1V7OA

Alanyl-trna synthetase editing domain homologue protein from pyrococcus horikoshii
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLELEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords alanyl-tRNA synthetase
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1v7oA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1v7oA01
1WNUA 1TKEA 1TJEA 2ZZEA 2ZZFA 2E1BA 2ZTGA 3RHUA 1QF6A 1WXOA 1TKGA 3WQZA 1NYQA 1V4PA 3RFNA 3KEWA 1V7OA 1TKYA 2ZZGA 1NYRA
chains in the Genus database with same CATH superfamily
1WNUA 4TZ4A 1TJEA 3ZU6A 4A0AA 3I7LA 3I7NA 4CI3A 4E5ZA 1ECRA 3WQZA 4XR1A 1NYQA 3ZTYA 1V7OA 1WZCA 2ZZGA 3ZX4A 4A09A 2HYEA 2ZOSA 3ZUPA 5FQDA 4CI2A 2I05A 2E1BA 2ZTGA 3RHUA 3I8CA 1QF6A 3EI2A 4A0BA 1TKGA 3E0CA 1V4PA 3RFNA 4XR2A 2I06A 4AR9A 4AREA 1NYRA 2Y3UA 2EWJA 3I7PA 2Y6IA 2ZZEA 2ZZFA 2IUTA 3ZTWA 3I7HA 2B5LA 3EI1A 3I7KA 2IUSA 2B5MA 4ARFA 4AR1A 4CI1A 4AR8A 4A08A 1TKEA 4A11A 2IUUA 4E54A 3EI3A 3I89A 4XR3A 3ZWDA 3I8EA 3ZWKA 2Y50A 1WXOA 4XR0A 1XVIA 3I7OA 3ZX5A 3KEWA 3ZW7A 1TKYA 3EI4A
chains in the Genus database with same CATH topology
1WNUA 4TZ4A 1TJEA 4A0AA 3I7LA 3I7NA 4CI3A 4E5ZA 1ECRA 3WQZA 4XR1A 1NYQA 1V7OA 2ZZGA 4A09A 2HYEA 5FQDA 4CI2A 2I05A 2E1BA 2ZTGA 3RHUA 3I8CA 1QF6A 3EI2A 4A0BA 1TKGA 3E0CA 1V4PA 3RFNA 4XR2A 2I06A 4AR9A 4AREA 1NYRA 2Y3UA 2EWJA 3I7PA 2Y6IA 2ZZEA 2ZZFA 2IUTA 3I7HA 2B5LA 3EI1A 3I7KA 2IUSA 2B5MA 4ARFA 4AR1A 4CI1A 4AR8A 4A08A 1TKEA 4A11A 2IUUA 4E54A 3EI3A 3I89A 4XR3A 3I8EA 2Y50A 1WXOA 4XR0A 3I7OA 3KEWA 1TKYA 3EI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNU A;  1TKE A;  1TJE A;  2ZZE A;  2ZZF A;  2E1B A;  2ZTG A;  3RHU A;  1QF6 A;  1WXO A;  1TKG A;  3WQZ A;  1NYQ A;  1V4P A;  3RFN A;  3KEW A;  1V7O A;  1TKY A;  2ZZG A;  1NYR A; 
#chains in the Genus database with same CATH topology
 1WNU A;  4TZ4 A;  1TJE A;  3ZU6 A;  4A0A A;  3I7L A;  3I7N A;  4CI3 A;  4E5Z A;  1ECR A;  3WQZ A;  4XR1 A;  1NYQ A;  3ZTY A;  1V7O A;  1WZC A;  2ZZG A;  3ZX4 A;  4A09 A;  2HYE A;  2ZOS A;  3ZUP A;  5FQD A;  4CI2 A;  2I05 A;  2E1B A;  2ZTG A;  3RHU A;  3I8C A;  1QF6 A;  3EI2 A;  4A0B A;  1TKG A;  3E0C A;  1V4P A;  3RFN A;  4XR2 A;  2I06 A;  4AR9 A;  4ARE A;  1NYR A;  2Y3U A;  2EWJ A;  3I7P A;  2Y6I A;  2ZZE A;  2ZZF A;  2IUT A;  3ZTW A;  3I7H A;  2B5L A;  3EI1 A;  3I7K A;  2IUS A;  2B5M A;  4ARF A;  4AR1 A;  4CI1 A;  4AR8 A;  4A08 A;  1TKE A;  4A11 A;  2IUU A;  4E54 A;  3EI3 A;  3I89 A;  4XR3 A;  3ZWD A;  3I8E A;  3ZWK A;  2Y50 A;  1WXO A;  4XR0 A;  1XVI A;  3I7O A;  3ZX5 A;  3KEW A;  3ZW7 A;  1TKY A;  3EI4 A; 
#chains in the Genus database with same CATH homology
 1WNU A;  4TZ4 A;  1TJE A;  4A0A A;  3I7L A;  3I7N A;  4CI3 A;  4E5Z A;  1ECR A;  3WQZ A;  4XR1 A;  1NYQ A;  1V7O A;  2ZZG A;  4A09 A;  2HYE A;  5FQD A;  4CI2 A;  2I05 A;  2E1B A;  2ZTG A;  3RHU A;  3I8C A;  1QF6 A;  3EI2 A;  4A0B A;  1TKG A;  3E0C A;  1V4P A;  3RFN A;  4XR2 A;  2I06 A;  4AR9 A;  4ARE A;  1NYR A;  2Y3U A;  2EWJ A;  3I7P A;  2Y6I A;  2ZZE A;  2ZZF A;  2IUT A;  3I7H A;  2B5L A;  3EI1 A;  3I7K A;  2IUS A;  2B5M A;  4ARF A;  4AR1 A;  4CI1 A;  4AR8 A;  4A08 A;  1TKE A;  4A11 A;  2IUU A;  4E54 A;  3EI3 A;  3I89 A;  4XR3 A;  3I8E A;  2Y50 A;  1WXO A;  4XR0 A;  3I7O A;  3KEW A;  1TKY A;  3EI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...