JA 1OC1A 2GALA 2GAUA 3ZN6B 4CDWB 1JOBA 5E16A 3M3IA 1UY0A 4O61A 1PVC3 3MFCA 1W6PA 4EE2A 1CAVB 1CAUB 3HT1A 4MGZE 1XB9A 2GSYA 5GZEA 1OQDA 5H9SA 1OH3A 5AC92 1XRUA 1A8MA 3JBG1 5T5OA 2ZBJA 5LA2A 2EICA 5AFEA 4JZRA 5EYYA 1HN0A 3VBUC 1Y3TA 5IT6A 5AVAA 5C9AB 3TEYA 2SBAA 3I2HA 5FR3A 2HWC3 4AGGA 2OVUA 1CIWA 1VRH2 4OUMA 4QXBA 5FYUA 4V2WA 1UZVA 5IYYA 2AYHA 2WA3A 5FBJA 3UYJA 4TXWA 2FQPA 1LHVA 2JE8A 4LULA 4P5YA 3NKGA 5GLVA 2BV4A 4OHXA 3RYRA 2A3YA 2XQXA 5IAVA 3VV1A 5I8YA 1POV1 2H0BA 2FDHA 1O5LA 3GM8A 5A6XA 3I3EA 2E53A 2JDYA 4AI3A 4KWJA 4UT5A 3N9OA 4Q0VA 1OXCA 1H6YA 2XXZA 1WMEA 4EZ4A 5FPXA 4Q4V1 1EV13 3O1VA 4PJYA 4MVTA 2DUPA 1QOOA 2JD9A 4FOYA 5FPLA 3RYKA 4PDWA 1G9DA 2GMMA 3M3CA 1V9U1 2ZMKA 4XFGA 5DAQA 4CDXA 1UIJA 3JXSA 3WG4A 3VD3A 3VBRA 2IVIB 3BI3A 4NHYA 2NMOA 4IXLA 2JG9C 2HWF2 1QJY1 3U07A 5FJHA 5A7SA 3C3VA 3WUDA 3AK0A 4BIOA 1PZ8A 2BUKA 3WDYA 3GZAA 3ZFFA 5CADA 3J8F2 5IK7A 2Q30A 1W3XA 2ZX4A 1WZXA 5J7MA 1O7FA 4UI9L 4CP2A 3WEZA 3IDAA 1HXS3 1L7LA 2BEOA 4YW1A 5GJ6A 4GB32 3CJIA 1NUKA 2N7GA 2ZX2A 1S4CA 4V1PA 1PGSA 3ZYBA 4LHLA 4XJWA 5A80A 1VMJA 5HCHA 3NL1A 2H6BA 4ZKTB 1RYYA 4BJ0A 4CXXA 2D98A 4AVBA 4H2AA 2WYFA 3D5OA 3WZ1A 3PIGA 1JYNA 2VNVA 5DPNA 1VAKA 4EN7B 5KHKA 1NA1C 3ZN5A 4ASLA 1RUJ2 4E2SA 3AXEA 1VALA 5HCFA 5D8AA 3T2TA 4IE7A 1RUC3 2A6YA 2W1WA 3E6CC 4NE9A 2RR12 3HOBA 4P9YA 4B4QA 2IXHA 4A3XA 2B9UA 4PQQA 1LOGA 4CSWA 1WGPA 2XWBB 4M4RA 1NA1B 2BGPA 3FHAA 2JDMA 1NE4A 2AEYA 3TEXA 1E5IA 4BLIA 1XSQA 5IK5A 3U78A 4QKBA 2HH9A 1AR61 4NHXA 2CGOA 3POEA 5FZDA 4AOCA 4BYYA 5F9TA 5LBEA 5A3OA 3PUIA 3EJKA 5A7NA 3AC0A 2ZGUA 3H42B 1IS4A 3E1F1 3E5XA 1K45A 2J22A 3AMQA 1GZWA 1R083 1VBA3 5IVCA 4MGKE 3MIHA 1HRV2 3TRSB 3OBTA 4P9LA 1AXZA 4MSVA 3TN93 3VKFC 2K0GA 1JMUB 3PVNA 1UZZA 4AQ2A 3O0WA 1XQNA 2V73A 2J1AA 4FBFA 1C28A 4DUVA 5FYMA 1QJX1 4M3CB 4FPCA 1GKBA 1IPKA 3L2HA 2VQAA 2BW8A 3CJXA 1C3HA 5FPUA 1F8VA 1RMU1 4AFDA 3LDRA 3MFAA 2C1FA 4LO7A 4QB2A 3LA7A 1RUF2 4LLOA 2P6CA 2WS91 1G6NA 4XC9A 3I2FA 1UKRA 1J1LA 1N1VA 3EB7A 5KBFA 1IKPA 3PTRB 4IV1C 3GBFA 1RUD3 4AVAA 4I0WB 5A32A 5L19A 1YO8A 4YGCA 1VLNA 1RJ7A 2BWAA 1JU3A 1JZ4A 2AR6A 3P6BA 3H7JA 1XXNA 4GKXA 1TMF1 3U14A 4Q1PA 3RRDA 4EROA 3MV11 4IV1B 3VBFA 3H7YA 2E7AA 4LTAA 5FZ3A 1LOBA 1JS9A 1O8PA 1R092 3DKWA 3M4FA 4Y5SA 3ZN4A 1IOAA 3IPVB 3O1UA 4AQ6A 3OGVA 2QBXA 2DFBA 5DAWA 4YYOA 1EPWA 2FCTA 1C1FA 1W2UA 2HBTA 1Y43B 1MEC2 2Q8EA 2BOJA 5L7OA 3EXUA 5ABJA 1NCRC 2ARCA 2QE3A 2WZR2 3LE0A 3LDKA 5HCAA 4LEJA 4MX3A 3I2IA 3H50A 4FAGA 4JRLA 1Q8OA 1JYXA 2JICA 3N35A 5IK4A 5CG8A 3WXPA 1VBD2 3ZXKA 1MS4A 1LHNA 1LEDA 2GNMA 2RS13 1BLZA 3AFKA 5FOJB 1AZDA 5FYVA 4AVCA 3Q8BA 3RSJA 3D6EA 4QMAA 5F3CA 2X05A 5GZGA 4Y1UA 5T50A 4QQLA 1CN1A 5IVBA 2WT2A 1YQ2A 3KCXA 2XJPA 4QQPA 5FO9B 1MZEA 4QHOA 4YVWA 1UYYA 5C8CC 4RHV1 4K20A 4XFCA 4Y20B 3S6PA 3POSA 3A21A 5CG9A 2A6WA 3NJVA 4GWIA 1SLTA 3SCFA 3AKRA 1AR83 5C3QA 5A1LA 1HB1A 1XU1A 1C8M1 4CU8A 1OA4A 2JECA 1SCRA 4LBQD 5C8CB 1SMVA 1J3QA 2VZRA 5EIYB 2CDPA 4WZFA 3ITQA 2WZEA 4AI1A 3VDCA 3S57A 1GFF2 4XZUG 1KJRA 5CFCC 4LBLA 3RQ0A 1W6MA 1ZRDA 5JZGC 3CKHA 2WWSA 2VCMA 3CZUA 2WLQA 4HONA 5B4NA 5F6LB 1H6XA 4RFT0 3ZO0B 5FK7A 1JYWA 3B69A 1XNAA 3W21A 5CFCB 5FY5A 2ZEZA 3H8XA 1JYTA 2ZKLA 5C3SA 2CGPA 5LATA 2E26A 2OZ6A 2VOXA 3K3OA 5JZGB 5LEKA 4XF4A 3O1OA 3UJQA 1E5HA 5FP3A 4TWTA 2VMCA 4YW5A 3T0DA 5F5AA 4IGPA 2OZJA 1IZ3A 1TZOA 3U0ZA 4CDUC 4COZA 2B5HA 4JV4A 2OA2A 3B7MA 1TVGA 1Y9QA 2FBEA 2XJVA 3ILFA 1ND3B 1RUE3 4MXWA 2VCAA 3D4KA 2YU1A 4FT8A 1FXZA 2RM23 2VOWA 3N9NA 3DYOA 1W8ZA 4JGZA 3C7EA 1CAWA 4P02B 1EAH2 1MS1A 3IMMA 4I0BA 4P9WA 4COUA 4LO6B 1KFXL 4BK5A 5JWPA 4NAOA 5E6HA 4M0HA 5F5QA 3ME2A 1LU2A 1UZYA 3O1RA 1ZRCA 1LGBA 2WWUA 4FFGA 3FWEA 1I5PA 2ZOEB 4YVSA 1NG0A 2XMLA 3I59B 3NWKA 4FFHA 3ETPA 4OZXA 2VXJA 2HWF3 4XFBA 4FTSA 3VBHA 4LORA 4FOWA 1AR71 4MUVA 2YBSA 5EZWA 3WNNA 3WG2A 3J8F3 1V6OA 5F3IA 4JHTA 2JB4A 1O3TA 5BNQA 3RMXA 1US3A 1PVC1 4GB33 4L0PA 2WQZC 4LIUA 1CONA 1DGWX 2X53S 1PGW1 2RDQA 4NPMA 1PMHX 5L9BA 5IVEA 2XJSA 2ZX1A 5FZ6A 5ANQA 5IFTA 2WO7A 1VBB2 1PIV2 3H9AA 1PNFA 2OKXA 1S0CA 2DU0A 2G4IA 2HJIA 2HWB3 2HWC1 3AMNA 5BNNC 1OHFA 1RUJ3 1Q8VA 2MHFA 2R043 1QDOA 2Z42A 4PCRA 2Y6GA 2RS53 4BOWA 4LK6A 1LENA 1QXRA 5FYSA 1N3OA 4AGRA 2JG8B 3AB0A 1O4YA 3HPNA 5A7PA 2UY9A 1Q8PA 3LWCA 5BNNB 1I5ZA 1OFNA 3CEWA 4IERA 2P3IA 4E4DX 2P3KA 3AP7A 1QXPA 1RXFA 3P3NA 2VXRA 2RS32 4KGQA 1RVF3 3FBMA 4XURA 5EHDA 1EV11 4YG6A 3ON7A 3ZFGA 4AEDA 3GALA 1UZWA 2JJ6A 2WFF2 3HN3A 1RHI2 4XZPA 3AM2A 1HLCA 3D8CA 4H7MA 2VZSA 3PUSA 4OQ8A 4XUQA 2D3PA 4TSVA 2BZDA 2QJVA 2CL2A 4JKKA 4KBZA 3HNBM 1JHNA 5FZ9A 5I93A 1C5IA 1DZTA 2CWSA 3POBA 3AYCA 1A78A 2A73B 4CE8A 4IE0A 4ZU5A 4YW3A 4XJUA 5FPVA 5IJRA 1J59A 2KA3A 1PK6C 3JQXA 1S2KA 4K1YA 5LRSA 5F3GA 1OD3A 4QD2A 2WO2A 1RL3A 4Q27A 5K0UA 3BIEA 5FZ0A 1HXS1 1SDDB 3AJZA 1WA4A 4XILA 2K46A 4B8EA 4CUGA 1WKYA 2D6OX 4KMQA 4ARXA 5I8TA 3WLUA 1FNYA 1KGYA 2D6NA 4PBOA 3SH4A 3ATGA 5FLIA 5LWBA 3SEPA 1EYBA 1G8WA 1PK6B 5F5CA 1NCQC 3OGRA 5FQ0B 1BHGA 3J7MA 1MS8A 4AEMA 1WLCA 3H3UA 1OVSA 4GAZA 4LR4A 2DBNA 2ZCWA 2VUDA 1BKZA 1ZZBA 3WNXA 2PHWA 4B1MA 3SHRA 5J36A 1XSRA 2ZGRA 2OPWA 2A3WA 3KCCA 1RUI2 3PDQA 1IHMA 1NCQB 3AXDA 5E88A 5EV7A 1F31A 3FE5A 4I30A 5J09A 1RUC1 3F95A 2CHHA 2IXLA 3D0JA 4GULA 2IC1A 4JKLA 1TE1B 1MR5A 3I2GA 5SV5A 3ZFFB 4AEKA 4YZ2A 2H0VA 1CAXB 1O91A 2BNOA 3OG2A 2NP0A 4JRAA 4QB1A 4QU1A 4RGGA 2JDZA 4CEWA 1FX5A 1QJU3 2QQVA 5FO8B 3RWNA 2VJXA 2D7FA 5HBAA 2P3JA 1AXYA 2B45X 2ZHLA 2ORZA 1FMD3 1W05A 3MPPG 4LIVA 4LHSA 4YG0A 4UW4A 2TEPA 3T30A 2B39A 1OT5A 3QLQA 3KSCA 4ISRA 2HBUA 1MZ6A 2J1SA 2ZS6B 1ENXA 1OUSA 1D0HA 1UPIA 4UFIA 4I2OA 2X8KA 1ULEA 1R081 4QX0A 1I6XA 1VBA1 4CXWA 4Z2AA 1VBD3 2RJ2A 1OLME 3C7GA 5JOZA 1ZZ7A 2NM1A 5K9YA 2BBVA 1AL0G 4TLFA 3TN91 5LA1A 3RPQA 2QFEA 4AF9A 1DQ2A 1W06A 1OLRA 4KBBA 4LQRA 4PF5A 5FBZA 3T2OA 1WCQA 1PM4A 4AQTA 2Y0IA 4LKSA 2VGDA 4LT5A 2ZHKA 4UFKA 3WQBA 4AHXA 1RJ8A 3K4ZA 3PJQA 2W52A 4LMFA 2XLAA 4N43A 5DUUA 5KXDA 1R1A2 2A6VA 1GQHA 4KWKA 4M0NA 4I01A 5IATA 4AAPA 1SFPA 1BK1A 1RUD1 2I74A 5HXVA 3VDDC 2VMFA 1FATA 3KB5A 1B35A 2QQMA 5BPXA 5A7WA 5EXOA 3AKQA 1WCUA 5FXXA 5F39A 2WABA 4BQ3A 1O4TA 2PYTA 2E32A 3FLRA 4NAMA 2R072 3MGUA 4ZZ8A 4Y24A 4AFCA 5BNPA 3VDDB 5KHIA 4LOSA 3CF6E 4G3YC 2R062 2JDNA 4YWAA 1YFYA 1W0NA 1YQ8A 3H0OA 2V5DA 2ADEA 3X29B 1X8MA 1UWWA 4A44A 1H0BA 1PX3A 3W5MA 1I9RA 1NLQA 4RR3C 3WR0A 4OHZA 4K8RB 1JUHA 3K51A 2KM2A 4QXHA 1GOHA 5H9QA 2Z79A 3H3LA 4R4XA 5CFDC 3J9SA 3F2ZA 1Q3EA 3OTFA 2OPKA 4UF0B 4NIHA 5FY4A 3Q8AA 2CTVA 1IKQA 4NPRA 3PTYA 4OHVA 1LHUA 2RS11 1QXJA 2XB6C 4RR3B 1H8TC 4YM0A 2MEV3 2OW4A 4XDPA 4BM8A 1LCLA 4HVRA 2IWGB 1QNWA 4HPKA 3AJYA 1PMIA 5CFDB 4R9BA 5EYXA 1HKDA 1EAH3 1WD4A 2CWMA 1LHWA 1H8TB 2XHNA 4IETA 4CUBA 2UU8A 1AR81 1SCSA 2A6ZA 3M70A 3DGTA 4CP1A 3W58A 2YC2A 1RIRA 3LEKA 4K3UA 4CEYA 5I91A 2D6KA 4D7YA 2GP5A 3O1TA 4FSJA 1OBNA 3NKTA 3H3ZA 1JUIA 2C5DA 4E9KA 2R1DA 2H6CA 1TNRA 4EWEA 4UBHA 3ZFEC 1SLAA 2YG0A 4W4ZA 1GMMA 4W6XA 3IIIA 4QPIA 1RUH2 4WM8A 3W20A 1XNTA 3WQ0A 3R4UA 2QQLA 1JODA 1ST8A 1NQJA 2PHXA 2FMYA 1H1AA 2Q1MA 3LPGA 5FZLA 1W9WA 4EWAA 5CAZA 2FD8A 3OPWA 3K77A 2LTNA 1YNAA 5JOYA 5GLWA 3ZFEB 3GHNA 2FCUA 4COYA 1PIV3 1LNSA 4AVSA 4YSFA 4HFSA 2OIIA 4LHKA 3NNFA 5ACA2 1O3RA 1OLMA 5CIRA 3BTZA 4GH4A 3HBKA 4Q0PA 1WWYA 3P1IA 2IXKA 2JE9A 3OY8A 1JOPA 1S1AA 2R49A 4GA9A 4Q0SA 1IG0A 5M0TA 4DXZA 2ZGNA 5JPMB 4D69A 2SLIA 4MADA 1X36A 4GALA 5FZOB 3WHUA 1RUE1 2D43A 4X8NA 2QKDA 5FZ4A 2RM21 4JTOA 1IQAA 3ZKYA 4QX1A 2WUHA 3OCPA 1AYM2 2O8OA 3K4AA 5FYYA 4Y1ZA 4GZ9A 2XUEA 4RGAA 4K6BA 4LNVA 3USUB 3K2OA 1U5ZA 1Z78A 1K12A 4RQPA 1DQ6A 3LD8A 4XFAA 4Q4Y2 5BNOC 5A70A 3S0MA 1D2QA 1P8JA 3FZ3A 3ZDSA 3HEIA 3ZSMA 4AK3A 4ZY9A 1D4VB 2VZOA 4LBQA 3ZYJB 3BB6A 4RS5A 2HWF1 4U36A 3RYPA 1PNGA 4S2GA 2F6BA 5K7PA 2QNKA 4CDQC 3ZSJA 1SZBA 3KV5A 2VY0A 2YU2A 1LOFC 3J8F1 1NXD1 1XNKA 1UOJA 3GBWA 5BNOB 5J96B 5JDBA 2JENA 1JYVA 4XXPA 4GB31 1AJKA 2XJUA 1NXMA 2ARAA 1MS0A 2UYAA 2GMEA 4DB5A 1L3JA 4WM7C 3WDUA 3N9MA 2X10A 3JU9A 1BBT3 4CDQB 4XF0A 1JYCA 1ODNA 1U5IA 1PHMA 2ET1A 3GF6A 4OI1A 4CCMA 4LJHA 5FTTC 2JE7A 1H8VA 3K46A 4CP9B 5AFBA 1GYKA 3IZOA 2ZMNA 2O14A 4BQ2A 2G19A 1WA6X 2HWB1 2ZEYA 3A0NA 1LECA 3HQXA 1RUJ1 3R4SA 2R041 1GOGA 3AMHA 1RUG2 3I3MA 3N9QA 1J1TA 2RS51 1HQLA 4YM1A 3THPA 2YFUA 2XWJB 2Y8KA 3GGLA 4FFIA 2QQKA 4I02A 3FMGA 1AHSA 1VP6A 4YM3A 2ZHNA 2RJLA 1IS5A 1CWPA 5FLHA 4FXKB 1RVF1 5C4WC 1DYOA 2J1TA 1QOTA 1QF3A 1UPSA 1RGSA 4LE3A 4UW6A 4XW3A 1BMV2 2C4XA 3OBRA 2PTMA 2VZUA 3TNQA 3VGIA 3N9LA 3CZJA 3IM0A 3RMYA 1BCXA 2PHDA 2VZPA 1H9WA 3P5BA 1DP0A 3KMHA 2G9FA 4ZZ5A 1X9TA 4QX2A 5C4WB 3FFQA 1HB3A 2ZMLA 4I3GA 2WNEA 3ES1A 1KS4A 4OYUA 2QQOA 4P9XA 4LO4B 3DPRA 5C3PA 2UYBA 3I3BA 4LBMA 4QM9A 4QQ2A 3OGJA 3RJRA 4KG8A 3ST7A 5K8SA 2FDFA 5BXXA 4XUTA 4KWLA 4JQTA 4DY5A 1AR73 4D6RA 1H4HA 4G9SB 4NWVA 4QPGB 1BZWA 3B5LB 3GCWA 2VZQA 4B4RA 4XUPA 3S5AA 2CU5A 5GM0A 3ZYIB 4IEOA 2PHTA 1N1SA 1R1A3 2WT0A 3LSEA 4R9AA 2ES3A 5A33A 4FTBA 3VDBA 4QKNA 3N7KA 3UL2A 2D6PA 4K9SA 3IWZA 4UWDA 1SDWA 2PQSA 3PMSA 3RVHA 4D0QA 3OBZA 3MLKA 1DYKA 4XAEA 1GZTA 3GDBA 5I0UA 2G9GA 3KVBA 3NAPA 4O9GA 4QX5A 4C8DA 4XF3A 1GZ9A 1MQTA 4AWDA 2Q8CA 5J3UA 5FPAA 4XAAA 2ZXQA 4HSLA 1BVP1 4N90A 5JXIA 4WVZA 2R073 4PDWC 1YXWA 1Z0HA 2DVGA 2LW8A 2XBO2 3KWVA 4KG0A 2Q5TA 4CDXC 1VMFA 4K7JA 5C71A 3KS7A 1QJU1 3OSDA 5DAVA 3VBRC 2GDFA 3PL0A 4NRPA 3MI8A 2ZGOA 1VB2A 4IE6A 2Z69A 2DVDA 1GQGA 1FMD1 4PDWB 3H1WA 2HWE2 5BUVA 3WW1A 4CDXB 4KQ7A 1NY72 4M3CE 4FPHA 1GWLA 1DQ5A 3VL9A 5KR7A 3VBRB 1COV3 1ULPA 5LK5A 3HWJA 3ZXFA 1SHWB 5C9AA 3ZM8A 4HLTA 1WMDA 1ZA4A 1VBD1 3B94A 3R6SA 1X82A 2VNRA 2DBIA 1ZVFA 2IVJA 4OUEA 1DYPA 1FOD3 2GN3A 2E63A 2Z5WA 2Y33A 2XLGA 4IEWA 4WVMA 1OKOA 3HNYM 3MV01 3PMEA 4LKDA 1F9KA 2RDNA 4UFJA 3IN9A 4DEVA 2BERA 1D4M3 2DURA 4AFMA 2WN2A 4OI2A 4Y26A 2Q8DA 4GKYA 2XLFA 5D8AC 1TNFA 4FPGA 3VD7A 1FPN2 4A4AA 2JG9B 3AP4A 2R6QA 1ND2C 1O5UA 1C4RA 1OMIA 1VE0A 4WV8A 4ONUA 4JHZA 1ULCA 3OYWA 2JX9A 1X7NA 4C90A 1JYIA 1WW7A 1IG3A 4BE3A 3V0BB 1PGL2 3UT0A 5FMDA 1SFYA 5T5LA 5JLVA 4EQVA 3PVOA 3PNAA 3WNKA 2V5YA 2Y26A 5FZAA 1KS5A 1ND2B 4X8PA 4YZ1A 3KGLA 4HZFA 5F7UA 4AVVA 3AKTA 5FZKA 5T54A 1RUH3 4K21A 4W6YA 5CKNA 3B93A 5I0SA 4W6WA 1IPSA 3PLQA 1GQPA 1UU5A 1Y9GA 2OX0A 1M06G 4KNCA 3AVSA 4XE9A 5F3EA 4CP0A 4ZXEA 1XYPA 5JOWA 2L9LA 1X8EA 1MPXA 4P9GA 2DUOA 2DCYA 3KQRA 4QHZA 5FUIA 4AW7A 1W8TA 4RA0A 4BQ4A 3MIBA 5A1AA 1GR3A 5FIXA 5ACA3 3E97A 3NV1A 3RZHA 2RMU2 1TG7A 1BVVA 1STMA 4FFFA 3WCRA 1S2BA 4BB3A 2XR4A 1GZWB 1C8NA 3C7FA 2IFRA 4B4PA 3DXUA 1TME2 4OQ9A 1ODMA 4AHZA 1DG6A 5KC6A 3WG1A 1G9AA 3KHCA 2MEV1 4IEPA 3OPTA 2P2KA 2I2SA 2C9AA 5D1IA 5FXVA 2WA4A 4P5HA 4IDZA 2OUJA 1AYM3 2LM3A 1XC6A 3CU7A 3GJAA 3OD4A 1EAH1 3HIFA 1LGNA 5E89A 5A7QA 1DGLA 3VUOA 4Q4W2 1QH7A 2XHKA 4Z07A 4HVOA 5F2SA 2YC4A 4Q4Y3 2VULA 5FY0A 4DNYA 1KRIA 1ZM1A 2YC0A 3VBFC 3ZXDA 3TOJA 3SITA 1OF3A 5GKAC 4RD7A 1HQNA 4F7ZA 5HXMA 3WD5A 3LCPA 1VBE2 4IE5A 5FYCA 5DZGA 2UWBA 3PU8A 2YBPA 4JX0A 4Q4X2 1VBC2 3DV8A 4R9CA 1PVXA 1ZBA2 3MW4A 4UW3A 4Z8BA 2HWD3 2Y34A 3MIFA 4PF1A 3IBMA 4NHLA 1CIYA 3PJYA 1DZQA 3OGSA 4FXGB 5L7OC 5DUVA 1EUTA 5ABJC 3KHBA 2VZTA 1F35A 4ZU4A 1K5MA 1CJPA 3VKLA 5C5TA 1AX2A 4XIKA 1ZRIA 2WQ8A 1RUNA 1QH6A 3FN9A 2X09A 1PIV1 2CDOA 3VB9A 4R4ZA 4AL9A 2VQTA 3JBG2 3PVBB 5L7OB 5ABJB 3KT4A 2WZ8A 5IK8A 2NZ9A 3I3DA 2FZ2A 4RSUA 4XFIA 4XABA 4YLZA 1S0DA 1Y4WA 2IZWA 1CJDA 1W8UA 3HNMA 4MGQA 4YVWC 5DN2A 3ZPOA 1NQDA 2XONA 4XBNA 3LGRA 1HJFA 2MPFA 4B7KA 3WVJA 1U5YA 4GIQA 4EJRA 2WL1A 4FQ4A 2BGOA 2W2IA 2B4KA 1Q56A 1BJQA 1WCKA 2QZ3A 1SACA 4OI4A 4PIZA 3HBZA 4QPYA 5BYNA 1APNA 2JDPA 1NCRB 3WDVA 4AE2A 2ZACA 4YVWB 4CYDA 3AP5A 1JOJA 3BODA 1UXXX 4QKFA 2JD4A 2VMDA 3RG0A 1JZ8A 4XXAA 1UAIA 2C6SA 3KF3A 2QQUA 2B46X 1UOBA 2VE1A 2BRTA 2WIIB 1GP6A 1RTVA 4Q29A 3T2PA 3ZMNA 1V9U2 4IGQA 2JIGA 3KV6A 4XBLA 1GNHA 5IWFA 4YW4A 4R9DA 4LKEA 4YW7A 1CVNA 4P9JA 2E9QA 3J7LA 2IXCA 4YW2A 1LESA 1O59A 1XYNA 3DXTA 2GU9A 1OA2A 1SBDA 2BWCA 1W6MB 4H14A 4Y1XA 4E8CA 3BUCA 2D44A 5EJ3A 3BU0A 1AYN2 3BVCA 4ZPIA 1BBT1 1Q8QA 1XBFA 4S2FA 4UFHA 1V70A 5ANNA 2GC3A 3WDWA 2YY1A 1KJLA 5L9RA 3LFMA 5AC93 1LULA 4Q2FA 4HBNA 1KEXA 2VOVA 2GMPA 1URXA 1Y9MA 2K2SA 4L9BA 4U2AA 5B4XA 4Z2WA 4ZHNA 4Y20A 2VAUA 3O1SA 5AVPA 4OZOA 1TQ5A 3DYMA 1X50A 1US2A 4M4PA 4CPBA 2AC1A 1JZ7A 2XL7A 2FCVA 1SG3A 4PHZA 1VRH3 2YROA 5LCWL 3AKPA 3NV4A 3BCWA 3M1HA 1WBLA 1UX6A 2XBO3 1ZYBA 4GJYA 5HCBA 3VLBB 3Q9OA 4CCKA 4GWNA 3R4DB 4MXWB 4FAHA 1V6NA 1LOEA 1OI6A 4YVSC 5L73A 3GBGA 3O5SA 4YNIA 3VBHC 2C9KA 4CTEA 1U5XA 4DQAA 1XNDA 1YJLA 4LK7A 3HQUA 2ETEA 4Y22B 1QNYA 1FAYA 4QX3A 2QQPA 5DG1A 3PIJA 3LKJA 1HW5A 1LB2A 4CDUB 2AUYA 2ZGMA 1N3QA 1YFWA 4P14A 5D21A 4YVSB 4AYUA 3NMBA 1K3IA 3HAGA 3VBHB 5IHRA 4UYBA 5JIUA 4XQ4A 3S7EA 5L9VA 1RB8G 4JGYA 4N53A 3GXUA 2WNVA 1KD7A 4H3WA 4E4HA 1JW6A 4AZZA 2Y64A 3FLTA 3LSDA 2A70A 1GWMA 2ENRA 2Y6KA 4YZ3A 2BJSA 5BV6A 1LAJA 1ASJ2 2O8QA 1QMJA 3KD4A 1ND3A 2EVXA 3TEWA 1W9SA 2ARBA 2UY8A 1FPN3 1PZ7A 4ZS2A 1QJX2 1R1A1 4FOQA 3RNSA 2ZX0A 2OUHA 4TYSA 2PAMA 3GZEA 3RFRA 1V6IA 4XJZA 4A6OA 4LOTA 1NLRA 2R16A 1AX0A 4UOJA 1LODA 1NZIA 3B00A 5FXZA 3ZFGC 4IEUA
chains in the Genus database with same CATH topology
2UURA 5GZFA 3G7DA 1HRI2 1DLLA 2R071 2ZGSA 4QM8A 2WQ4A 2RR13 1J58A 3QH6A 4FPLA 4META 3B9IA 3MW2A 1I1EA 1A8DA 3ZFGB 1AXKA 3BTAA 4MH0E 1OLQA 3VHOA 4OHYA 3JB8A 3PHMA 4FQZA 2DWRA 3JCIA 5K0UC 1COV1 1Q43A 1MS5A 1DZRA 1WBFA 2EXIA 1TME3 4HMZA 4WVWA 3M3OA 1FOD1 1G9BA 1J3PA 1PM7A 1HRV3 2XVGA 2IFWA 5K0UB 3SXWA 5A3LA 3RS6A 3APBA 1PZ9A 4GWMA 4BCUA 4XMIA 4E4SA 2JG8A 2V09A 4A2UA 1D4M1 4YFWA 3ROUA 4HSJA 4GMP0 2DYCA 2HEYF 4IV3A 2BFUS 2R0HA 2EF6A 3TNPB 3IMNA 4B29A 1H1MA 1NOVA 2I45A 1RUF3 4YZ5A 4JDMA 3UKVA 1CD3G 2VG9A 4F3JA 4K8FA 3AFGA 4CEWC 4NHMA 1YFUA 2RJKA 3FUQA 3S7IA 1VBC3 2EXKA 3FUOA 3WP3A 3AYEA 3VHRA 3ZMOA 1QKQA 4QU2A 5L36A 4R8HA 1RUH1 1AL22 2E6VA 5JVVA 1QU0A 4CEWB 3WG3A 1YIFA 2BNMA 2MNGA 3WDTA 3MF6A 1R093 1SBEA 1HV0A 1W6QB 3HT2A 1SFNA 1LOCA 3WT3A 3ZXLA 4MGYE 4OVEA 4OUSA 5ACA1 2BPA2 4YG3A 1MEC3 4XFFA 2PN5A 1BEV2 5E8AA 2WZR3 2ATFA 4AGVA 1CX4A 4XJ8A 4QXKA 3E6DA 4FP3A 2Q8OA 1TEIA 2QZ2A 5E1RA 1D2SA 3W9AA 3ZFFA 3SLIA 3QD6A 1OA3A 1AYM1 1CAXA 4GQ7A 3KGZA 4FPEA 2PFWA 5DZEA 4HKWA 1W39A 1B35C 3P3PA 4HT1T 2UWAA 3WP4A 4K40A 3VKMA 1XNCA 3N36A 2EA7A 4IEQA 2P34A 4Q4Y1 5CB7A 1LEMA 2X5IC 4W65A 2VNGA 3KM5A 4BH9A 1AF9A 4PLNA 2Y38A 2A7AA 1S55A 2XGXA 2HWD1 3ZIWA 1RC6A 4DINB 2DVAA 2X5IB 3VBSA 5F1RA 1QOSA 3WW2A 1AYN3 1FYUA 3M3EA 4YGDA 4J1XA 3THTA 2R32A 1PVC2 1CPMA 4MV2A 1Z7S2 1OFSA 5CBLA 4HK9A 3VZNA 1VR3A 1POV0 4DPNA 1WW5A 5DDJ2 5JR7B 1C57A 5F6KA 2XVLA 2YZ4A 2D40A 5T5PA 2PHRA 2HEVF 4S2HA 2W39A 1H1IA 4JCKA 2BYVE 2ZKNA 5J48A 2VMHA 2PA7A 4AG4A 4HPKB 1WMFA 1UF2C 1XYOA 1NZCA 4AVTA 3TBDA 2VNOA 1QQP2 3SCGA 3O0XA 5FO7B 3OD0A 2PLV2 2DTWA 3V0AB 3MLLA 2RE9A 5T5JA 3NO8A 1JN2P 1N1YA 3JD72 4QPIC 3BPZA 4WM8C 5JSOA 3WP6A 4D7SA 4AEJA 3TAYA 2GH8A 1DDLA 4WVVA 3FLPA 3B3QE 2KXLA 3IKWA 3CLPA 1OPMA 4LBNA 3O0VA 4QGNA 1EPZA 3NV3A 2ZJCA 3AMPA 1LOAA 4QPIB 4WM8B 1ASJ3 4X6QB 3VBOA 2ZZQA 2D93A 2Q0AA 4UW5A 3AZYA 2DCTA 5FFOC 5AC91 5C8WA 5LEJA 1H30A 1A6CA 1GZCA 4HANA 1H8TA 2DV9A 4ZU7A 1VBB3 2DCJA 4XTPA 1ULGA 4NHKA 4LE4A 4XQDA 3OY8B 2AH2A 1QJZA 1VRH1 3NW4A 5JIAA 2IXIA 3HN1A 4MXVA 1DQ4A 1LKNA 1HRI3 1DIWA 4AXOA 1DHKB 2XBO1 2WNUA 3T1LA 1G9CA 4RQPC 2WSVA 3ZIXA 2YMZA 2DVFA 3QH7A 5KHGA 4XTMA 4KL1A 4B3NA 2ZAAA 4RS5C 1N1TA 1BQPA 2RS33 3M8LA 2DCKA 1ZZ6A 2WFF3 4H7LA 1NY71 4RQPB 1RHI3 3NVCA 4HETA 3VL8A 1LJ7A 4XJ9A 5A3MA 2XKOA 4RS5B 2W08A 4LBKA 2EALA 3WOGA 3ENRA 4XYXA 4Q0QA 2PHFA 4FPFA 1JH5A 4N7IA 5CNAA 4PQ9A 3USSA 1OOPA 4IESA 2ZGLA 1QDCA 3TN92 1PO12 3LAGA 1FPN1 4L92A 3WQ1A 4SBVA 4HKOA 5FMOS 3TWIA 4KU7A 3NV2A 2VW0A 1PGL1 3I4IA 4LUKA 3ES4A 1ZBE2 4UXAA 4KGGA 4WM7B 3VN4A 1RUD2 3WW4A 1RUI3 3AZXA 5GZDA 3ILRA 1AL23 1YLLA 5JMCA 2RR11 1HV1A 1XE7A 5J98B 3EQEA 3MLJA 4A7YA 5JI9A 2VW1A 2VVDA 4QHBA 3QOPA 2ARXA 1W0OA 3DPRC 4IL7A 4CDQA 3ETQA 2VVEA 4YZ4A 2BNNA 3UK9A 4DRVA 3QBQA 4MZUA 1ULDA 3KZ4C 1BEV3 2NLRA 3UJOA 5LRRA 3DPRB 1CGPA 4MGIE 1TME1 1F2NA 4OLLA 1RINA 2P17A 1HRV1 4D3WA 1UL9A 1W6OB 2XUMA 2RS12 2PHLA 4XQWA 4D94A 5BNPC 3LB9A 3LA2A 3NAPC 5JSPA 4AHWA 1W6PB 2NMNA 1MQTC 1UW8A 2GNDA 4LA2A 1AVBA 5A33B 1W6NA 2DU1A 2ZGQA 1RUF1 2DCZA 2FMDA 5BNPB 5KC5A 3NAPB 1ENSA 1OD5A 3J26N 4A7ZA 3SCHA 4Q26A 3INAA 5FCCA 1UKGA 1MQTB 2GH2A 1VBC1 2XKPA 2YDEA 3V56A 1AR82 2NYYA 2EAAA 4PBPA 4E27A 1WW6A 1S0IA 3ILNA 4BHPA 1V6KA 3ZXJA 4FVVA 1MVQA 2YHJA 5C9AC 1VAVA 1R091 1V6MA 4QPGA 5DZFA 3ZN6A 1Z7S3 4CDWA 2R063 1ZRFA 4BIFA 5JPNB 4LBOA 3SH5A 1E57A 1KITA 4EN0A 5DDJ3 1CAVA 3ALQA 1GBGA 1CAUA 4BZ4A 4E2GA 3EBRA 2ZGKA 1MEC1 2YPJA 5FDBA 4QQHA 1KDKA 2WZR1 2CNAA 1C1LA 3AP9A 3L9JT 4BA6A 3CJIC 3EHKA 1ZREA 4WVMB 1UIKA 3MYXA 2YV8A 1KFUL 4XMAA 4C1WA 2B42B 1OPOA 3KLSA 4M00A 4SLIA 2AGSA 2GC0A 1SBFA 2XJQA 4JC1A 3VBUA 1RUE2 1QQP3 3CJIB 4BPZA 1AR92 5GZGA 2RM22 2LALA 4HL0A 1H2LA 1GLHA 4G4FA 4M3CF 2ERFA 2PLV3 3GYDA 2K9ZA 4F83A 3OYWB 3N7MA 3JD73 3O14A 1YWKA 5CU1A 1HQWA 1WW4A 4YARA 4Q0UA 4NR1A 3U11A 1SLCA 4PLOA 3UKNA 2WINB 2WJSA 4Y1YA 4E4ZA 5D8AB 2DUQA 2XJTA 4HN0A 3O7OA 5LK7B 5JCTA 3MIDA 4X6RB 3VHPA 1MZ5A 1H2NA 2PELA 1T6GC 1AYN1 3WX5A 5JAXA 1H2MA 2BVBA 3WCSA 5IUQA 2A71A 4OI0A 5GZCA 3U4XA 4FPJA 2B7YA 1G7YA 2W68A 4AQSA 1Y7BA 2JG9A 4JDOA 1MACA 1O3QA 1S0JA 4LA3A 1H2KA 3J4UH 1YIPA 2WKKA 2O1QA 3V0BA 2HWB2 4JQRA 5DG2A 5T55A 3AYAA 2R042 1PO22 2NN8A 4BMBA 2WSUA 2RS52 4EN9B 4DS0A 2PAKA 3H8UA 1ND2A 1SLIA 4DZGA 1YI9A 3T1MA 2Q4SA 2A6XA 3ZXAC 1VAMA 1YFXA 1R1ZA 2VMIA 3I8TA 3LOBA 1ZZ9A 1NE6A 3HR9A 1CR7A 4XOGA 5JI7A 5FLJA 4IEYA 1RVF2 1NA1A 2EIGA 2BVVA 5H9RA 2D5HA 3IIAA 2XL9A 4YRDA 2FHRA 1GNZA 2X29A 1K5MC 4WZCA 5A32B 1CESA 1KQRA 2A75A 3K48A 3CNAA 1Q5OA 3A0KA 4O9EA 2HKXA 5I0TA 3RI8A 1AUYA 1ASJ1 1CQ9A 2CYFA 1PO13 1S0EA 4I3PA 2VMGA 3VBFB 4XDQA 1K5MB 3SNMA 4IEVA 4CRQA 2ZZJA 3KCYA 1XNBA 4D7TA 1WCDJ 5T52A 4M3CA 1V6LA 1ONAA 2Z2SB 1ZBE3 5CVRA 1VBB1 3ZXEA 2XH6A 3I54A 3ZYRA 1BYHA 2VH9A 1RUG3 1U0AA 3ECQA 2YGLA 2P37A 1HRI1 2ZGTA 1F5FA 1JBCA 2AZ5A 5CA6A 1ENRA 4BLJA 3DF0A 3GNEA 3D0SA 3BOPA 2XPJA 3WQ7A 2RS31 2DFCA 4Q1RA 4Y4YA 1IPJA 1QJU2 4IV1A 3V65A 4HKLA 4MYEA 2BFUL 2WFF1 1RHI1 3KT1A 3IDEA 3IPVA 2Y0OA 2BTVC 3WUCA 1REFA 1AX1A 4Q4V2 2A3XA 1FMD2 2R0FA 1UD1A 4FPYA 3MPBA 3DL3A 3C2UA 4NO4A 1SLBA 2B8MA 2CAVA 4J6GA 4OULA 4XFHA 2EXJA 1XU2A 4HN1A 3GHMA 2VUAA 3M2MA 2F4PA 1GV9A 4XIOA 1SQ4A 1N3PA 3FX3A 1V00A 1QJY2 3D82A 3N7JA 2JEMA 3FC0A 3N7LA 2WLPA 1DFQA 1NCRA 1ULFA 5C33A 3NSTA 2ZPXA 1A3KA 4IEZA 1KDMA 4Z82A 3URFA 3AMMA 1RUI1 4JGZC 3ZPYA 1AL21 1VB4A 2VQ0A 4KH9A 5B2GB 3B01A 1ENQA 5C8CA 1FNZA 2WC2A 3AZVA 4KU8A 1HX6A 2ZHMA 4MLOA 4JGZB 2UWCA 4JAAA 4L97A 4N7UA 2DF7A 1CAWB 4JGYC 4N53C 1WLDA 4XETA 2VOKA 4LUMA 2WNVC 4AI2A 1W0PA 1LHOA 3B02A 1BEV1 2HWE3 5KHHA 4QGMA 1UN1A 1ND3C 1HIXA 3AKSA 3R05A 2O0OA 4COWA 2I07B 4JGYB 4N53B 4P9IA 1AR62 5CFCA 1O4ZA 4DY3A 2WNVB 1YJKA 4LO5B 5JZGA 4CZSA 4ISQA 3JQWA 1UU6A 1QY4A 2MEV2 2IXJA 3LZZA 1LU1A 2ET7A 1AR93 3NJZA 4BQ1A 4EV0A 2QCSB 4PIXA 5I0RA 3CL1A 3VKOA 2YXSA 4XF9A 2ZABA 4YGEA 4Q8LA 2QVSB 4PIYA 4LO8A 2LUWA 4Y22A 3RI9A 4DMIA 2HEWF 3IDCB 1JTZX 4CDUA 1YRZA 2JXAA 1RMU2 3ASIA 2ILMA 4Y1VA 3VZOA 4PLMA 4C0BA 4XHXA 4DOUA 2WS92 4ATFA 3ZSEA 3N4MA 5FOBB 4AEDC 3I59A 3ZXGA 5JOXA 4IQPA 4GMP3 3ELNA 3KT7A 2ZX3A 1YCIA 4Z1VA 1Z7S1 5KHJA 2R061 1B09A 4C91A 1DU3D 5KXEA 1TMF2 4AEDB 5DDJ1 2W0XA 4EWDA 3IT8A 2JG8C 1AJOA 2RMU3 3LA3A 3RDIA 5KXBA 5J37A 5HI0A 1PO23 4IV3C 3EO6A 2GN7A 4L8QA 3H1YA 2XJRA 2YGMA 4M01A 1H9PA 2CAUA 1GICA 4WBBA 1QGLA 1WLTA 2VW2A 1QQP1 4IV3B 2E7TA 5BNNA 4LLFA 5GLZA 1H4GA 4Q4W3 2PLV1 3ZYPA 5KXCA 3JD71 1EY2A 3SISA 2PQQA 3AX4A 4RHV2 2CV6A 3TB0A 3ACLA 3MIGA 2GNBA 4Y5Z0 1VBE3 4Q4X3 4C0HA 4EN8B 1U12A 1ZBA3 2QDRA 3W59A 1C8M2 4Z92B 1O3SA 5C6CA 4ITCA 3VHNA 2NQYA 1ZNPA 1EP0A 4GXLA 3HD8B 3OF1A 3QACA 3SMHA 1BBT2 2D3RA 3ZFFC 3DN7A 3JBG3 3JB4C 1PK6A 4YGBA 2AENA 5FQ0A 4UBGA 2GC2A 3ZVXA 1REDA 4L2NA 4OHWA 4NVPA 3FJSA 1CPNA 4N43C 5JSRA 1NCQA 3E5QA 1OKQA 5H9PA 3MICA 1S0GA 5EWSA 5FRAA 1POV3 4TZDA 2WFPA 2GZWA 1W6QA 4URTA 4N43B 5FMOL 5GLUA 4Q4V3 3VBSC 4EN6B 1OQEA 1VJ2A 3AZWA 4L99A 4YFZA 1OSGA 4BMEA 1V9U3 3MDPA 4NWWA 5FREA 1DGRA 1B35B 1REEA 1X33A 3VZMA 4C1XA 3OPZA 1VIWB 3VBSB 2VPVA 2ZAHA 5DUXA 1WD3A 4FP2A 1PO11 1QJY3 4AFBA 3FBYA 1AR72 5T3NA 1WCSA 1FI2A 1LGCA 4XHBA 4B7EA 4FO9A 2VUJA 3ZX7A 1ZBE1 4S2DA 2DVBA 1PGW2 5I8SA 4ASMB 3WW3A 1RUG1 1WUVA 4FPKA 3DUIA 4L11A 4N9HA 1UU4A 1WLWA 3RZZA 1SEFA 2HWC2 2RHPA 4HVQA 1YI7A 4NOTA 1LTEA 2X5IA 4XEZA 1LR5A 4COVA 1C5HA 3AZZA 1F5JA 1BMV1 1IGOA 3VDDA 4CEYC 2VVFA 4E2QA 3MIEA 2PAEA 3MEPA 3FHIB 1N47A 1EV12 4HK8A 4RL7A 3JZVA 3VBOC 1SLLA 1AR63 2A5ZA 4QGLA 1D0GA 1MS9A 1COV2 4QT6A 4ZXKA 4CEYB 3I7DA 3V64A 2GNTA 2OYZA 1XE8A 2D6MA 1IS6A 1NLSA 2R1BA 1YHFA 4J1WA 1FOD2 3IDBB 3VBOB 2YYOA 3G6JB 4IEXA 1UCXA 4RR3A 3I2DA 4K1ZA 1D4M2 3A4UA 3QCWA 4GH4C 1DF0A 5EFUA 5GLTA 1JXNA 1QJX3 1HXS2 2Q1ZB 5CFDA 4I0AA 4I09A 2EXHA 2WNUC 3S30A 1DQ1A 1RMU3 2VECA 2DTYA 2WZPP 3V0AA 3WP5A 2QDNA 3JUUA 2XG3A