1V8RA

Crystal structure analysis of the adp-ribose pyrophosphatase complexed with adp-ribose and zn
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
159
structure length
153
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 35
structure length 153
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8rA00
2VNPA 1SU2A 5C8LA 3HYQA 3N9UA 1V8RA 2B0VA 5GHMA 3CNGA 2B2KA 2G74A 2GT2A 3Q4IA 1PPWA 2PQVA 4NFWA 4ZG0A 1NFZA 1V8WA 3F6AA 4ICKA 1V8SA 2YVNA 1VHZA 3FFUA 4YOQA 3L85A 1V8NA 2J8QA 4KTBA 5ANVA 4S2WA 5GHPA 5BONA 2FVVA 2QKMB 2PNYA 3X0MA 5C7TA 1QVJA 3X0LA 4S2YA 2JVBA 4C9XA 2GB5A 2DSBA 2QJTA 3WHWA 3X0IA 1XSAA 3GG6A 2QJOA 2O5FA 3HHJA 2A8SA 3SHDA 5IW5A 1PUSA 4S2VA 4V14A 3FSPA 1X84A 1VIUA 3BHOA 5BS6A 1R67A 1NQZA 4MPOA 2ICJA 5ANWA 3G0QA 4IJXA 4ILQA 1V8LA 2AZWA 2O5WA 4YPHA 3X0NA 1VCDA 5I8UA 1V8MA 4JZTA 4N1UA 4YPRA 5ANUA 3X0RA 3BM4A 3O6ZA 1IRYA 1V8IA 3Q2SA 1PPVA 5LPGA 2GT4A 1PUQA 1RRQA 1VRLA 1VK6A 3COUA 3O61A 5IW4A 4JZUA 3MGMA 2A6TA 1OW2A 3Q2TA 1KTGA 3X0SA 5CFIA 1Q54A 5HZXA 1G9QA 3SMDA 2I6KA 1RYAA 4JZVA 1MK1A 5FSLA 1GA7A 5DEQA 4JZSA 5ISYA 2R5WA 2W4EA 4KYXA 3R03A 1V8TA 1Q27A 4DYWA 2B06A 1V8YA 2FMLA 3GZ6A 1SOIA 4S2XA 2YVMA 1NFSA 1VC9A 1TUMA 2DSDA 1V8VA 1X83A 5FSOA 3SONA 1PUNA 3E57A 3N77A 3Q91A 3RH7A 3X0PA 5DPKA 1KT9A 1F3YA 1KHZA 1NQYA 3I7VA 1VIQA 2RRKA 3MCFA 3X0OA 3P6YA 5ANSA 2XSQA 2G73A 2I8TA 3BAPA 2FKBA 3QSJA 3MDIA 3O8SA 1VHGA 5FSMA 2KDVA 2A8TA 5GHNA 2DSCA 4HVYA 3O52A 3J7Ye 3H95A 1K2EA 1Q33A 2I8UA 3EESA 4N1TA 3Q1PA 4HFQA 1VC8A 3EF5A 5C7QA 3ID9A 3ZR1A 3EXQA 3A6SA 3GRNA 2YVOA 3KVHA 4NFXA 1MUTA 1U20A 1PVFA 3A6UA 1X51A 2A8QA 1MR2A 3FCMA 3A6TA 3GZ5A 5FSIA 5DDGA 5ANTA 1RRSA 2CL3A 5GHJA 2DUKA 3ACAA 2YVPA 3Q93A 2ICKA 1MP2A 1JKNA 1MQEA 2VNQA 1PPXA 3I7UA 3O69A 3DUPA 3GZ8A 3MDGA 5CFJA 3X0KA 1SZ3A 4KG4A 1K26A 3P5TA 1G0SA 1JRKA 3I9XA 1I9AA 3A6VA 3AC9A 5GHIA 3X0JA 3FK9A 2DHOA 2YYHA 4K6EA 1V8UA 2A8PA 1HX3A 1XSBA 1SJYA 5FSKA 2KDWA 5GHOA 5DD4A 3ZR0A 1XSCA 3OGAA 3FJYA 2Q9PA 3F13A 3EEUA 1HZTA 5FSNA 3DKUA 5GHQA 3U53A 3X0QA 3GWYA 2O1CA 4KG3A 4C9WA 2A8RA 1MQWA
chains in the Genus database with same CATH superfamily
2VNPA 1SU2A 5C8LA 3HYQA 4J7HA 3N9UA 1V8RA 2B0VA 5GHMA 3CNGA 2B2KA 2G74A 2GT2A 3Q4IA 1PPWA 2PQVA 4NFWA 4ZG0A 1NFZA 1V8WA 3F6AA 4ICKA 1V8SA 2YVNA 1VHZA 3FFUA 4YOQA 3L85A 1V8NA 2J8QA 4KTBA 5ANVA 4S2WA 5GHPA 5BONA 2FVVA 2QKMB 2PNYA 3X0MA 5C7TA 1QVJA 3X0LA 4S2YA 2JVBA 4C9XA 2GB5A 2DSBA 2QJTA 3WHWA 3X0IA 1XSAA 3GG6A 2QJOA 2O5FA 3HHJA 2A8SA 3SHDA 5IW5A 1PUSA 4S2VA 4V14A 3FSPA 1X84A 1VIUA 3BHOA 5BS6A 1R67A 1NQZA 4MPOA 2ICJA 5ANWA 3G0QA 4IJXA 4ILQA 1V8LA 2AZWA 2O5WA 4YPHA 3X0NA 1VCDA 5I8UA 1V8MA 4JZTA 4N1UA 4YPRA 5ANUA 3X0RA 3BM4A 3O6ZA 1IRYA 1V8IA 3Q2SA 1PPVA 5LPGA 2GT4A 1PUQA 1RRQA 1VRLA 1VK6A 3COUA 3O61A 5IW4A 4JZUA 3MGMA 2A6TA 1OW2A 3Q2TA 1KTGA 3X0SA 5CFIA 1Q54A 5HZXA 1G9QA 3SMDA 2I6KA 1RYAA 4JZVA 1MK1A 5FSLA 1GA7A 5DEQA 4JZSA 5ISYA 2R5WA 2W4EA 4KYXA 3R03A 1V8TA 1Q27A 4DYWA 2B06A 1V8YA 2FMLA 3GZ6A 2CZRA 1SOIA 4S2XA 2YVMA 1NFSA 1VC9A 1TUMA 2DSDA 1V8VA 1X83A 5FSOA 3SONA 1PUNA 3E57A 3N77A 3Q91A 3RH7A 3X0PA 5DPKA 1KT9A 1F3YA 1KHZA 1NQYA 3I7VA 1VIQA 2RRKA 3MCFA 3X0OA 3P6YA 5ANSA 2XSQA 2G73A 2I8TA 3BAPA 2FKBA 3QSJA 3MDIA 3O8SA 1VHGA 5FSMA 2KDVA 2A8TA 5GHNA 2DSCA 4HVYA 3O52A 3J7Ye 3H95A 1K2EA 1Q33A 2I8UA 3EESA 4N1TA 3Q1PA 4HFQA 1VC8A 3EF5A 5C7QA 3ID9A 3ZR1A 3EXQA 3A6SA 3GRNA 2YVOA 3KVHA 4NFXA 1MUTA 1U20A 1PVFA 3A6UA 1X51A 2A8QA 1MR2A 3FCMA 3A6TA 3GZ5A 5FSIA 5DDGA 5ANTA 1RRSA 2CL3A 5GHJA 2DUKA 3ACAA 2YVPA 3Q93A 2ICKA 1MP2A 1JKNA 1MQEA 2VNQA 1PPXA 3I7UA 3O69A 3DUPA 3GZ8A 3MDGA 5CFJA 3X0KA 1SZ3A 4KG4A 1K26A 3P5TA 4J7GA 1G0SA 1JRKA 3I9XA 1I9AA 3A6VA 3AC9A 5GHIA 3X0JA 3FK9A 2DHOA 2YYHA 4K6EA 1V8UA 2A8PA 1HX3A 1XSBA 1SJYA 5FSKA 2KDWA 5GHOA 5DD4A 3ZR0A 1XSCA 3OGAA 3FJYA 2Q9PA 3F13A 3EEUA 1HZTA 5FSNA 3DKUA 5GHQA 3U53A 3X0QA 3GWYA 2O1CA 4KG3A 4C9WA 2A8RA 1MQWA
chains in the Genus database with same CATH topology
2VNPA 1SU2A 5C8LA 3HYQA 4J7HA 3N9UA 1V8RA 2B0VA 5GHMA 3CNGA 2B2KA 2G74A 2GT2A 3Q4IA 1PPWA 2PQVA 4NFWA 4ZG0A 1NFZA 1V8WA 3F6AA 4ICKA 1V8SA 2YVNA 1VHZA 3FFUA 4YOQA 3L85A 1V8NA 2J8QA 4KTBA 5ANVA 4S2WA 5GHPA 5BONA 2FVVA 2QKMB 2PNYA 3X0MA 5C7TA 1QVJA 3X0LA 4S2YA 2JVBA 4C9XA 2GB5A 2DSBA 2QJTA 3WHWA 3X0IA 1XSAA 3GG6A 2QJOA 2O5FA 3HHJA 2A8SA 3SHDA 5IW5A 1PUSA 4S2VA 4V14A 3FSPA 1X84A 1VIUA 3BHOA 5BS6A 1R67A 1NQZA 4MPOA 2ICJA 5ANWA 3G0QA 4IJXA 4ILQA 1V8LA 2AZWA 2O5WA 4YPHA 3X0NA 1VCDA 5I8UA 1V8MA 4JZTA 4N1UA 4YPRA 5ANUA 3X0RA 3BM4A 3O6ZA 1IRYA 1V8IA 3Q2SA 1PPVA 5LPGA 2GT4A 1PUQA 1RRQA 1VRLA 1VK6A 3COUA 3O61A 5IW4A 4JZUA 3MGMA 2A6TA 1OW2A 3Q2TA 1KTGA 3X0SA 5CFIA 1Q54A 5HZXA 1G9QA 3SMDA 2I6KA 1RYAA 4JZVA 1MK1A 5FSLA 1GA7A 5DEQA 4JZSA 5ISYA 2R5WA 2W4EA 4KYXA 3R03A 1V8TA 1Q27A 4DYWA 2B06A 1V8YA 2FMLA 3GZ6A 2CZRA 1SOIA 4S2XA 2YVMA 1NFSA 1VC9A 1TUMA 2DSDA 1V8VA 1X83A 5FSOA 3SONA 1PUNA 3E57A 3N77A 3Q91A 3RH7A 3X0PA 5DPKA 1KT9A 1F3YA 1KHZA 1NQYA 3I7VA 1VIQA 2RRKA 3MCFA 3X0OA 3P6YA 5ANSA 2XSQA 2G73A 2I8TA 3BAPA 2FKBA 3QSJA 3MDIA 3O8SA 1VHGA 5FSMA 2KDVA 2A8TA 5GHNA 2DSCA 4HVYA 3O52A 3J7Ye 3H95A 1K2EA 1Q33A 2I8UA 3EESA 4N1TA 3Q1PA 4HFQA 1VC8A 3EF5A 5C7QA 3ID9A 3ZR1A 3EXQA 3A6SA 3GRNA 2YVOA 3KVHA 4NFXA 1MUTA 1U20A 1PVFA 3A6UA 1X51A 2A8QA 1MR2A 3FCMA 3A6TA 3GZ5A 5FSIA 5DDGA 5ANTA 1RRSA 2CL3A 5GHJA 2DUKA 3ACAA 2YVPA 3Q93A 2ICKA 1MP2A 1JKNA 1MQEA 2VNQA 1PPXA 3I7UA 3O69A 3DUPA 3GZ8A 3MDGA 5CFJA 3X0KA 1SZ3A 4KG4A 1K26A 3P5TA 4J7GA 1G0SA 1JRKA 3I9XA 1I9AA 3A6VA 3AC9A 5GHIA 3X0JA 3FK9A 2DHOA 2YYHA 4K6EA 1V8UA 2A8PA 1HX3A 1XSBA 1SJYA 5FSKA 2KDWA 5GHOA 5DD4A 3ZR0A 1XSCA 3OGAA 3FJYA 2Q9PA 3F13A 3EEUA 1HZTA 5FSNA 3DKUA 5GHQA 3U53A 3X0QA 3GWYA 2O1CA 4KG3A 4C9WA 2A8RA 1MQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNP A;  1SU2 A;  5C8L A;  3HYQ A;  3N9U A;  1V8R A;  2B0V A;  5GHM A;  3CNG A;  2B2K A;  2G74 A;  2GT2 A;  3Q4I A;  1PPW A;  2PQV A;  4NFW A;  4ZG0 A;  1NFZ A;  1V8W A;  3F6A A;  4ICK A;  1V8S A;  2YVN A;  1VHZ A;  3FFU A;  4YOQ A;  3L85 A;  1V8N A;  2J8Q A;  4KTB A;  5ANV A;  4S2W A;  5GHP A;  5BON A;  2FVV A;  2QKM B;  2PNY A;  3X0M A;  5C7T A;  1QVJ A;  3X0L A;  4S2Y A;  2JVB A;  4C9X A;  2GB5 A;  2DSB A;  2QJT A;  3WHW A;  3X0I A;  1XSA A;  3GG6 A;  2QJO A;  2O5F A;  3HHJ A;  2A8S A;  3SHD A;  5IW5 A;  1PUS A;  4S2V A;  4V14 A;  3FSP A;  1X84 A;  1VIU A;  3BHO A;  5BS6 A;  1R67 A;  1NQZ A;  4MPO A;  2ICJ A;  5ANW A;  3G0Q A;  4IJX A;  4ILQ A;  1V8L A;  2AZW A;  2O5W A;  4YPH A;  3X0N A;  1VCD A;  5I8U A;  1V8M A;  4JZT A;  4N1U A;  4YPR A;  5ANU A;  3X0R A;  3BM4 A;  3O6Z A;  1IRY A;  1V8I A;  3Q2S A;  1PPV A;  5LPG A;  2GT4 A;  1PUQ A;  1RRQ A;  1VRL A;  1VK6 A;  3COU A;  3O61 A;  5IW4 A;  4JZU A;  3MGM A;  2A6T A;  1OW2 A;  3Q2T A;  1KTG A;  3X0S A;  5CFI A;  1Q54 A;  5HZX A;  1G9Q A;  3SMD A;  2I6K A;  1RYA A;  4JZV A;  1MK1 A;  5FSL A;  1GA7 A;  5DEQ A;  4JZS A;  5ISY A;  2R5W A;  2W4E A;  4KYX A;  3R03 A;  1V8T A;  1Q27 A;  4DYW A;  2B06 A;  1V8Y A;  2FML A;  3GZ6 A;  1SOI A;  4S2X A;  2YVM A;  1NFS A;  1VC9 A;  1TUM A;  2DSD A;  1V8V A;  1X83 A;  5FSO A;  3SON A;  1PUN A;  3E57 A;  3N77 A;  3Q91 A;  3RH7 A;  3X0P A;  5DPK A;  1KT9 A;  1F3Y A;  1KHZ A;  1NQY A;  3I7V A;  1VIQ A;  2RRK A;  3MCF A;  3X0O A;  3P6Y A;  5ANS A;  2XSQ A;  2G73 A;  2I8T A;  3BAP A;  2FKB A;  3QSJ A;  3MDI A;  3O8S A;  1VHG A;  5FSM A;  2KDV A;  2A8T A;  5GHN A;  2DSC A;  4HVY A;  3O52 A;  3J7Y e;  3H95 A;  1K2E A;  1Q33 A;  2I8U A;  3EES A;  4N1T A;  3Q1P A;  4HFQ A;  1VC8 A;  3EF5 A;  5C7Q A;  3ID9 A;  3ZR1 A;  3EXQ A;  3A6S A;  3GRN A;  2YVO A;  3KVH A;  4NFX A;  1MUT A;  1U20 A;  1PVF A;  3A6U A;  1X51 A;  2A8Q A;  1MR2 A;  3FCM A;  3A6T A;  3GZ5 A;  5FSI A;  5DDG A;  5ANT A;  1RRS A;  2CL3 A;  5GHJ A;  2DUK A;  3ACA A;  2YVP A;  3Q93 A;  2ICK A;  1MP2 A;  1JKN A;  1MQE A;  2VNQ A;  1PPX A;  3I7U A;  3O69 A;  3DUP A;  3GZ8 A;  3MDG A;  5CFJ A;  3X0K A;  1SZ3 A;  4KG4 A;  1K26 A;  3P5T A;  1G0S A;  1JRK A;  3I9X A;  1I9A A;  3A6V A;  3AC9 A;  5GHI A;  3X0J A;  3FK9 A;  2DHO A;  2YYH A;  4K6E A;  1V8U A;  2A8P A;  1HX3 A;  1XSB A;  1SJY A;  5FSK A;  2KDW A;  5GHO A;  5DD4 A;  3ZR0 A;  1XSC A;  3OGA A;  3FJY A;  2Q9P A;  3F13 A;  3EEU A;  1HZT A;  5FSN A;  3DKU A;  5GHQ A;  3U53 A;  3X0Q A;  3GWY A;  2O1C A;  4KG3 A;  4C9W A;  2A8R A;  1MQW A; 
#chains in the Genus database with same CATH topology
 2VNP A;  1SU2 A;  5C8L A;  3HYQ A;  4J7H A;  3N9U A;  1V8R A;  2B0V A;  5GHM A;  3CNG A;  2B2K A;  2G74 A;  2GT2 A;  3Q4I A;  1PPW A;  2PQV A;  4NFW A;  4ZG0 A;  1NFZ A;  1V8W A;  3F6A A;  4ICK A;  1V8S A;  2YVN A;  1VHZ A;  3FFU A;  4YOQ A;  3L85 A;  1V8N A;  2J8Q A;  4KTB A;  5ANV A;  4S2W A;  5GHP A;  5BON A;  2FVV A;  2QKM B;  2PNY A;  3X0M A;  5C7T A;  1QVJ A;  3X0L A;  4S2Y A;  2JVB A;  4C9X A;  2GB5 A;  2DSB A;  2QJT A;  3WHW A;  3X0I A;  1XSA A;  3GG6 A;  2QJO A;  2O5F A;  3HHJ A;  2A8S A;  3SHD A;  5IW5 A;  1PUS A;  4S2V A;  4V14 A;  3FSP A;  1X84 A;  1VIU A;  3BHO A;  5BS6 A;  1R67 A;  1NQZ A;  4MPO A;  2ICJ A;  5ANW A;  3G0Q A;  4IJX A;  4ILQ A;  1V8L A;  2AZW A;  2O5W A;  4YPH A;  3X0N A;  1VCD A;  5I8U A;  1V8M A;  4JZT A;  4N1U A;  4YPR A;  5ANU A;  3X0R A;  3BM4 A;  3O6Z A;  1IRY A;  1V8I A;  3Q2S A;  1PPV A;  5LPG A;  2GT4 A;  1PUQ A;  1RRQ A;  1VRL A;  1VK6 A;  3COU A;  3O61 A;  5IW4 A;  4JZU A;  3MGM A;  2A6T A;  1OW2 A;  3Q2T A;  1KTG A;  3X0S A;  5CFI A;  1Q54 A;  5HZX A;  1G9Q A;  3SMD A;  2I6K A;  1RYA A;  4JZV A;  1MK1 A;  5FSL A;  1GA7 A;  5DEQ A;  4JZS A;  5ISY A;  2R5W A;  2W4E A;  4KYX A;  3R03 A;  1V8T A;  1Q27 A;  4DYW A;  2B06 A;  1V8Y A;  2FML A;  3GZ6 A;  2CZR A;  1SOI A;  4S2X A;  2YVM A;  1NFS A;  1VC9 A;  1TUM A;  2DSD A;  1V8V A;  1X83 A;  5FSO A;  3SON A;  1PUN A;  3E57 A;  3N77 A;  3Q91 A;  3RH7 A;  3X0P A;  5DPK A;  1KT9 A;  1F3Y A;  1KHZ A;  1NQY A;  3I7V A;  1VIQ A;  2RRK A;  3MCF A;  3X0O A;  3P6Y A;  5ANS A;  2XSQ A;  2G73 A;  2I8T A;  3BAP A;  2FKB A;  3QSJ A;  3MDI A;  3O8S A;  1VHG A;  5FSM A;  2KDV A;  2A8T A;  5GHN A;  2DSC A;  4HVY A;  3O52 A;  3J7Y e;  3H95 A;  1K2E A;  1Q33 A;  2I8U A;  3EES A;  4N1T A;  3Q1P A;  4HFQ A;  1VC8 A;  3EF5 A;  5C7Q A;  3ID9 A;  3ZR1 A;  3EXQ A;  3A6S A;  3GRN A;  2YVO A;  3KVH A;  4NFX A;  1MUT A;  1U20 A;  1PVF A;  3A6U A;  1X51 A;  2A8Q A;  1MR2 A;  3FCM A;  3A6T A;  3GZ5 A;  5FSI A;  5DDG A;  5ANT A;  1RRS A;  2CL3 A;  5GHJ A;  2DUK A;  3ACA A;  2YVP A;  3Q93 A;  2ICK A;  1MP2 A;  1JKN A;  1MQE A;  2VNQ A;  1PPX A;  3I7U A;  3O69 A;  3DUP A;  3GZ8 A;  3MDG A;  5CFJ A;  3X0K A;  1SZ3 A;  4KG4 A;  1K26 A;  3P5T A;  4J7G A;  1G0S A;  1JRK A;  3I9X A;  1I9A A;  3A6V A;  3AC9 A;  5GHI A;  3X0J A;  3FK9 A;  2DHO A;  2YYH A;  4K6E A;  1V8U A;  2A8P A;  1HX3 A;  1XSB A;  1SJY A;  5FSK A;  2KDW A;  5GHO A;  5DD4 A;  3ZR0 A;  1XSC A;  3OGA A;  3FJY A;  2Q9P A;  3F13 A;  3EEU A;  1HZT A;  5FSN A;  3DKU A;  5GHQ A;  3U53 A;  3X0Q A;  3GWY A;  2O1C A;  4KG3 A;  4C9W A;  2A8R A;  1MQW A; 
#chains in the Genus database with same CATH homology
 2VNP A;  1SU2 A;  5C8L A;  3HYQ A;  4J7H A;  3N9U A;  1V8R A;  2B0V A;  5GHM A;  3CNG A;  2B2K A;  2G74 A;  2GT2 A;  3Q4I A;  1PPW A;  2PQV A;  4NFW A;  4ZG0 A;  1NFZ A;  1V8W A;  3F6A A;  4ICK A;  1V8S A;  2YVN A;  1VHZ A;  3FFU A;  4YOQ A;  3L85 A;  1V8N A;  2J8Q A;  4KTB A;  5ANV A;  4S2W A;  5GHP A;  5BON A;  2FVV A;  2QKM B;  2PNY A;  3X0M A;  5C7T A;  1QVJ A;  3X0L A;  4S2Y A;  2JVB A;  4C9X A;  2GB5 A;  2DSB A;  2QJT A;  3WHW A;  3X0I A;  1XSA A;  3GG6 A;  2QJO A;  2O5F A;  3HHJ A;  2A8S A;  3SHD A;  5IW5 A;  1PUS A;  4S2V A;  4V14 A;  3FSP A;  1X84 A;  1VIU A;  3BHO A;  5BS6 A;  1R67 A;  1NQZ A;  4MPO A;  2ICJ A;  5ANW A;  3G0Q A;  4IJX A;  4ILQ A;  1V8L A;  2AZW A;  2O5W A;  4YPH A;  3X0N A;  1VCD A;  5I8U A;  1V8M A;  4JZT A;  4N1U A;  4YPR A;  5ANU A;  3X0R A;  3BM4 A;  3O6Z A;  1IRY A;  1V8I A;  3Q2S A;  1PPV A;  5LPG A;  2GT4 A;  1PUQ A;  1RRQ A;  1VRL A;  1VK6 A;  3COU A;  3O61 A;  5IW4 A;  4JZU A;  3MGM A;  2A6T A;  1OW2 A;  3Q2T A;  1KTG A;  3X0S A;  5CFI A;  1Q54 A;  5HZX A;  1G9Q A;  3SMD A;  2I6K A;  1RYA A;  4JZV A;  1MK1 A;  5FSL A;  1GA7 A;  5DEQ A;  4JZS A;  5ISY A;  2R5W A;  2W4E A;  4KYX A;  3R03 A;  1V8T A;  1Q27 A;  4DYW A;  2B06 A;  1V8Y A;  2FML A;  3GZ6 A;  2CZR A;  1SOI A;  4S2X A;  2YVM A;  1NFS A;  1VC9 A;  1TUM A;  2DSD A;  1V8V A;  1X83 A;  5FSO A;  3SON A;  1PUN A;  3E57 A;  3N77 A;  3Q91 A;  3RH7 A;  3X0P A;  5DPK A;  1KT9 A;  1F3Y A;  1KHZ A;  1NQY A;  3I7V A;  1VIQ A;  2RRK A;  3MCF A;  3X0O A;  3P6Y A;  5ANS A;  2XSQ A;  2G73 A;  2I8T A;  3BAP A;  2FKB A;  3QSJ A;  3MDI A;  3O8S A;  1VHG A;  5FSM A;  2KDV A;  2A8T A;  5GHN A;  2DSC A;  4HVY A;  3O52 A;  3J7Y e;  3H95 A;  1K2E A;  1Q33 A;  2I8U A;  3EES A;  4N1T A;  3Q1P A;  4HFQ A;  1VC8 A;  3EF5 A;  5C7Q A;  3ID9 A;  3ZR1 A;  3EXQ A;  3A6S A;  3GRN A;  2YVO A;  3KVH A;  4NFX A;  1MUT A;  1U20 A;  1PVF A;  3A6U A;  1X51 A;  2A8Q A;  1MR2 A;  3FCM A;  3A6T A;  3GZ5 A;  5FSI A;  5DDG A;  5ANT A;  1RRS A;  2CL3 A;  5GHJ A;  2DUK A;  3ACA A;  2YVP A;  3Q93 A;  2ICK A;  1MP2 A;  1JKN A;  1MQE A;  2VNQ A;  1PPX A;  3I7U A;  3O69 A;  3DUP A;  3GZ8 A;  3MDG A;  5CFJ A;  3X0K A;  1SZ3 A;  4KG4 A;  1K26 A;  3P5T A;  4J7G A;  1G0S A;  1JRK A;  3I9X A;  1I9A A;  3A6V A;  3AC9 A;  5GHI A;  3X0J A;  3FK9 A;  2DHO A;  2YYH A;  4K6E A;  1V8U A;  2A8P A;  1HX3 A;  1XSB A;  1SJY A;  5FSK A;  2KDW A;  5GHO A;  5DD4 A;  3ZR0 A;  1XSC A;  3OGA A;  3FJY A;  2Q9P A;  3F13 A;  3EEU A;  1HZT A;  5FSN A;  3DKU A;  5GHQ A;  3U53 A;  3X0Q A;  3GWY A;  2O1C A;  4KG3 A;  4C9W A;  2A8R A;  1MQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...