1V85A

Sterile alpha motif (sam) domain of mouse bifunctional apoptosis regulator
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGEHGLLVHKAVDKWTTEEVVLWLEQLGPWASLYRDRFLSERVNGRLLLTLTEEEFSRAPYTIENSSHRRVILTELERVRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to ring finger protein 36
publication title Sterile alpha motif (SAM) domain of mouse bifunctional apoptosis regulator
rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1v85A00
4MHVA 3TACB 3SEIA 2EANA 1UQVA 1V85A 1PK1B 5J8YC 1JI7A 2LPEA 1SXDA 2F8KA 4IS7A 2E8NA 3BS7A 2L5YA 3KKAC 1SGGA 4NL9C 2EAPA 5KNIA 2KSOA 2ESEA 2QARB 5L1MA 3IDWA 1WWVA 1SXEA 2E8MA 2DKZA 1PK1A 4PZNA 3H8MA 2K4PA 1B0XA 1Z1VA 2QB1A 2E8PA 4RQNA 5JU5A 1X40A 3SENA 1DXSA 1PK3A 2JV3A 2ES6A 1UCVA 5J8YA 1SV4A 1OXJA 2E8OA 2QARA 1OW5A 3KKAA 4NL9A 1COKA 2B6GA 1B4FA 2D8CA 1X66A 1F0MA 1RG6A 3BQ7A 1KW4A 2KIVA 3TADC 2DL0A 2LMRA 2Y9TA 3BS5A 4NJ8A 2YTUA 2F44A 5JRTA 1WWUA 2KG5A 4PZOA 2FE9A 3BS5B 2QB0B 1SV0C 1V38A 2Y9UA 3K1RB 2K60A 5JTIA 3HILA 2EAOA 4RQMA 3TADA 2QB0A 2D3DA 2KE7A 1LKYA 2KMDA 1X9XA 2QKQA 5F3XB 2DKXA 1LKYB 2EAMA 1SV0A 2KSOB 2F3NA 2GLEA
chains in the Genus database with same CATH superfamily
3T5JA 3BQTA 3PSFA 2Q4TA 4J9KA 8ICNA 1N61A 4P4PA 4Y2SA 1BPDA 5J2CA 5KFCA 2RHFA 3C21A 3KKAC 4ECTA 4RQ1A 3M9OB 2ZIVB 4DSLA 4OO1J 3OJUA 1ZQ1C 2ESEA 4KLOA 4TUQA 5J2JA 1WCLA 3SV3A 1IG6A 1ZJMA 4P4MA 3N7SC 3RJFA 5KFZA 4EX6A 1VJ5A 5H2FU 1Q8KA 5AKKA 9ICRA 4XRHA 4O5CA 3RR8A 3J81j 4FBTA 2IOHA 2I1QA 3SYZA 2QARA 2PFNA 2FPMA 4RPXA 4DOCA 3K75D 3EUB2 1MC8A 3I76A 4DLGA 5DQIA 3PNCA 1RDFA 2DL0A 3NVWA 1U47A 4ECYA 5T14A 4K4GA 4QWBA 1X9MA 3FAHA 4GXIA 2DBYA 5KFJA 1CRXA 1S5LU 4DQIA 1IM4A 1TKDA 2YMLA 3E0FA 5KFDA 3PZPA 4M0AA 3AMZA 5CB1A 2E3TA 1Y88A 4DQPA 4A8EA 2OCEA 1ZQGA 5J0WA 2IHNA 2EZZA 3KD3A 4RNMA 3AN1A 4RPYA 3KHRA 1S0VA 3IHQB 2HBLA 2WFAA 4Q8FA 3UMBA 2YMMA 2YQEA 2WB1C 2A1JB 1QQ6A 3F2DA 1L3VA 1ZXIA 2RRDA 1BPBA 2A1AA 3TACB 5HP4A 2NRWA 4PHPA 1QTMA 2BDUA 5KFAA 3MR5A 4DLEA 8ICZA 5DG8A 8ICQA 2ISPA 4Q43A 4NLZA 1RYUA 2W9CA 1ZQQA 5KG5A 1SL0A 3KHLA 8ICMA 4EYIB 3B0YA 3JPOA 4FE3A 2BGWA 1KN5A 2Y0SC 9ICOA 1SKRA 2VA8A 3Q8KA 7ICJA 1X6IA 5AM2A 1X40A 3OPXA 5KG4A 1ZQRA 3TAQA 2AXTU 1OXJA 2E8OA 8ICGA 1MA7A 1YZ6A 4UAZA 1RYSA 4YP3A 1ZD4A 5KFLA 4QWCA 4NWIA 4RU9A 3K1ZA 1NJZA 3BQ7A 3N28A 2LYHA 2AGPA 4C7YA 3TANA 1X2IA 4C4RA 3L3FX 1L7PA 1ZRNA 1C7YA 5JUMA 1N5XA 3OHAA 5KT7A 1WWUA 4PZOA 5KFNA 1Z1BA 9ICFA 3UMGA 1PVPA 3C28A 5ALPA 1M6YA 3QU7A 1FO4A 3K1RB 5KT3A 3EPIA 1BNOA 2JZBB 2K60A 2ZTCA 2FLNA 4F50A 4CE6A 3MGHA 1KDHA 2ZIXA 4PGQA 2GH1A 1D9DA 5CRXA 5HMLA 3ETRA 5CP2A 3Q8SB 4U6PA 2C22A 4DF4A 4RQ5A 4J9SA 4KLQA 2G07A 3IP4B 2LKYA 5DQGA 1HJPA 5F3XB 4C80A 2W9MA 2W8LA 1XSPA 4KLMA 2GOLA 3RAQA 4EELA 4ZOHC 2W3SA 2WF9A 2HBMA 2MUTA 1V85A 1BVSA 3GFKB 2LPEA 3MR3A 1ZJNA 4MEXA 1JUDA 5KG3A 3SAHA 1S9FA 4O3PA 1ZQAA 1IXRA 3I28A 2EAPA 4FFDA 1L7OA 1X9SA 5ALQA 2H3FA 4Y2JA 5BOLA 4US8A 3RRHA 1SWWA 3DEEA 2F8LA 3JPNA 2CPRA 3ICXA 3QU9A 4ZH4A 5DBCA 4DFKA 3RJHA 1L6NA 3A0HU 2XGPA 3RB0A 2H5XA 4ECVA 3RBDA 4C0ZA 3C5FA 9ICTA 5ALJA 4KLUA 2C28A 4J9MA 3V7JA 4Y2RA 4LVSA 2XGQA 4P0PA 2ZIUA 2ZUBA 5J2GA 3EWAA 4NL9A 5TZVA 1Q3VA 5IIIA 2HCFA 2HBJA 4CNQA 4UB6U 1UA0A 1LV5A 4XA5A 1Z3EB 5AIBA 1NK8A 3BS5A 5ALIA 1A6SA 5DLFA 2W7PA 4O3SA 2G5HB 1L8OA 1T8EA 9ICQA 3LDAA 5AM4A 4BUGA 5ALNA 1N5WA 4DL4A 1RYRA 4I2EA 5IIMA 3KZIU 2GWSA 2KIWA 2A19A 4UQGA 3JPPA 1X42A 7ICPA 2K8AA 3M1YA 4O9MA 3C1YA 4PPXA 4E0DA 3OSNA 2E1EA 1KRPA 1IV8A 2KJ5A 4F91B 4KTQA 3MDCA 9ICUA 2ZUDA 4DSEA 3QXGA 2M0NA 2OEHA 5IIJA 5F9NA 3SQIA 4DL2A 2J6UA 1ZQNA 2FMSA 1QH9A 4GC7A 5AI0A 4Y2UA 4ED2A 3UPQA 1O08A 4QWDA 3H8WA 1O03A 5HMMA 4MFAA 2KZ3A 4YR2A 4DQQA 5KG0A 2HHSA 3UMCA 1Z1VA 4NXZA 2HDOA 4OJ5A 1URJA 1KFSA 2JV3A 5KFIA 2VJ4A 1PUZA 4O3OA 5ALFA 3CYMA 2F1HA 3AL0B 3RFAA 1ZQSA 4EBCA 1BNPA 1ZQMA 2OWOA 1NK6A 4DOAA 2NRTA 4DSKA 8ICJA 1NK5A 2KZZA 2YX8A 3TADC 4HYKA 5EE3A 3H8JA 3WKAA 5IILA 3SAFA 2ZJAA 4NJ8A 3AU6A 3QX7A 2KG5A 4RQ8A 2PXIA 1COOA 2FE9A 5E79U 2AJQA 1D8LA 1VDVA 4PH5A 4QNLA 5GTHU 9ICWA 4ECUA 1K1QA 4RT2A 2V4QA 1N48A 5JTIA 4F93B 3RH6A 4B6JA 5KFGA 2ASLA 4F71A 2ZIXB 5KTQA 4RNOA 3HT3A 3HW8A 2HVIA 4F4YA 5AM3A 4C8NA 1HUZA 2KD1A 4DQRA 3ZI4A 1ZQLA 5AKHA 3SEIA 4RNNA 7ICSA 4RZRA 2KTQA 5DGAA 4BGDA 4IR1A 4YG2A 1LVHA 2F8KA 4Y2XA 9ICPA 3ISDA 4YXMA 3ONNA 1NJYA 3PVXA 8ICRA 2KJ9A 2AGOA 1KBUA 4GXJA 3OSPA 1QSLA 3C2MA 1L3UA 9ICMA 5IIOA 4JWMA 2JEFA 5CWRA 2VIXA 2RDJA 1TE2A 4F92B 1HEKA 2AH5A 2G06A 3LWLA 2I6XA 2RP5A 2W04A 3H4DA 3M7DA 1SZPA 4IQWA 4YCXA 3PO5A 2OXOA 8ICLA 1D8YA 4P0PB 1QQ5A 2ZIUB 2XO7A 5L1IA 3GV7B 1XO0A 2XI9A 3WK4A 4UAWA 2H3ZA 4UW9A 3JPSA 2XY7A 4I2AA 4PHEA 2FMPA 3BS5B 4C8KA 4FBUA 2QB0B 2HHTA 2W3RA 3RBEA 3ZDDA 1ZQIA 2E1FA 1D9FA 5KG6A 1S0NA 1UPHA 4EEYA 3V72A 2IMWP 1XSNA 1DGSA 4ELVA 5J2KA 3JPRA 3KHHA 3WK9A 2RLTA 2WF8A 1RXVA 2JZBA 1T4GA 1Q3UA 5KFQA 3NRZA 3E58A 4BXOB 2P6UA 3WU2U 2C2EA 2UVWA 1ZQUA 1L3SA 3PX0A 5KFRA 3V6JA 3M9NB 4GIBA 2KK0A 3QUTA 2HOFA 4O5KA 4IQUA 5D49A 4KLSA 4FZMA 4MF8A 4ED8A 5DGBA 3C2LA 4DEZA 2V9WA 2V4RA 3GIKA 4RQNA 3ZDBA 8ICOA 3SI8A 1V9PA 1DXSA 1UCVA 2NO4A 3WK6A 1U49A 3GDXA 2B6GA 2C2DA 1TK0A 2W55A 3SZ2A 4ECSA 2NRXA 4Z6CA 4I2CA 8ICVA 3NUQA 1KW4A 2JHDA 3MC1A 4RPZA 3JPQA 2MSNA 5L1LA 1CUKA 8ICUA 2BCUA 1N62A 3NVZA 3ORYA 4DWIA 1NJWA 2ISOA 5HR6A 1SKSA 3VC8A 8ICSA 4UB8U 2Y9UA 3PW2A 2MU2A 2RDIA 1TAMA 2DUYA 3PY8A 5AI8A 1ZQVA 3A0BU 5DG7A 1SL2A 3KBBA 1KSPA 2ZIWA 3QU5A 3H0RB 4B9LA 4KN4A 1ZD2P 1S97A 4GLXA 1PVQA 1OUQA 4R8UB 5AKEA 3H7IA 3KHGA 5KFKA 3QEBZ 3HX0A 4CF3A 7ICTA 4DS5A 4ECWA 3K4GA 4R65A 3RAXA 2PI5A 1QSYA 5AK6A 2ZUCA 5KG2A 3KTQA 4JV1A 3QZ8A 2Y1JA 2EDUA 3PX6A 3H8MA 2PI4A 4UAUA 5ALVA 2K4PA 3G6XA 4RQ3A 4O5EA 2WAQC 3RJIA 3HP6A 1JALA 1UT8A 2JEJA 3IRUA 4F5QA 2WHEA 1COKA 4WJ3B 4DL5A 4QZBA 3WKBA 1X66A 4PHDA 2KP7A 4C4TA 3NGDA 5AM0A 1UT5A 8ICIA 5IIKA 4GXKA 2Q0ZX 4I2BA 5AKZA 2ATLA 5B66U 5BOMA 3Q8MA 2HOIA 4DQSA 4DO9A 3RTVA 4F5OA 3OTQA 1QLNA 3CW2C 5DB9A 3GZFA 4EZ6A 2HHQA 2DF4B 1NKCA 5C0YA 2KEYA 4BJQA 4MFCA 5J0SA 1H38A 1LKYA 2KMDA 5CEHA 2KKVA 4NLNA 3BQ2A 2UVVA 2WAQF 1HUOA 7ICHA 3ZDAA 3MFIA 4AYBF 4DCCA 4DL7A 4YVZA 3LK9A 1BPEA 1SZHA 4ECZA 2WTFA 2DPJA 1J2MA 1KKXA 4X5VA 4KMUA 5KFSA 4AP9A 2HHUA 2WF6A 2XY5A 2KJ8A 5ALSA 2HHVA 2CRXA 2PMZC 1B43A 2XCPA 1MN8A 4Y2TA 3SAGA 2Y1IA 5J0YA 1N60A 9ICLA 2DKZA 3RJKA 1BPYA 4OJPA 4IQVA 4OJLA 1B0XA 2HBKA 3OJSA 1RM6C 2E8PA 5CR0A 4F72A 1ZD5A 2W54A 2FLLA 4IL6U 4I2DA 4I2FA 1C20A 2D8CA 4P0QB 4PHAA 2AQ0A 3H4BA 1JMSA 1K1SA 4FO6A 3BQ0A 1NK7A 2P66A 4ED0A 2VA3A 3GU3A 3UXNA 5FP0A 1FFVA 2BPCA 4K4IA 3NS1A 4DL6A 4DF8A 4Z6FA 1MQ3A 4P4OA 2ZTDA 4QZCA 1ZQXA 2M9NA 3GV8B 5KFOA 4I2IA 1A0PA 5KG1A 3SV4A 1ZQZA 2KHQA 2PMZF 4HAIA 2FMQA 4UBCA 2JEIA 4RQ2A 2BCRA 3I1YA 4OJOA 3JPTA 1DK3A 4OD0A 2QB0A 3M6KA 1ZQKA 1ZETA 4RUAA 2IHMA 3Q8QB 2ZIWB 5KAFU 4ED7A 3TFRA 3TAPA 2KSOB 3Q8PB 2F3NA 3PSIA 1S77D 3D2SA 4MHVA 4EBEA 2UVRA 3N97B 4KX3A 3GV5B 3IN5A 2ASDA 2NYVA 9ICXA 4Z6DA 3ISCA 5ALHA 4DFMA 2P6RA 2K8BB 5AKIA 2HI0A 4R66A 3PO4A 2L5YA 4NL9C 1ZQTA 4Y2PA 3M8RA 3BZKA 4BXOA 2ZXHA 1XNSA 4JMUA 2DGZA 2OHFA 1WWVA 3TFSA 1SXEA 1TVAA 1Z00B 4QIWF 5DDMA 2E8MA 3D6JA 2CXYA 5F9LA 5KL8B 2NO5A 4I27A 3L4PA 1S0OA 3IG8A 4F4ZA 5AM5A 1A76A 2PKEA 2QB1A 4RQ7A 2D6FC 4ECXA 8ICFA 5ALOA 5DBBA 4I29A 4PGYA 2ZJ5A 1FIQA 2MRLA 1XS9D 1XU4A 3MGIA 3C1ZA 3V7LA 9ICSA 3R9KA 4R64A 4O3NA 1PVRA 4G3IA 1JXEA 2F76X 3ZDCA 4YMMA 2JH7A 2HSZA 5AK3A 1F5SA 4M9HA 9ICBA 3SR6A 3UQ2A 1X6JA 2UVUA 2G08A 1XSLA 4TURA 5J2BA 1QSSA 4FS2A 4ACOA 5K4LA 4YXJA 2VANA 3IG5A 4Y2QA 5AIAA 2EQYA 4O3RA 1K5OA 1NOMA 2D3DA 3GIIA 2Z7JA 4QZEA 3MFHA 3FC4A 4YD1A 4B9SA 5ALKA 1KLNA 2DKXA 5EE0A 2YB1A 1LKYB 3HJEA 1SV0A 2BQUA 5J0QA 4RQ6A 1KTQA 1UQVA 5EE9A 4XQ8A 1U48A 1JI7A 2YN4A 3ALRA 2AQ4A 2E8NA 2JR5A 5ALMA 4JV2A 2ODGA 1NJXA 4M47A 7ICMA 3C23A 1NKBA 4R8UA 4M9LA 2WF5A 3ED5A 2W9BB 4NLCA 1ZQYA 4Q44A 3EPGA 2JEGA 1RQLA 8ICKA 3U26A 3G6VA 4DS4A 4NM1A 1TK8A 2KOBA 1CEZA 3WKCA 3E2EA 2KKPA 5JU5A 3SENA 5KFTA 3UXOA 5J0TA 5J8YA 3QE9Y 2R8JA 2R8IA 2OYYA 3HKZC 4GFJA 2G09A 3RB6A 3L5KA 4ELUA 1Z19A 4LZGA 4KLJA 4M9JA 2HVHA 4YR0A 5CJ7A 4M6WB 2EH9A 3WK5A 3RJGA 2PFQA 1ZQFA 1ZQWA 8ICHA 1X9WA 4QZHA 2Y9TA 3D2QA 4B9VA 4KMOB 4M9GA 4EYHB 4QW9A 3PSTA 1JROA 1ZQPA 3H0LB 3WK7A 2DFLA 3KZXA 3BQ1A 3GQCA 4ECQA 3EZ5A 5EWEA 8ICXA 3PSPA 3RH5A 3TQ1A 5HR7A 7ICLA 9ICEA 2FJ6A 3ZD9A 4C8LA 8ICAA 3NRWA 1Q46A 5BPCA 3T3FA 4F2SA 4J03A 1Z4NA 5CA7A 4Y2YA 2GO7A 1BGXT 5KFPA 5ALTA 1ZD3A 1NI3A 4ED3A 2W43A 2YMPA 3GIMA 2W9AA 5DKWA 3D2NA 3HKZF 2O6KA 4DFPA 1TAUA 1U9LA 2KN7A 8ICYA 3QU4A 2KVCA 3QUBA 5HHHA 3AQEA 1U45A 4UASA 4JWNA 2BPFA 5AKGA 4EENA 4JB3A 3AEVA 1XO1A 3CP8A 2G5IB 4P2HA 4C4SA 1YT3A 4YFKA 4Q8EA 3UM9A 2ALZA 3TARA 4F3OA 5KT4A 2HHXA 1ED1A 3KOOA 3ETLA 2J6TA 2QLTA 2JRZA 5ALWA 3AUOA 3NASA 3AQFA 3BJYA 4M2YA 2HW3A 2ZJ8A 3V7KA 5D4BA 5DDYA 3MGVA 1ZQCA 2YY6A 2BQ3A 4O3MA 5J2FA 3KKAA 3H8SA 8ICBA 4USAA 2LM1A 1IIPA 1L7NA 5KFFA 4DSIA 2KIVA 4J9QA 4LJXA 3B9JA 3V6HA 2KICA 5J0OA 3FM9A 1ZOLA 1TAQA 5DQHA 4IRKA 3NTUA 1L8LA 1ZQOA 4P0QA 4DFDA 4UB5A 1WCNA 2PFOA 3C29A 5A0LA 4PL1A 4DSFA 4QZGA 4NLKA 2DQNB 2I5HA 4BDPA 5DB8A 3BDPA 5DB7A 3MABA 1BPXA 4RQMA 2H3IA 3AU2A 2DWQA 4C7ZA 2BQRA 4DL3A 3H40A 2GLEA 3ZDEA 4J9OA 1UHUA 3S6JA 3RH4A 4RQ0A 3ZD8A 2ASJA 2JXJA 2LYBA 3CRXA 2R8GA 5GTIU 3PMNA 1SGGA 2KSOA 3MBYA 1B22A 1YZ7A 2XIDA 3M6ZA 1RXWA 2DPIA 4KLFA 4J9RA 5L1MA 1NZBA 9ICHA 2K8CB 1L7MA 4YQWA 2LHTA 4R63A 5KFBA 5AKJA 3MR6A 1NZPA 1T3QA 1J97A 2C2RA 3G6YA 3MR2A 4UATA 5G5GA 3PW5A 4F2RA 1Z00A 4IRDA 1B4FA 4NLGA 4YN4A 4F5RA 5KT6A 4QZFA 4I28A 2LM4A 4J9PA 3DV9A 4UAVA 1S76D 1ZQEA 3RR7A 3WKEA 2KFZA 2HMXA 4NV0A 2K4EA 4KLDA 4ED6A 2MAXA 5ALGA 2BCQA 1TFRA 1V38A 4AYBC 4KN7A 4NM2A 4KX5A 4F5NA 8ICWA 2HOQA 1EXNA 4UB3A 1JN3A 4IQTA 1VLBA 4YR3A 5EE1A 1RQNA 1U4BA 2FPLA 3QUQA 2J6SA 1SWVA 3LVWA 2HHWA 9ICIA 2CN1A 3F2CA 7ICKA 3O0FA 2KNJA 4F4KA 1QQ7A 1NK9A 5L1KA 4OCZA 1XWLA 1N2XA 5ALXA 5J2HA 3F53A 4ICAA 1PK1B 3PX4A 1PZNA 4CRXA 1AQ6A 3BS7A 7ICOA 5J0UA 3EW9A 4PJ0U 3EYZA 1ZYQA 2EZXA 4PGXA 2I9GA 7ICFA 2AGQA 5DG9A 2BDPA 2WB1F 1RZTA 4UB1A 4CF4A 1T7PA 4CGZA 4G9BA 2FPKA 2XICA 4CDGA 4FS1A 1PK3A 3T5KA 2ES6A 3DDHA 4QZDA 4CCHA 2W9BA 2FI1A 3RB4A 4QWEA 7ICGA 4RT3A 3F5AA 4J9NA 2G0AA 4NLBA 2LYAA 2IBKA 3Q8LA 1V97A 5L1JA 4EEKA 1LB2B 5KFYA 7ICNA 2Y0SF 1ZQBA 5DB6A 4KLIA 3FDSA 3H0MB 2KV2A 2VKQA 2BCSA 5J2IA 4EX7A 1WG8A 2OM6A 5AKLA 5KFHA 9ICJA 2KFNA 3KFUF 2PFPA 4M6WA 3TI0A 1MQ2A 1KQQA 5G5HA 2BCVA 5IINA 3QUCA 4KLGA 3QNMA 4KLEA 4JV0A 4ED1A 9ICNA 5J0RA 4F5PA 1NK0A 3F5EA 3T5LA 2KZMA 3M9MB 2H3VA 3HILA 3Q8RB 3UQ0A 2XY6A 4NY8A 3PMLA 2F1IA 3FYHA 9ICKA 3OGUA 2QKQA 4TQSA 5EOZA 2R18A 4QIWC 5HNKA 5AI9A 1A77A 1DRGA 5AI4A 1NKEA 3ISBA 1SXDA 5DBAA 2BPGA 5DLGA 2IOFK 2IA6A 2P35A 4B9MA 2IOFA 4FZLA 1BPZA 4KITB 1KL9A 5ALEA 5AI6A 4ECRA 3UXPA 3HRDD 2QARB 5KT2A 1QCKA 1S8OA 4CF5A 2VA2A 2BHNA 4QZIA 4Y2VA 2W8KA 5KT5A 2YMQA 1WYGA 2KHVA 4FZNA 1N56A 9ICGA 5J29A 7ICUA 2F2AB 2XVTA 3T79A 1L5UA 2RQ5A 1JIHA 1ECWA 4QJFB 3SD7A 1F0MA 3HWTA 3PW0A 1RG6A 4TUSA 1T3NA 4YD2A 4B9UA 3TKAA 1S10A 4PL2A 1ZQHA 8ICTA 5JRTA 1SIJA 3THVA 2ZXIA 2W03A 4F8RA 5ALYA 5ALZA 1TK5A 8ICEA 2EZYA 4Z6EA 4UAYA 4EZ9A 7ICQA 9ICAA 1P7DA 1FFUA 5AKYA 4MF2A 2EAOA 4MEYA 2N1RA 3TADA 4BX9C 1F44A 4F4XA 2E5SA 2F77X 4B9NA 2KE7A 1L3TA 4DSJA 2OH2A 4KLLA 2YB4A 2W9CB 3BZCA 3RJEA 2EANA 5AK4A 2ZIVA 4DOBA 3MDAA 4F4WA 1AROP 3CNHA 3QYPA 5AI5A 3LYSA 5AHXA 5KNIA 4RQ4A 7ICEA 4XUSA 3PW4A 3IDWA 2BKEA 2XC9A 9ICVA 2JMGA 2A3VA 4PZNA 5KFXA 2KVSA 3NVVA 3N7RC 3LWMA 4BWJA 2LI6A 3VCBA 4UARA 4UBBA 1UA1A 3C2KA 2ZG6A 5L9XA 2WF7A 1NNLA 3NVYA 1GO3F 2W7OA 2B21A 3RRGA 7ICRA 5EWGA 1NK4A 3N7PD 3PR5B 5ALDA 3AM9A 5D46A 4O3QA 4QWAA 5C5JA 1KFTA 4Q45A 3QZ7A 2K89A 5TISU 5EWFA 5J2AA 4QW8A 4QZ9A 3OHBA 4U7CA 4OJ6A 5KFWA 1SV0C 1D8BA 3GIJA 2LBOA 4MFFA 1J2NA 2AU0A 3WK8A 1KEJA 2VJ5A 5KFVA 5AK5A 4TUPA 5KG7A 4I2GA 2BR0A 4UB2A 4IR9A 1HIWA 5AKXA 2MUTB 2A1JA 3IM1A 3RJJA 5KFEA 3B0XA 3N4MB 2NV3A 4EBDA 2BZFA 3SMVA 5J2DA 5ALRA 5ALUA 4LZDA 4IC9A 8ICPA 4J9LA 2NRZA 4UB4A 1FEZA 4GC6A 5J0XA 5B5EU 3M8SA 1ZQJA 2K4IA 1SKWA 3HPOA 4C8OA 4QZ8A 1SB3C 5J8YC 4IS7A 3PW7A 7ICIA 4K4HA 5J2EA 4M04A 1JX4A 1RPLA 2FLPA 4ELTA 1ZRMA 3QEAZ 5KFMA 3GILA 1PK1A 3RF9A 1TV9A 3V6KA 1Z4OA 4I2JA 4KLTA 2W11A 1XC9A 4M9NA 2R8HA 1SV4A 1JRPA 1KFDA 9ICCA 5AICA 1OW5A 8ICCA 1MSWD 2R8KA 2FDRA 3PR4A 1JXLA 4O0IA 4I2HA 2NRVA 4JK1A 1S0MA 1T94A 4B9TA 4BWMA 5CHGA 1N63A 2ZTEA 3T5HA 2JH1A 2LMRA 5KAIU 5KFUA 2AHOB 4IRCA 1DOQA 4YMOA 5ALLA 4KLHA 4QZAA 2YTUA 2F44A 3QU2A 1CI4A 1DGJA 4YMNA 3IV6A 1ZQDA 1WUDA 2K4HA 3PV8A 4JUZA 4TQRA 3RB3A 5AM1A 2F1JA 1DK2A 2XCAA 4DFJA 5HHIA 5KL1B 7ICVA 2B0CA 3WKDA 3C5GA 3LVVA 4C8MA 4RUCA 4US9A 2JGAA 1X9XA 2MA1A 5J0PA 2H3QA 2EAMA 1SL1A 3F2BA
chains in the Genus database with same CATH topology
4MHVA 3TACB 3SEIA 2EANA 1UQVA 1V85A 1PK1B 5J8YC 1JI7A 2LPEA 1SXDA 2F8KA 4IS7A 2E8NA 3BS7A 2L5YA 3KKAC 1SGGA 4NL9C 2EAPA 5KNIA 2KSOA 2ESEA 2QARB 5L1MA 3IDWA 1WWVA 1SXEA 2E8MA 2DKZA 1PK1A 4PZNA 3H8MA 2K4PA 1B0XA 1Z1VA 2QB1A 2E8PA 4RQNA 5JU5A 1X40A 3SENA 1DXSA 1PK3A 2JV3A 2ES6A 1UCVA 5J8YA 1SV4A 1OXJA 2E8OA 2QARA 1OW5A 3KKAA 4NL9A 1COKA 2B6GA 1B4FA 2D8CA 1X66A 1F0MA 1RG6A 3BQ7A 1KW4A 2KIVA 3TADC 2DL0A 2LMRA 2Y9TA 3BS5A 4NJ8A 2YTUA 2F44A 5JRTA 1WWUA 2KG5A 4PZOA 2FE9A 3BS5B 2QB0B 1SV0C 1V38A 2Y9UA 3K1RB 2K60A 5JTIA 3HILA 2EAOA 4RQMA 3TADA 2QB0A 2D3DA 2KE7A 1LKYA 2KMDA 1X9XA 2QKQA 5F3XB 2DKXA 1LKYB 2EAMA 1SV0A 2KSOB 2F3NA 2GLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHV A;  3TAC B;  3SEI A;  2EAN A;  1UQV A;  1V85 A;  1PK1 B;  5J8Y C;  1JI7 A;  2LPE A;  1SXD A;  2F8K A;  4IS7 A;  2E8N A;  3BS7 A;  2L5Y A;  3KKA C;  1SGG A;  4NL9 C;  2EAP A;  5KNI A;  2KSO A;  2ESE A;  2QAR B;  5L1M A;  3IDW A;  1WWV A;  1SXE A;  2E8M A;  2DKZ A;  1PK1 A;  4PZN A;  3H8M A;  2K4P A;  1B0X A;  1Z1V A;  2QB1 A;  2E8P A;  4RQN A;  5JU5 A;  1X40 A;  3SEN A;  1DXS A;  1PK3 A;  2JV3 A;  2ES6 A;  1UCV A;  5J8Y A;  1SV4 A;  1OXJ A;  2E8O A;  2QAR A;  1OW5 A;  3KKA A;  4NL9 A;  1COK A;  2B6G A;  1B4F A;  2D8C A;  1X66 A;  1F0M A;  1RG6 A;  3BQ7 A;  1KW4 A;  2KIV A;  3TAD C;  2DL0 A;  2LMR A;  2Y9T A;  3BS5 A;  4NJ8 A;  2YTU A;  2F44 A;  5JRT A;  1WWU A;  2KG5 A;  4PZO A;  2FE9 A;  3BS5 B;  2QB0 B;  1SV0 C;  1V38 A;  2Y9U A;  3K1R B;  2K60 A;  5JTI A;  3HIL A;  2EAO A;  4RQM A;  3TAD A;  2QB0 A;  2D3D A;  2KE7 A;  1LKY A;  2KMD A;  1X9X A;  2QKQ A;  5F3X B;  2DKX A;  1LKY B;  2EAM A;  1SV0 A;  2KSO B;  2F3N A;  2GLE A; 
#chains in the Genus database with same CATH topology
 3T5J A;  3BQT A;  3PSF A;  2Q4T A;  4J9K A;  8ICN A;  1N61 A;  4P4P A;  4Y2S A;  1BPD A;  5J2C A;  5KFC A;  2RHF A;  3C21 A;  3KKA C;  4ECT A;  4RQ1 A;  3M9O B;  2ZIV B;  4DSL A;  4OO1 J;  3OJU A;  1ZQ1 C;  2ESE A;  4KLO A;  4TUQ A;  5J2J A;  1WCL A;  3SV3 A;  1IG6 A;  1ZJM A;  4P4M A;  3N7S C;  3RJF A;  5KFZ A;  4EX6 A;  1VJ5 A;  5H2F U;  1Q8K A;  5AKK A;  9ICR A;  4XRH A;  4O5C A;  3RR8 A;  3J81 j;  4FBT A;  2IOH A;  2I1Q A;  3SYZ A;  2QAR A;  2PFN A;  2FPM A;  4RPX A;  4DOC A;  3K75 D;  3EUB 2;  1MC8 A;  3I76 A;  4DLG A;  5DQI A;  3PNC A;  1RDF A;  2DL0 A;  3NVW A;  1U47 A;  4ECY A;  5T14 A;  4K4G A;  4QWB A;  1X9M A;  3FAH A;  4GXI A;  2DBY A;  5KFJ A;  1CRX A;  1S5L U;  4DQI A;  1IM4 A;  1TKD A;  2YML A;  3E0F A;  5KFD A;  3PZP A;  4M0A A;  3AMZ A;  5CB1 A;  2E3T A;  1Y88 A;  4DQP A;  4A8E A;  2OCE A;  1ZQG A;  5J0W A;  2IHN A;  2EZZ A;  3KD3 A;  4RNM A;  3AN1 A;  4RPY A;  3KHR A;  1S0V A;  3IHQ B;  2HBL A;  2WFA A;  4Q8F A;  3UMB A;  2YMM A;  2YQE A;  2WB1 C;  2A1J B;  1QQ6 A;  3F2D A;  1L3V A;  1ZXI A;  2RRD A;  1BPB A;  2A1A A;  3TAC B;  5HP4 A;  2NRW A;  4PHP A;  1QTM A;  2BDU A;  5KFA A;  3MR5 A;  4DLE A;  8ICZ A;  5DG8 A;  8ICQ A;  2ISP A;  4Q43 A;  4NLZ A;  1RYU A;  2W9C A;  1ZQQ A;  5KG5 A;  1SL0 A;  3KHL A;  8ICM A;  4EYI B;  3B0Y A;  3JPO A;  4FE3 A;  2BGW A;  1KN5 A;  2Y0S C;  9ICO A;  1SKR A;  2VA8 A;  3Q8K A;  7ICJ A;  1X6I A;  5AM2 A;  1X40 A;  3OPX A;  5KG4 A;  1ZQR A;  3TAQ A;  2AXT U;  1OXJ A;  2E8O A;  8ICG A;  1MA7 A;  1YZ6 A;  4UAZ A;  1RYS A;  4YP3 A;  1ZD4 A;  5KFL A;  4QWC A;  4NWI A;  4RU9 A;  3K1Z A;  1NJZ A;  3BQ7 A;  3N28 A;  2LYH A;  2AGP A;  4C7Y A;  3TAN A;  1X2I A;  4C4R A;  3L3F X;  1L7P A;  1ZRN A;  1C7Y A;  5JUM A;  1N5X A;  3OHA A;  5KT7 A;  1WWU A;  4PZO A;  5KFN A;  1Z1B A;  9ICF A;  3UMG A;  1PVP A;  3C28 A;  5ALP A;  1M6Y A;  3QU7 A;  1FO4 A;  3K1R B;  5KT3 A;  3EPI A;  1BNO A;  2JZB B;  2K60 A;  2ZTC A;  2FLN A;  4F50 A;  4CE6 A;  3MGH A;  1KDH A;  2ZIX A;  4PGQ A;  2GH1 A;  1D9D A;  5CRX A;  5HML A;  3ETR A;  5CP2 A;  3Q8S B;  4U6P A;  2C22 A;  4DF4 A;  4RQ5 A;  4J9S A;  4KLQ A;  2G07 A;  3IP4 B;  2LKY A;  5DQG A;  1HJP A;  5F3X B;  4C80 A;  2W9M A;  2W8L A;  1XSP A;  4KLM A;  2GOL A;  3RAQ A;  4EEL A;  4ZOH C;  2W3S A;  2WF9 A;  2HBM A;  2MUT A;  1V85 A;  1BVS A;  3GFK B;  2LPE A;  3MR3 A;  1ZJN A;  4MEX A;  1JUD A;  5KG3 A;  3SAH A;  1S9F A;  4O3P A;  1ZQA A;  1IXR A;  3I28 A;  2EAP A;  4FFD A;  1L7O A;  1X9S A;  5ALQ A;  2H3F A;  4Y2J A;  5BOL A;  4US8 A;  3RRH A;  1SWW A;  3DEE A;  2F8L A;  3JPN A;  2CPR A;  3ICX A;  3QU9 A;  4ZH4 A;  5DBC A;  4DFK A;  3RJH A;  1L6N A;  3A0H U;  2XGP A;  3RB0 A;  2H5X A;  4ECV A;  3RBD A;  4C0Z A;  3C5F A;  9ICT A;  5ALJ A;  4KLU A;  2C28 A;  4J9M A;  3V7J A;  4Y2R A;  4LVS A;  2XGQ A;  4P0P A;  2ZIU A;  2ZUB A;  5J2G A;  3EWA A;  4NL9 A;  5TZV A;  1Q3V A;  5III A;  2HCF A;  2HBJ A;  4CNQ A;  4UB6 U;  1UA0 A;  1LV5 A;  4XA5 A;  1Z3E B;  5AIB A;  1NK8 A;  3BS5 A;  5ALI A;  1A6S A;  5DLF A;  2W7P A;  4O3S A;  2G5H B;  1L8O A;  1T8E A;  9ICQ A;  3LDA A;  5AM4 A;  4BUG A;  5ALN A;  1N5W A;  4DL4 A;  1RYR A;  4I2E A;  5IIM A;  3KZI U;  2GWS A;  2KIW A;  2A19 A;  4UQG A;  3JPP A;  1X42 A;  7ICP A;  2K8A A;  3M1Y A;  4O9M A;  3C1Y A;  4PPX A;  4E0D A;  3OSN A;  2E1E A;  1KRP A;  1IV8 A;  2KJ5 A;  4F91 B;  4KTQ A;  3MDC A;  9ICU A;  2ZUD A;  4DSE A;  3QXG A;  2M0N A;  2OEH A;  5IIJ A;  5F9N A;  3SQI A;  4DL2 A;  2J6U A;  1ZQN A;  2FMS A;  1QH9 A;  4GC7 A;  5AI0 A;  4Y2U A;  4ED2 A;  3UPQ A;  1O08 A;  4QWD A;  3H8W A;  1O03 A;  5HMM A;  4MFA A;  2KZ3 A;  4YR2 A;  4DQQ A;  5KG0 A;  2HHS A;  3UMC A;  1Z1V A;  4NXZ A;  2HDO A;  4OJ5 A;  1URJ A;  1KFS A;  2JV3 A;  5KFI A;  2VJ4 A;  1PUZ A;  4O3O A;  5ALF A;  3CYM A;  2F1H A;  3AL0 B;  3RFA A;  1ZQS A;  4EBC A;  1BNP A;  1ZQM A;  2OWO A;  1NK6 A;  4DOA A;  2NRT A;  4DSK A;  8ICJ A;  1NK5 A;  2KZZ A;  2YX8 A;  3TAD C;  4HYK A;  5EE3 A;  3H8J A;  3WKA A;  5IIL A;  3SAF A;  2ZJA A;  4NJ8 A;  3AU6 A;  3QX7 A;  2KG5 A;  4RQ8 A;  2PXI A;  1COO A;  2FE9 A;  5E79 U;  2AJQ A;  1D8L A;  1VDV A;  4PH5 A;  4QNL A;  5GTH U;  9ICW A;  4ECU A;  1K1Q A;  4RT2 A;  2V4Q A;  1N48 A;  5JTI A;  4F93 B;  3RH6 A;  4B6J A;  5KFG A;  2ASL A;  4F71 A;  2ZIX B;  5KTQ A;  4RNO A;  3HT3 A;  3HW8 A;  2HVI A;  4F4Y A;  5AM3 A;  4C8N A;  1HUZ A;  2KD1 A;  4DQR A;  3ZI4 A;  1ZQL A;  5AKH A;  3SEI A;  4RNN A;  7ICS A;  4RZR A;  2KTQ A;  5DGA A;  4BGD A;  4IR1 A;  4YG2 A;  1LVH A;  2F8K A;  4Y2X A;  9ICP A;  3ISD A;  4YXM A;  3ONN A;  1NJY A;  3PVX A;  8ICR A;  2KJ9 A;  2AGO A;  1KBU A;  4GXJ A;  3OSP A;  1QSL A;  3C2M A;  1L3U A;  9ICM A;  5IIO A;  4JWM A;  2JEF A;  5CWR A;  2VIX A;  2RDJ A;  1TE2 A;  4F92 B;  1HEK A;  2AH5 A;  2G06 A;  3LWL A;  2I6X A;  2RP5 A;  2W04 A;  3H4D A;  3M7D A;  1SZP A;  4IQW A;  4YCX A;  3PO5 A;  2OXO A;  8ICL A;  1D8Y A;  4P0P B;  1QQ5 A;  2ZIU B;  2XO7 A;  5L1I A;  3GV7 B;  1XO0 A;  2XI9 A;  3WK4 A;  4UAW A;  2H3Z A;  4UW9 A;  3JPS A;  2XY7 A;  4I2A A;  4PHE A;  2FMP A;  3BS5 B;  4C8K A;  4FBU A;  2QB0 B;  2HHT A;  2W3R A;  3RBE A;  3ZDD A;  1ZQI A;  2E1F A;  1D9F A;  5KG6 A;  1S0N A;  1UPH A;  4EEY A;  3V72 A;  2IMW P;  1XSN A;  1DGS A;  4ELV A;  5J2K A;  3JPR A;  3KHH A;  3WK9 A;  2RLT A;  2WF8 A;  1RXV A;  2JZB A;  1T4G A;  1Q3U A;  5KFQ A;  3NRZ A;  3E58 A;  4BXO B;  2P6U A;  3WU2 U;  2C2E A;  2UVW A;  1ZQU A;  1L3S A;  3PX0 A;  5KFR A;  3V6J A;  3M9N B;  4GIB A;  2KK0 A;  3QUT A;  2HOF A;  4O5K A;  4IQU A;  5D49 A;  4KLS A;  4FZM A;  4MF8 A;  4ED8 A;  5DGB A;  3C2L A;  4DEZ A;  2V9W A;  2V4R A;  3GIK A;  4RQN A;  3ZDB A;  8ICO A;  3SI8 A;  1V9P A;  1DXS A;  1UCV A;  2NO4 A;  3WK6 A;  1U49 A;  3GDX A;  2B6G A;  2C2D A;  1TK0 A;  2W55 A;  3SZ2 A;  4ECS A;  2NRX A;  4Z6C A;  4I2C A;  8ICV A;  3NUQ A;  1KW4 A;  2JHD A;  3MC1 A;  4RPZ A;  3JPQ A;  2MSN A;  5L1L A;  1CUK A;  8ICU A;  2BCU A;  1N62 A;  3NVZ A;  3ORY A;  4DWI A;  1NJW A;  2ISO A;  5HR6 A;  1SKS A;  3VC8 A;  8ICS A;  4UB8 U;  2Y9U A;  3PW2 A;  2MU2 A;  2RDI A;  1TAM A;  2DUY A;  3PY8 A;  5AI8 A;  1ZQV A;  3A0B U;  5DG7 A;  1SL2 A;  3KBB A;  1KSP A;  2ZIW A;  3QU5 A;  3H0R B;  4B9L A;  4KN4 A;  1ZD2 P;  1S97 A;  4GLX A;  1PVQ A;  1OUQ A;  4R8U B;  5AKE A;  3H7I A;  3KHG A;  5KFK A;  3QEB Z;  3HX0 A;  4CF3 A;  7ICT A;  4DS5 A;  4ECW A;  3K4G A;  4R65 A;  3RAX A;  2PI5 A;  1QSY A;  5AK6 A;  2ZUC A;  5KG2 A;  3KTQ A;  4JV1 A;  3QZ8 A;  2Y1J A;  2EDU A;  3PX6 A;  3H8M A;  2PI4 A;  4UAU A;  5ALV A;  2K4P A;  3G6X A;  4RQ3 A;  4O5E A;  2WAQ C;  3RJI A;  3HP6 A;  1JAL A;  1UT8 A;  2JEJ A;  3IRU A;  4F5Q A;  2WHE A;  1COK A;  4WJ3 B;  4DL5 A;  4QZB A;  3WKB A;  1X66 A;  4PHD A;  2KP7 A;  4C4T A;  3NGD A;  5AM0 A;  1UT5 A;  8ICI A;  5IIK A;  4GXK A;  2Q0Z X;  4I2B A;  5AKZ A;  2ATL A;  5B66 U;  5BOM A;  3Q8M A;  2HOI A;  4DQS A;  4DO9 A;  3RTV A;  4F5O A;  3OTQ A;  1QLN A;  3CW2 C;  5DB9 A;  3GZF A;  4EZ6 A;  2HHQ A;  2DF4 B;  1NKC A;  5C0Y A;  2KEY A;  4BJQ A;  4MFC A;  5J0S A;  1H38 A;  1LKY A;  2KMD A;  5CEH A;  2KKV A;  4NLN A;  3BQ2 A;  2UVV A;  2WAQ F;  1HUO A;  7ICH A;  3ZDA A;  3MFI A;  4AYB F;  4DCC A;  4DL7 A;  4YVZ A;  3LK9 A;  1BPE A;  1SZH A;  4ECZ A;  2WTF A;  2DPJ A;  1J2M A;  1KKX A;  4X5V A;  4KMU A;  5KFS A;  4AP9 A;  2HHU A;  2WF6 A;  2XY5 A;  2KJ8 A;  5ALS A;  2HHV A;  2CRX A;  2PMZ C;  1B43 A;  2XCP A;  1MN8 A;  4Y2T A;  3SAG A;  2Y1I A;  5J0Y A;  1N60 A;  9ICL A;  2DKZ A;  3RJK A;  1BPY A;  4OJP A;  4IQV A;  4OJL A;  1B0X A;  2HBK A;  3OJS A;  1RM6 C;  2E8P A;  5CR0 A;  4F72 A;  1ZD5 A;  2W54 A;  2FLL A;  4IL6 U;  4I2D A;  4I2F A;  1C20 A;  2D8C A;  4P0Q B;  4PHA A;  2AQ0 A;  3H4B A;  1JMS A;  1K1S A;  4FO6 A;  3BQ0 A;  1NK7 A;  2P66 A;  4ED0 A;  2VA3 A;  3GU3 A;  3UXN A;  5FP0 A;  1FFV A;  2BPC A;  4K4I A;  3NS1 A;  4DL6 A;  4DF8 A;  4Z6F A;  1MQ3 A;  4P4O A;  2ZTD A;  4QZC A;  1ZQX A;  2M9N A;  3GV8 B;  5KFO A;  4I2I A;  1A0P A;  5KG1 A;  3SV4 A;  1ZQZ A;  2KHQ A;  2PMZ F;  4HAI A;  2FMQ A;  4UBC A;  2JEI A;  4RQ2 A;  2BCR A;  3I1Y A;  4OJO A;  3JPT A;  1DK3 A;  4OD0 A;  2QB0 A;  3M6K A;  1ZQK A;  1ZET A;  4RUA A;  2IHM A;  3Q8Q B;  2ZIW B;  5KAF U;  4ED7 A;  3TFR A;  3TAP A;  2KSO B;  3Q8P B;  2F3N A;  3PSI A;  1S77 D;  3D2S A;  4MHV A;  4EBE A;  2UVR A;  3N97 B;  4KX3 A;  3GV5 B;  3IN5 A;  2ASD A;  2NYV A;  9ICX A;  4Z6D A;  3ISC A;  5ALH A;  4DFM A;  2P6R A;  2K8B B;  5AKI A;  2HI0 A;  4R66 A;  3PO4 A;  2L5Y A;  4NL9 C;  1ZQT A;  4Y2P A;  3M8R A;  3BZK A;  4BXO A;  2ZXH A;  1XNS A;  4JMU A;  2DGZ A;  2OHF A;  1WWV A;  3TFS A;  1SXE A;  1TVA A;  1Z00 B;  4QIW F;  5DDM A;  2E8M A;  3D6J A;  2CXY A;  5F9L A;  5KL8 B;  2NO5 A;  4I27 A;  3L4P A;  1S0O A;  3IG8 A;  4F4Z A;  5AM5 A;  1A76 A;  2PKE A;  2QB1 A;  4RQ7 A;  2D6F C;  4ECX A;  8ICF A;  5ALO A;  5DBB A;  4I29 A;  4PGY A;  2ZJ5 A;  1FIQ A;  2MRL A;  1XS9 D;  1XU4 A;  3MGI A;  3C1Z A;  3V7L A;  9ICS A;  3R9K A;  4R64 A;  4O3N A;  1PVR A;  4G3I A;  1JXE A;  2F76 X;  3ZDC A;  4YMM A;  2JH7 A;  2HSZ A;  5AK3 A;  1F5S A;  4M9H A;  9ICB A;  3SR6 A;  3UQ2 A;  1X6J A;  2UVU A;  2G08 A;  1XSL A;  4TUR A;  5J2B A;  1QSS A;  4FS2 A;  4ACO A;  5K4L A;  4YXJ A;  2VAN A;  3IG5 A;  4Y2Q A;  5AIA A;  2EQY A;  4O3R A;  1K5O A;  1NOM A;  2D3D A;  3GII A;  2Z7J A;  4QZE A;  3MFH A;  3FC4 A;  4YD1 A;  4B9S A;  5ALK A;  1KLN A;  2DKX A;  5EE0 A;  2YB1 A;  1LKY B;  3HJE A;  1SV0 A;  2BQU A;  5J0Q A;  4RQ6 A;  1KTQ A;  1UQV A;  5EE9 A;  4XQ8 A;  1U48 A;  1JI7 A;  2YN4 A;  3ALR A;  2AQ4 A;  2E8N A;  2JR5 A;  5ALM A;  4JV2 A;  2ODG A;  1NJX A;  4M47 A;  7ICM A;  3C23 A;  1NKB A;  4R8U A;  4M9L A;  2WF5 A;  3ED5 A;  2W9B B;  4NLC A;  1ZQY A;  4Q44 A;  3EPG A;  2JEG A;  1RQL A;  8ICK A;  3U26 A;  3G6V A;  4DS4 A;  4NM1 A;  1TK8 A;  2KOB A;  1CEZ A;  3WKC A;  3E2E A;  2KKP A;  5JU5 A;  3SEN A;  5KFT A;  3UXO A;  5J0T A;  5J8Y A;  3QE9 Y;  2R8J A;  2R8I A;  2OYY A;  3HKZ C;  4GFJ A;  2G09 A;  3RB6 A;  3L5K A;  4ELU A;  1Z19 A;  4LZG A;  4KLJ A;  4M9J A;  2HVH A;  4YR0 A;  5CJ7 A;  4M6W B;  2EH9 A;  3WK5 A;  3RJG A;  2PFQ A;  1ZQF A;  1ZQW A;  8ICH A;  1X9W A;  4QZH A;  2Y9T A;  3D2Q A;  4B9V A;  4KMO B;  4M9G A;  4EYH B;  4QW9 A;  3PST A;  1JRO A;  1ZQP A;  3H0L B;  3WK7 A;  2DFL A;  3KZX A;  3BQ1 A;  3GQC A;  4ECQ A;  3EZ5 A;  5EWE A;  8ICX A;  3PSP A;  3RH5 A;  3TQ1 A;  5HR7 A;  7ICL A;  9ICE A;  2FJ6 A;  3ZD9 A;  4C8L A;  8ICA A;  3NRW A;  1Q46 A;  5BPC A;  3T3F A;  4F2S A;  4J03 A;  1Z4N A;  5CA7 A;  4Y2Y A;  2GO7 A;  1BGX T;  5KFP A;  5ALT A;  1ZD3 A;  1NI3 A;  4ED3 A;  2W43 A;  2YMP A;  3GIM A;  2W9A A;  5DKW A;  3D2N A;  3HKZ F;  2O6K A;  4DFP A;  1TAU A;  1U9L A;  2KN7 A;  8ICY A;  3QU4 A;  2KVC A;  3QUB A;  5HHH A;  3AQE A;  1U45 A;  4UAS A;  4JWN A;  2BPF A;  5AKG A;  4EEN A;  4JB3 A;  3AEV A;  1XO1 A;  3CP8 A;  2G5I B;  4P2H A;  4C4S A;  1YT3 A;  4YFK A;  4Q8E A;  3UM9 A;  2ALZ A;  3TAR A;  4F3O A;  5KT4 A;  2HHX A;  1ED1 A;  3KOO A;  3ETL A;  2J6T A;  2QLT A;  2JRZ A;  5ALW A;  3AUO A;  3NAS A;  3AQF A;  3BJY A;  4M2Y A;  2HW3 A;  2ZJ8 A;  3V7K A;  5D4B A;  5DDY A;  3MGV A;  1ZQC A;  2YY6 A;  2BQ3 A;  4O3M A;  5J2F A;  3KKA A;  3H8S A;  8ICB A;  4USA A;  2LM1 A;  1IIP A;  1L7N A;  5KFF A;  4DSI A;  2KIV A;  4J9Q A;  4LJX A;  3B9J A;  3V6H A;  2KIC A;  5J0O A;  3FM9 A;  1ZOL A;  1TAQ A;  5DQH A;  4IRK A;  3NTU A;  1L8L A;  1ZQO A;  4P0Q A;  4DFD A;  4UB5 A;  1WCN A;  2PFO A;  3C29 A;  5A0L A;  4PL1 A;  4DSF A;  4QZG A;  4NLK A;  2DQN B;  2I5H A;  4BDP A;  5DB8 A;  3BDP A;  5DB7 A;  3MAB A;  1BPX A;  4RQM A;  2H3I A;  3AU2 A;  2DWQ A;  4C7Z A;  2BQR A;  4DL3 A;  3H40 A;  2GLE A;  3ZDE A;  4J9O A;  1UHU A;  3S6J A;  3RH4 A;  4RQ0 A;  3ZD8 A;  2ASJ A;  2JXJ A;  2LYB A;  3CRX A;  2R8G A;  5GTI U;  3PMN A;  1SGG A;  2KSO A;  3MBY A;  1B22 A;  1YZ7 A;  2XID A;  3M6Z A;  1RXW A;  2DPI A;  4KLF A;  4J9R A;  5L1M A;  1NZB A;  9ICH A;  2K8C B;  1L7M A;  4YQW A;  2LHT A;  4R63 A;  5KFB A;  5AKJ A;  3MR6 A;  1NZP A;  1T3Q A;  1J97 A;  2C2R A;  3G6Y A;  3MR2 A;  4UAT A;  5G5G A;  3PW5 A;  4F2R A;  1Z00 A;  4IRD A;  1B4F A;  4NLG A;  4YN4 A;  4F5R A;  5KT6 A;  4QZF A;  4I28 A;  2LM4 A;  4J9P A;  3DV9 A;  4UAV A;  1S76 D;  1ZQE A;  3RR7 A;  3WKE A;  2KFZ A;  2HMX A;  4NV0 A;  2K4E A;  4KLD A;  4ED6 A;  2MAX A;  5ALG A;  2BCQ A;  1TFR A;  1V38 A;  4AYB C;  4KN7 A;  4NM2 A;  4KX5 A;  4F5N A;  8ICW A;  2HOQ A;  1EXN A;  4UB3 A;  1JN3 A;  4IQT A;  1VLB A;  4YR3 A;  5EE1 A;  1RQN A;  1U4B A;  2FPL A;  3QUQ A;  2J6S A;  1SWV A;  3LVW A;  2HHW A;  9ICI A;  2CN1 A;  3F2C A;  7ICK A;  3O0F A;  2KNJ A;  4F4K A;  1QQ7 A;  1NK9 A;  5L1K A;  4OCZ A;  1XWL A;  1N2X A;  5ALX A;  5J2H A;  3F53 A;  4ICA A;  1PK1 B;  3PX4 A;  1PZN A;  4CRX A;  1AQ6 A;  3BS7 A;  7ICO A;  5J0U A;  3EW9 A;  4PJ0 U;  3EYZ A;  1ZYQ A;  2EZX A;  4PGX A;  2I9G A;  7ICF A;  2AGQ A;  5DG9 A;  2BDP A;  2WB1 F;  1RZT A;  4UB1 A;  4CF4 A;  1T7P A;  4CGZ A;  4G9B A;  2FPK A;  2XIC A;  4CDG A;  4FS1 A;  1PK3 A;  3T5K A;  2ES6 A;  3DDH A;  4QZD A;  4CCH A;  2W9B A;  2FI1 A;  3RB4 A;  4QWE A;  7ICG A;  4RT3 A;  3F5A A;  4J9N A;  2G0A A;  4NLB A;  2LYA A;  2IBK A;  3Q8L A;  1V97 A;  5L1J A;  4EEK A;  1LB2 B;  5KFY A;  7ICN A;  2Y0S F;  1ZQB A;  5DB6 A;  4KLI A;  3FDS A;  3H0M B;  2KV2 A;  2VKQ A;  2BCS A;  5J2I A;  4EX7 A;  1WG8 A;  2OM6 A;  5AKL A;  5KFH A;  9ICJ A;  2KFN A;  3KFU F;  2PFP A;  4M6W A;  3TI0 A;  1MQ2 A;  1KQQ A;  5G5H A;  2BCV A;  5IIN A;  3QUC A;  4KLG A;  3QNM A;  4KLE A;  4JV0 A;  4ED1 A;  9ICN A;  5J0R A;  4F5P A;  1NK0 A;  3F5E A;  3T5L A;  2KZM A;  3M9M B;  2H3V A;  3HIL A;  3Q8R B;  3UQ0 A;  2XY6 A;  4NY8 A;  3PML A;  2F1I A;  3FYH A;  9ICK A;  3OGU A;  2QKQ A;  4TQS A;  5EOZ A;  2R18 A;  4QIW C;  5HNK A;  5AI9 A;  1A77 A;  1DRG A;  5AI4 A;  1NKE A;  3ISB A;  1SXD A;  5DBA A;  2BPG A;  5DLG A;  2IOF K;  2IA6 A;  2P35 A;  4B9M A;  2IOF A;  4FZL A;  1BPZ A;  4KIT B;  1KL9 A;  5ALE A;  5AI6 A;  4ECR A;  3UXP A;  3HRD D;  2QAR B;  5KT2 A;  1QCK A;  1S8O A;  4CF5 A;  2VA2 A;  2BHN A;  4QZI A;  4Y2V A;  2W8K A;  5KT5 A;  2YMQ A;  1WYG A;  2KHV A;  4FZN A;  1N56 A;  9ICG A;  5J29 A;  7ICU A;  2F2A B;  2XVT A;  3T79 A;  1L5U A;  2RQ5 A;  1JIH A;  1ECW A;  4QJF B;  3SD7 A;  1F0M A;  3HWT A;  3PW0 A;  1RG6 A;  4TUS A;  1T3N A;  4YD2 A;  4B9U A;  3TKA A;  1S10 A;  4PL2 A;  1ZQH A;  8ICT A;  5JRT A;  1SIJ A;  3THV A;  2ZXI A;  2W03 A;  4F8R A;  5ALY A;  5ALZ A;  1TK5 A;  8ICE A;  2EZY A;  4Z6E A;  4UAY A;  4EZ9 A;  7ICQ A;  9ICA A;  1P7D A;  1FFU A;  5AKY A;  4MF2 A;  2EAO A;  4MEY A;  2N1R A;  3TAD A;  4BX9 C;  1F44 A;  4F4X A;  2E5S A;  2F77 X;  4B9N A;  2KE7 A;  1L3T A;  4DSJ A;  2OH2 A;  4KLL A;  2YB4 A;  2W9C B;  3BZC A;  3RJE A;  2EAN A;  5AK4 A;  2ZIV A;  4DOB A;  3MDA A;  4F4W A;  1ARO P;  3CNH A;  3QYP A;  5AI5 A;  3LYS A;  5AHX A;  5KNI A;  4RQ4 A;  7ICE A;  4XUS A;  3PW4 A;  3IDW A;  2BKE A;  2XC9 A;  9ICV A;  2JMG A;  2A3V A;  4PZN A;  5KFX A;  2KVS A;  3NVV A;  3N7R C;  3LWM A;  4BWJ A;  2LI6 A;  3VCB A;  4UAR A;  4UBB A;  1UA1 A;  3C2K A;  2ZG6 A;  5L9X A;  2WF7 A;  1NNL A;  3NVY A;  1GO3 F;  2W7O A;  2B21 A;  3RRG A;  7ICR A;  5EWG A;  1NK4 A;  3N7P D;  3PR5 B;  5ALD A;  3AM9 A;  5D46 A;  4O3Q A;  4QWA A;  5C5J A;  1KFT A;  4Q45 A;  3QZ7 A;  2K89 A;  5TIS U;  5EWF A;  5J2A A;  4QW8 A;  4QZ9 A;  3OHB A;  4U7C A;  4OJ6 A;  5KFW A;  1SV0 C;  1D8B A;  3GIJ A;  2LBO A;  4MFF A;  1J2N A;  2AU0 A;  3WK8 A;  1KEJ A;  2VJ5 A;  5KFV A;  5AK5 A;  4TUP A;  5KG7 A;  4I2G A;  2BR0 A;  4UB2 A;  4IR9 A;  1HIW A;  5AKX A;  2MUT B;  2A1J A;  3IM1 A;  3RJJ A;  5KFE A;  3B0X A;  3N4M B;  2NV3 A;  4EBD A;  2BZF A;  3SMV A;  5J2D A;  5ALR A;  5ALU A;  4LZD A;  4IC9 A;  8ICP A;  4J9L A;  2NRZ A;  4UB4 A;  1FEZ A;  4GC6 A;  5J0X A;  5B5E U;  3M8S A;  1ZQJ A;  2K4I A;  1SKW A;  3HPO A;  4C8O A;  4QZ8 A;  1SB3 C;  5J8Y C;  4IS7 A;  3PW7 A;  7ICI A;  4K4H A;  5J2E A;  4M04 A;  1JX4 A;  1RPL A;  2FLP A;  4ELT A;  1ZRM A;  3QEA Z;  5KFM A;  3GIL A;  1PK1 A;  3RF9 A;  1TV9 A;  3V6K A;  1Z4O A;  4I2J A;  4KLT A;  2W11 A;  1XC9 A;  4M9N A;  2R8H A;  1SV4 A;  1JRP A;  1KFD A;  9ICC A;  5AIC A;  1OW5 A;  8ICC A;  1MSW D;  2R8K A;  2FDR A;  3PR4 A;  1JXL A;  4O0I A;  4I2H A;  2NRV A;  4JK1 A;  1S0M A;  1T94 A;  4B9T A;  4BWM A;  5CHG A;  1N63 A;  2ZTE A;  3T5H A;  2JH1 A;  2LMR A;  5KAI U;  5KFU A;  2AHO B;  4IRC A;  1DOQ A;  4YMO A;  5ALL A;  4KLH A;  4QZA A;  2YTU A;  2F44 A;  3QU2 A;  1CI4 A;  1DGJ A;  4YMN A;  3IV6 A;  1ZQD A;  1WUD A;  2K4H A;  3PV8 A;  4JUZ A;  4TQR A;  3RB3 A;  5AM1 A;  2F1J A;  1DK2 A;  2XCA A;  4DFJ A;  5HHI A;  5KL1 B;  7ICV A;  2B0C A;  3WKD A;  3C5G A;  3LVV A;  4C8M A;  4RUC A;  4US9 A;  2JGA A;  1X9X A;  2MA1 A;  5J0P A;  2H3Q A;  2EAM A;  1SL1 A;  3F2B A; 
#chains in the Genus database with same CATH homology
 4MHV A;  3TAC B;  3SEI A;  2EAN A;  1UQV A;  1V85 A;  1PK1 B;  5J8Y C;  1JI7 A;  2LPE A;  1SXD A;  2F8K A;  4IS7 A;  2E8N A;  3BS7 A;  2L5Y A;  3KKA C;  1SGG A;  4NL9 C;  2EAP A;  5KNI A;  2KSO A;  2ESE A;  2QAR B;  5L1M A;  3IDW A;  1WWV A;  1SXE A;  2E8M A;  2DKZ A;  1PK1 A;  4PZN A;  3H8M A;  2K4P A;  1B0X A;  1Z1V A;  2QB1 A;  2E8P A;  4RQN A;  5JU5 A;  1X40 A;  3SEN A;  1DXS A;  1PK3 A;  2JV3 A;  2ES6 A;  1UCV A;  5J8Y A;  1SV4 A;  1OXJ A;  2E8O A;  2QAR A;  1OW5 A;  3KKA A;  4NL9 A;  1COK A;  2B6G A;  1B4F A;  2D8C A;  1X66 A;  1F0M A;  1RG6 A;  3BQ7 A;  1KW4 A;  2KIV A;  3TAD C;  2DL0 A;  2LMR A;  2Y9T A;  3BS5 A;  4NJ8 A;  2YTU A;  2F44 A;  5JRT A;  1WWU A;  2KG5 A;  4PZO A;  2FE9 A;  3BS5 B;  2QB0 B;  1SV0 C;  1V38 A;  2Y9U A;  3K1R B;  2K60 A;  5JTI A;  3HIL A;  2EAO A;  4RQM A;  3TAD A;  2QB0 A;  2D3D A;  2KE7 A;  1LKY A;  2KMD A;  1X9X A;  2QKQ A;  5F3X B;  2DKX A;  1LKY B;  2EAM A;  1SV0 A;  2KSO B;  2F3N A;  2GLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...