1V7OA

Alanyl-trna synthetase editing domain homologue protein from pyrococcus horikoshii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanyl-tRNA synthetase
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1v7oA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1v7oA01
1NYQA 1TJEA 1V4PA 1TKGA 1WXOA 1NYRA 2ZZEA 1V7OA 3KEWA 1TKEA 2ZZFA 2ZZGA 1WNUA 3RFNA 3WQZA 1TKYA 1QF6A 3RHUA 2E1BA 2ZTGA
chains in the Genus database with same CATH superfamily
1WZCA 4A09A 3I8CA 1XVIA 4XR3A 4ARFA 2Y50A 5FQDA 4A08A 3I7OA 3ZWKA 4XR0A 2IUUA 4AR1A 1QF6A 4TZ4A 2E1BA 4CI3A 3EI2A 4AREA 3I89A 4A11A 1WXOA 1NYRA 1V7OA 2B5LA 4XR2A 2ZZFA 4E54A 3EI3A 3WQZA 3ZTWA 2HYEA 3ZU6A 3ZW7A 2ZTGA 1NYQA 1TJEA 3EI4A 3I7NA 4CI2A 2IUTA 2IUSA 1TKGA 3I7HA 3ZWDA 4AR8A 2ZZEA 3KEWA 3I7LA 1TKEA 4E5ZA 2B5MA 3I7KA 1WNUA 3RFNA 4CI1A 4A0BA 3RHUA 4AR9A 2ZOSA 3E0CA 3ZTYA 3EI1A 1V4PA 3ZX4A 2Y3UA 3ZX5A 2I05A 3I7PA 2EWJA 3ZUPA 2ZZGA 1TKYA 4XR1A 2Y6IA 3I8EA 2I06A 1ECRA 4A0AA
chains in the Genus database with same CATH topology
1NYQA 4A09A 1TJEA 3EI4A 3I8CA 3I7NA 2IUTA 3I89A 4AREA 4CI2A 1V4PA 4XR3A 2IUSA 4A11A 1TKGA 4ARFA 1WXOA 3I7HA 2Y50A 5FQDA 4AR8A 4A0AA 4A08A 2Y3UA 2I05A 1NYRA 2ZZEA 3I7OA 3I7PA 1V7OA 3KEWA 2B5LA 3I7LA 4XR2A 4XR0A 2ZZFA 1TKEA 2EWJA 4E5ZA 4E54A 2B5MA 3I7KA 2IUUA 2ZZGA 1WNUA 3RFNA 3WQZA 1TKYA 4AR1A 4XR1A 4CI1A 2HYEA 1QF6A 4A0BA 3RHUA 4AR9A 4TZ4A 2E1BA 2Y6IA 4CI3A 3EI2A 3I8EA 2I06A 1ECRA 3E0CA 3EI1A 2ZTGA 3EI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  1TJE A;  1V4P A;  1TKG A;  1WXO A;  1NYR A;  2ZZE A;  1V7O A;  3KEW A;  1TKE A;  2ZZF A;  2ZZG A;  1WNU A;  3RFN A;  3WQZ A;  1TKY A;  1QF6 A;  3RHU A;  2E1B A;  2ZTG A; 
#chains in the Genus database with same CATH topology
 1WZC A;  4A09 A;  3I8C A;  1XVI A;  4XR3 A;  4ARF A;  2Y50 A;  5FQD A;  4A08 A;  3I7O A;  3ZWK A;  4XR0 A;  2IUU A;  4AR1 A;  1QF6 A;  4TZ4 A;  2E1B A;  4CI3 A;  3EI2 A;  4ARE A;  3I89 A;  4A11 A;  1WXO A;  1NYR A;  1V7O A;  2B5L A;  4XR2 A;  2ZZF A;  4E54 A;  3EI3 A;  3WQZ A;  3ZTW A;  2HYE A;  3ZU6 A;  3ZW7 A;  2ZTG A;  1NYQ A;  1TJE A;  3EI4 A;  3I7N A;  4CI2 A;  2IUT A;  2IUS A;  1TKG A;  3I7H A;  3ZWD A;  4AR8 A;  2ZZE A;  3KEW A;  3I7L A;  1TKE A;  4E5Z A;  2B5M A;  3I7K A;  1WNU A;  3RFN A;  4CI1 A;  4A0B A;  3RHU A;  4AR9 A;  2ZOS A;  3E0C A;  3ZTY A;  3EI1 A;  1V4P A;  3ZX4 A;  2Y3U A;  3ZX5 A;  2I05 A;  3I7P A;  2EWJ A;  3ZUP A;  2ZZG A;  1TKY A;  4XR1 A;  2Y6I A;  3I8E A;  2I06 A;  1ECR A;  4A0A A; 
#chains in the Genus database with same CATH homology
 1NYQ A;  4A09 A;  1TJE A;  3EI4 A;  3I8C A;  3I7N A;  2IUT A;  3I89 A;  4ARE A;  4CI2 A;  1V4P A;  4XR3 A;  2IUS A;  4A11 A;  1TKG A;  4ARF A;  1WXO A;  3I7H A;  2Y50 A;  5FQD A;  4AR8 A;  4A0A A;  4A08 A;  2Y3U A;  2I05 A;  1NYR A;  2ZZE A;  3I7O A;  3I7P A;  1V7O A;  3KEW A;  2B5L A;  3I7L A;  4XR2 A;  4XR0 A;  2ZZF A;  1TKE A;  2EWJ A;  4E5Z A;  4E54 A;  2B5M A;  3I7K A;  2IUU A;  2ZZG A;  1WNU A;  3RFN A;  3WQZ A;  1TKY A;  4AR1 A;  4XR1 A;  4CI1 A;  2HYE A;  1QF6 A;  4A0B A;  3RHU A;  4AR9 A;  4TZ4 A;  2E1B A;  2Y6I A;  4CI3 A;  3EI2 A;  3I8E A;  2I06 A;  1ECR A;  3E0C A;  3EI1 A;  2ZTG A;  3EI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...