1V8WA

Crystal structure analysis of the adp-ribose pyrophosphatase of e82q mutant, complexed with so4 and zn
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
154
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRQLAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 35
structure length 154
sequence length 158
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8wA00
3MDIA 1G9QA 2VNPA 4S2VA 5ANUA 1NQYA 1VK6A 2YVNA 4K6EA 2DSDA 3FK9A 4S2YA 2DHOA 4NFXA 1Q54A 3O6ZA 2I8TA 3P5TA 3J7Ye 1IRYA 5DPKA 2Q9PA 2YVMA 2QKMB 3GG6A 1SZ3A 5ANVA 2DSCA 3X0PA 5FSIA 3DUPA 3A6UA 3FJYA 3I7UA 1SOIA 3X0JA 1K2EA 3QSJA 2ICKA 1VHZA 1VC9A 3Q91A 4JZUA 3FCMA 2JVBA 4V14A 1X84A 3GZ6A 3MDGA 2YVOA 4N1UA 1R67A 4YOQA 3H95A 2B2KA 3GZ5A 1V8LA 3Q4IA 3HHJA 3P6YA 2A8RA 3WHWA 4C9XA 3DKUA 2XSQA 4ILQA 5C7QA 5IW5A 5GHOA 1VHGA 2FKBA 1KHZA 1KTGA 2QJTA 3X0RA 4YPHA 3ACAA 3EF5A 2DSBA 1V8TA 4KG3A 1VC8A 2A8TA 5GHQA 2A8SA 2VNQA 4S2WA 3FSPA 1MQEA 5C7TA 5CFJA 2B0VA 1U20A 1Q27A 2O1CA 3SMDA 4ZG0A 1MK1A 3ZR0A 1PUSA 1NFSA 1PVFA 2A8PA 2CL3A 3BHOA 3X0QA 3X0SA 2W4EA 4ICKA 2QJOA 3O52A 3GZ8A 1RRQA 3AC9A 2DUKA 3KVHA 5FSMA 4HVYA 4IJXA 3L85A 1G0SA 1SU2A 5I8UA 3MGMA 5FSKA 1MP2A 2PQVA 4JZSA 1V8UA 2O5WA 1HZTA 3BM4A 2FMLA 2A8QA 1MR2A 4C9WA 5ISYA 3Q2TA 5DDGA 3ZR1A 2O5FA 1VIQA 3E57A 2GT2A 1VIUA 3EEUA 4KYXA 1PUNA 1VCDA 3COUA 1K26A 2YYHA 3EESA 5GHJA 5GHMA 1RRSA 2RRKA 3GRNA 1V8YA 5GHNA 5ANSA 3SONA 1V8IA 3CNGA 5ANWA 3I9XA 5ANTA 3ID9A 3R03A 1V8NA 1Q33A 3N77A 3O8SA 3MCFA 2PNYA 5C8LA 3X0KA 3I7VA 5BS6A 1F3YA 1NFZA 3Q2SA 1V8WA 2B06A 2GB5A 3X0IA 4S2XA 1HX3A 2KDVA 4KTBA 5GHPA 1RYAA 2FVVA 3OGAA 1I9AA 3Q1PA 1GA7A 5IW4A 1XSBA 5GHIA 1XSCA 2I8UA 5CFIA 1MUTA 2G74A 4NFWA 3X0NA 1MQWA 3BAPA 4DYWA 3A6TA 3A6SA 3A6VA 1V8VA 1PPXA 1X83A 3EXQA 2AZWA 3X0LA 3GWYA 5FSOA 3F6AA 5BONA 2YVPA 3O69A 3F13A 1JRKA 3U53A 3G0QA 1KT9A 5FSLA 2KDWA 1SJYA 4KG4A 4JZTA 1OW2A 2I6KA 5LPGA 4YPRA 1X51A 4JZVA 1NQZA 2G73A 1V8RA 5DD4A 3HYQA 3Q93A 3SHDA 5DEQA 3X0MA 3N9UA 1TUMA 1PPVA 3O61A 1JKNA 1XSAA 2R5WA 1PUQA 1V8MA 1PPWA 1V8SA 2J8QA 3RH7A 2GT4A 4HFQA 3X0OA 2A6TA 3FFUA 1VRLA 4N1TA 2ICJA 5HZXA 1QVJA 5FSNA 4MPOA
chains in the Genus database with same CATH superfamily
3MDIA 1G9QA 2VNPA 4S2VA 5ANUA 1NQYA 2CZRA 1VK6A 2YVNA 4K6EA 2DSDA 3FK9A 4S2YA 2DHOA 4NFXA 1Q54A 3O6ZA 2I8TA 3P5TA 3J7Ye 1IRYA 5DPKA 2Q9PA 2YVMA 2QKMB 3GG6A 1SZ3A 5ANVA 2DSCA 3X0PA 5FSIA 3DUPA 3A6UA 3FJYA 3I7UA 1SOIA 3X0JA 1K2EA 3QSJA 2ICKA 1VHZA 1VC9A 3Q91A 4JZUA 3FCMA 2JVBA 4V14A 1X84A 3GZ6A 3MDGA 2YVOA 4N1UA 1R67A 4YOQA 3H95A 2B2KA 3GZ5A 1V8LA 3Q4IA 3HHJA 3P6YA 2A8RA 3WHWA 4C9XA 3DKUA 2XSQA 4ILQA 5C7QA 5IW5A 5GHOA 1VHGA 2FKBA 1KHZA 1KTGA 2QJTA 3X0RA 4YPHA 3ACAA 3EF5A 2DSBA 1V8TA 4KG3A 1VC8A 2A8TA 5GHQA 2A8SA 2VNQA 4S2WA 3FSPA 1MQEA 5C7TA 5CFJA 2B0VA 1U20A 1Q27A 2O1CA 3SMDA 4ZG0A 1MK1A 3ZR0A 1PUSA 1NFSA 1PVFA 2A8PA 2CL3A 3BHOA 3X0QA 3X0SA 2W4EA 4ICKA 2QJOA 3O52A 3GZ8A 1RRQA 3AC9A 2DUKA 3KVHA 5FSMA 4HVYA 4IJXA 3L85A 1G0SA 1SU2A 5I8UA 3MGMA 5FSKA 1MP2A 2PQVA 4J7GA 1V8UA 4JZSA 2O5WA 1HZTA 3BM4A 2FMLA 2A8QA 1MR2A 4C9WA 5ISYA 3Q2TA 5DDGA 3ZR1A 2O5FA 1VIQA 3E57A 2GT2A 1VIUA 3EEUA 4KYXA 1PUNA 1VCDA 3COUA 1K26A 2YYHA 3EESA 5GHJA 5GHMA 1RRSA 2RRKA 3GRNA 1V8YA 5GHNA 5ANSA 3SONA 1V8IA 3CNGA 5ANWA 3I9XA 5ANTA 3ID9A 3R03A 1V8NA 1Q33A 3N77A 3O8SA 3MCFA 2PNYA 5C8LA 3X0KA 3I7VA 5BS6A 1F3YA 1NFZA 3Q2SA 1V8WA 2B06A 2GB5A 3X0IA 4S2XA 1HX3A 2KDVA 4KTBA 5GHPA 1RYAA 2FVVA 3OGAA 1I9AA 3Q1PA 1GA7A 5IW4A 1XSBA 5GHIA 1XSCA 2I8UA 5CFIA 1MUTA 2G74A 4NFWA 3X0NA 1MQWA 3BAPA 4DYWA 3A6TA 3A6SA 3A6VA 1V8VA 1PPXA 1X83A 3EXQA 2AZWA 3X0LA 3GWYA 5FSOA 3F6AA 5BONA 2YVPA 3O69A 3F13A 1JRKA 3U53A 3G0QA 1KT9A 5FSLA 2KDWA 1SJYA 4J7HA 4KG4A 4JZTA 1OW2A 2I6KA 5LPGA 4YPRA 1X51A 4JZVA 1NQZA 2G73A 1V8RA 5DD4A 3HYQA 3Q93A 3SHDA 5DEQA 3X0MA 3N9UA 1TUMA 1PPVA 3O61A 1JKNA 1XSAA 2R5WA 1PUQA 1V8MA 1PPWA 1V8SA 2J8QA 3RH7A 2GT4A 4HFQA 3X0OA 2A6TA 3FFUA 1VRLA 4N1TA 2ICJA 5HZXA 1QVJA 5FSNA 4MPOA
chains in the Genus database with same CATH topology
3MDIA 1G9QA 2VNPA 4S2VA 5ANUA 1NQYA 2CZRA 1VK6A 2YVNA 4K6EA 2DSDA 3FK9A 4S2YA 2DHOA 4NFXA 1Q54A 3O6ZA 2I8TA 3P5TA 3J7Ye 1IRYA 5DPKA 2Q9PA 2YVMA 2QKMB 3GG6A 1SZ3A 5ANVA 2DSCA 3X0PA 5FSIA 3DUPA 3A6UA 3FJYA 3I7UA 1SOIA 3X0JA 1K2EA 3QSJA 2ICKA 1VHZA 1VC9A 3Q91A 4JZUA 3FCMA 2JVBA 4V14A 1X84A 3GZ6A 3MDGA 2YVOA 4N1UA 1R67A 4YOQA 3H95A 2B2KA 3GZ5A 1V8LA 3Q4IA 3HHJA 3P6YA 2A8RA 3WHWA 4C9XA 3DKUA 2XSQA 4ILQA 5C7QA 5IW5A 5GHOA 1VHGA 2FKBA 1KHZA 1KTGA 2QJTA 3X0RA 4YPHA 3ACAA 3EF5A 2DSBA 1V8TA 4KG3A 1VC8A 2A8TA 5GHQA 2A8SA 2VNQA 4S2WA 3FSPA 1MQEA 5C7TA 5CFJA 2B0VA 1U20A 1Q27A 2O1CA 3SMDA 4ZG0A 1MK1A 3ZR0A 1PUSA 1NFSA 1PVFA 2A8PA 2CL3A 3BHOA 3X0QA 3X0SA 2W4EA 4ICKA 2QJOA 3O52A 3GZ8A 1RRQA 3AC9A 2DUKA 3KVHA 5FSMA 4HVYA 4IJXA 3L85A 1G0SA 1SU2A 5I8UA 3MGMA 5FSKA 1MP2A 2PQVA 4J7GA 1V8UA 4JZSA 2O5WA 1HZTA 3BM4A 2FMLA 2A8QA 1MR2A 4C9WA 5ISYA 3Q2TA 5DDGA 3ZR1A 2O5FA 1VIQA 3E57A 2GT2A 1VIUA 3EEUA 4KYXA 1PUNA 1VCDA 3COUA 1K26A 2YYHA 3EESA 5GHJA 5GHMA 1RRSA 2RRKA 3GRNA 1V8YA 5GHNA 5ANSA 3SONA 1V8IA 3CNGA 5ANWA 3I9XA 5ANTA 3ID9A 3R03A 1V8NA 1Q33A 3N77A 3O8SA 3MCFA 2PNYA 5C8LA 3X0KA 3I7VA 5BS6A 1F3YA 1NFZA 3Q2SA 1V8WA 2B06A 2GB5A 3X0IA 4S2XA 1HX3A 2KDVA 4KTBA 5GHPA 1RYAA 2FVVA 3OGAA 1I9AA 3Q1PA 1GA7A 5IW4A 1XSBA 5GHIA 1XSCA 2I8UA 5CFIA 1MUTA 2G74A 4NFWA 3X0NA 1MQWA 3BAPA 4DYWA 3A6TA 3A6SA 3A6VA 1V8VA 1PPXA 1X83A 3EXQA 2AZWA 3X0LA 3GWYA 5FSOA 3F6AA 5BONA 2YVPA 3O69A 3F13A 1JRKA 3U53A 3G0QA 1KT9A 5FSLA 2KDWA 1SJYA 4J7HA 4KG4A 4JZTA 1OW2A 2I6KA 5LPGA 4YPRA 1X51A 4JZVA 1NQZA 2G73A 1V8RA 5DD4A 3HYQA 3Q93A 3SHDA 5DEQA 3X0MA 3N9UA 1TUMA 1PPVA 3O61A 1JKNA 1XSAA 2R5WA 1PUQA 1V8MA 1PPWA 1V8SA 2J8QA 3RH7A 2GT4A 4HFQA 3X0OA 2A6TA 3FFUA 1VRLA 4N1TA 2ICJA 5HZXA 1QVJA 5FSNA 4MPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDI A;  1G9Q A;  2VNP A;  4S2V A;  5ANU A;  1NQY A;  1VK6 A;  2YVN A;  4K6E A;  2DSD A;  3FK9 A;  4S2Y A;  2DHO A;  4NFX A;  1Q54 A;  3O6Z A;  2I8T A;  3P5T A;  3J7Y e;  1IRY A;  5DPK A;  2Q9P A;  2YVM A;  2QKM B;  3GG6 A;  1SZ3 A;  5ANV A;  2DSC A;  3X0P A;  5FSI A;  3DUP A;  3A6U A;  3FJY A;  3I7U A;  1SOI A;  3X0J A;  1K2E A;  3QSJ A;  2ICK A;  1VHZ A;  1VC9 A;  3Q91 A;  4JZU A;  3FCM A;  2JVB A;  4V14 A;  1X84 A;  3GZ6 A;  3MDG A;  2YVO A;  4N1U A;  1R67 A;  4YOQ A;  3H95 A;  2B2K A;  3GZ5 A;  1V8L A;  3Q4I A;  3HHJ A;  3P6Y A;  2A8R A;  3WHW A;  4C9X A;  3DKU A;  2XSQ A;  4ILQ A;  5C7Q A;  5IW5 A;  5GHO A;  1VHG A;  2FKB A;  1KHZ A;  1KTG A;  2QJT A;  3X0R A;  4YPH A;  3ACA A;  3EF5 A;  2DSB A;  1V8T A;  4KG3 A;  1VC8 A;  2A8T A;  5GHQ A;  2A8S A;  2VNQ A;  4S2W A;  3FSP A;  1MQE A;  5C7T A;  5CFJ A;  2B0V A;  1U20 A;  1Q27 A;  2O1C A;  3SMD A;  4ZG0 A;  1MK1 A;  3ZR0 A;  1PUS A;  1NFS A;  1PVF A;  2A8P A;  2CL3 A;  3BHO A;  3X0Q A;  3X0S A;  2W4E A;  4ICK A;  2QJO A;  3O52 A;  3GZ8 A;  1RRQ A;  3AC9 A;  2DUK A;  3KVH A;  5FSM A;  4HVY A;  4IJX A;  3L85 A;  1G0S A;  1SU2 A;  5I8U A;  3MGM A;  5FSK A;  1MP2 A;  2PQV A;  4JZS A;  1V8U A;  2O5W A;  1HZT A;  3BM4 A;  2FML A;  2A8Q A;  1MR2 A;  4C9W A;  5ISY A;  3Q2T A;  5DDG A;  3ZR1 A;  2O5F A;  1VIQ A;  3E57 A;  2GT2 A;  1VIU A;  3EEU A;  4KYX A;  1PUN A;  1VCD A;  3COU A;  1K26 A;  2YYH A;  3EES A;  5GHJ A;  5GHM A;  1RRS A;  2RRK A;  3GRN A;  1V8Y A;  5GHN A;  5ANS A;  3SON A;  1V8I A;  3CNG A;  5ANW A;  3I9X A;  5ANT A;  3ID9 A;  3R03 A;  1V8N A;  1Q33 A;  3N77 A;  3O8S A;  3MCF A;  2PNY A;  5C8L A;  3X0K A;  3I7V A;  5BS6 A;  1F3Y A;  1NFZ A;  3Q2S A;  1V8W A;  2B06 A;  2GB5 A;  3X0I A;  4S2X A;  1HX3 A;  2KDV A;  4KTB A;  5GHP A;  1RYA A;  2FVV A;  3OGA A;  1I9A A;  3Q1P A;  1GA7 A;  5IW4 A;  1XSB A;  5GHI A;  1XSC A;  2I8U A;  5CFI A;  1MUT A;  2G74 A;  4NFW A;  3X0N A;  1MQW A;  3BAP A;  4DYW A;  3A6T A;  3A6S A;  3A6V A;  1V8V A;  1PPX A;  1X83 A;  3EXQ A;  2AZW A;  3X0L A;  3GWY A;  5FSO A;  3F6A A;  5BON A;  2YVP A;  3O69 A;  3F13 A;  1JRK A;  3U53 A;  3G0Q A;  1KT9 A;  5FSL A;  2KDW A;  1SJY A;  4KG4 A;  4JZT A;  1OW2 A;  2I6K A;  5LPG A;  4YPR A;  1X51 A;  4JZV A;  1NQZ A;  2G73 A;  1V8R A;  5DD4 A;  3HYQ A;  3Q93 A;  3SHD A;  5DEQ A;  3X0M A;  3N9U A;  1TUM A;  1PPV A;  3O61 A;  1JKN A;  1XSA A;  2R5W A;  1PUQ A;  1V8M A;  1PPW A;  1V8S A;  2J8Q A;  3RH7 A;  2GT4 A;  4HFQ A;  3X0O A;  2A6T A;  3FFU A;  1VRL A;  4N1T A;  2ICJ A;  5HZX A;  1QVJ A;  5FSN A;  4MPO A; 
#chains in the Genus database with same CATH topology
 3MDI A;  1G9Q A;  2VNP A;  4S2V A;  5ANU A;  1NQY A;  2CZR A;  1VK6 A;  2YVN A;  4K6E A;  2DSD A;  3FK9 A;  4S2Y A;  2DHO A;  4NFX A;  1Q54 A;  3O6Z A;  2I8T A;  3P5T A;  3J7Y e;  1IRY A;  5DPK A;  2Q9P A;  2YVM A;  2QKM B;  3GG6 A;  1SZ3 A;  5ANV A;  2DSC A;  3X0P A;  5FSI A;  3DUP A;  3A6U A;  3FJY A;  3I7U A;  1SOI A;  3X0J A;  1K2E A;  3QSJ A;  2ICK A;  1VHZ A;  1VC9 A;  3Q91 A;  4JZU A;  3FCM A;  2JVB A;  4V14 A;  1X84 A;  3GZ6 A;  3MDG A;  2YVO A;  4N1U A;  1R67 A;  4YOQ A;  3H95 A;  2B2K A;  3GZ5 A;  1V8L A;  3Q4I A;  3HHJ A;  3P6Y A;  2A8R A;  3WHW A;  4C9X A;  3DKU A;  2XSQ A;  4ILQ A;  5C7Q A;  5IW5 A;  5GHO A;  1VHG A;  2FKB A;  1KHZ A;  1KTG A;  2QJT A;  3X0R A;  4YPH A;  3ACA A;  3EF5 A;  2DSB A;  1V8T A;  4KG3 A;  1VC8 A;  2A8T A;  5GHQ A;  2A8S A;  2VNQ A;  4S2W A;  3FSP A;  1MQE A;  5C7T A;  5CFJ A;  2B0V A;  1U20 A;  1Q27 A;  2O1C A;  3SMD A;  4ZG0 A;  1MK1 A;  3ZR0 A;  1PUS A;  1NFS A;  1PVF A;  2A8P A;  2CL3 A;  3BHO A;  3X0Q A;  3X0S A;  2W4E A;  4ICK A;  2QJO A;  3O52 A;  3GZ8 A;  1RRQ A;  3AC9 A;  2DUK A;  3KVH A;  5FSM A;  4HVY A;  4IJX A;  3L85 A;  1G0S A;  1SU2 A;  5I8U A;  3MGM A;  5FSK A;  1MP2 A;  2PQV A;  4J7G A;  1V8U A;  4JZS A;  2O5W A;  1HZT A;  3BM4 A;  2FML A;  2A8Q A;  1MR2 A;  4C9W A;  5ISY A;  3Q2T A;  5DDG A;  3ZR1 A;  2O5F A;  1VIQ A;  3E57 A;  2GT2 A;  1VIU A;  3EEU A;  4KYX A;  1PUN A;  1VCD A;  3COU A;  1K26 A;  2YYH A;  3EES A;  5GHJ A;  5GHM A;  1RRS A;  2RRK A;  3GRN A;  1V8Y A;  5GHN A;  5ANS A;  3SON A;  1V8I A;  3CNG A;  5ANW A;  3I9X A;  5ANT A;  3ID9 A;  3R03 A;  1V8N A;  1Q33 A;  3N77 A;  3O8S A;  3MCF A;  2PNY A;  5C8L A;  3X0K A;  3I7V A;  5BS6 A;  1F3Y A;  1NFZ A;  3Q2S A;  1V8W A;  2B06 A;  2GB5 A;  3X0I A;  4S2X A;  1HX3 A;  2KDV A;  4KTB A;  5GHP A;  1RYA A;  2FVV A;  3OGA A;  1I9A A;  3Q1P A;  1GA7 A;  5IW4 A;  1XSB A;  5GHI A;  1XSC A;  2I8U A;  5CFI A;  1MUT A;  2G74 A;  4NFW A;  3X0N A;  1MQW A;  3BAP A;  4DYW A;  3A6T A;  3A6S A;  3A6V A;  1V8V A;  1PPX A;  1X83 A;  3EXQ A;  2AZW A;  3X0L A;  3GWY A;  5FSO A;  3F6A A;  5BON A;  2YVP A;  3O69 A;  3F13 A;  1JRK A;  3U53 A;  3G0Q A;  1KT9 A;  5FSL A;  2KDW A;  1SJY A;  4J7H A;  4KG4 A;  4JZT A;  1OW2 A;  2I6K A;  5LPG A;  4YPR A;  1X51 A;  4JZV A;  1NQZ A;  2G73 A;  1V8R A;  5DD4 A;  3HYQ A;  3Q93 A;  3SHD A;  5DEQ A;  3X0M A;  3N9U A;  1TUM A;  1PPV A;  3O61 A;  1JKN A;  1XSA A;  2R5W A;  1PUQ A;  1V8M A;  1PPW A;  1V8S A;  2J8Q A;  3RH7 A;  2GT4 A;  4HFQ A;  3X0O A;  2A6T A;  3FFU A;  1VRL A;  4N1T A;  2ICJ A;  5HZX A;  1QVJ A;  5FSN A;  4MPO A; 
#chains in the Genus database with same CATH homology
 3MDI A;  1G9Q A;  2VNP A;  4S2V A;  5ANU A;  1NQY A;  2CZR A;  1VK6 A;  2YVN A;  4K6E A;  2DSD A;  3FK9 A;  4S2Y A;  2DHO A;  4NFX A;  1Q54 A;  3O6Z A;  2I8T A;  3P5T A;  3J7Y e;  1IRY A;  5DPK A;  2Q9P A;  2YVM A;  2QKM B;  3GG6 A;  1SZ3 A;  5ANV A;  2DSC A;  3X0P A;  5FSI A;  3DUP A;  3A6U A;  3FJY A;  3I7U A;  1SOI A;  3X0J A;  1K2E A;  3QSJ A;  2ICK A;  1VHZ A;  1VC9 A;  3Q91 A;  4JZU A;  3FCM A;  2JVB A;  4V14 A;  1X84 A;  3GZ6 A;  3MDG A;  2YVO A;  4N1U A;  1R67 A;  4YOQ A;  3H95 A;  2B2K A;  3GZ5 A;  1V8L A;  3Q4I A;  3HHJ A;  3P6Y A;  2A8R A;  3WHW A;  4C9X A;  3DKU A;  2XSQ A;  4ILQ A;  5C7Q A;  5IW5 A;  5GHO A;  1VHG A;  2FKB A;  1KHZ A;  1KTG A;  2QJT A;  3X0R A;  4YPH A;  3ACA A;  3EF5 A;  2DSB A;  1V8T A;  4KG3 A;  1VC8 A;  2A8T A;  5GHQ A;  2A8S A;  2VNQ A;  4S2W A;  3FSP A;  1MQE A;  5C7T A;  5CFJ A;  2B0V A;  1U20 A;  1Q27 A;  2O1C A;  3SMD A;  4ZG0 A;  1MK1 A;  3ZR0 A;  1PUS A;  1NFS A;  1PVF A;  2A8P A;  2CL3 A;  3BHO A;  3X0Q A;  3X0S A;  2W4E A;  4ICK A;  2QJO A;  3O52 A;  3GZ8 A;  1RRQ A;  3AC9 A;  2DUK A;  3KVH A;  5FSM A;  4HVY A;  4IJX A;  3L85 A;  1G0S A;  1SU2 A;  5I8U A;  3MGM A;  5FSK A;  1MP2 A;  2PQV A;  4J7G A;  1V8U A;  4JZS A;  2O5W A;  1HZT A;  3BM4 A;  2FML A;  2A8Q A;  1MR2 A;  4C9W A;  5ISY A;  3Q2T A;  5DDG A;  3ZR1 A;  2O5F A;  1VIQ A;  3E57 A;  2GT2 A;  1VIU A;  3EEU A;  4KYX A;  1PUN A;  1VCD A;  3COU A;  1K26 A;  2YYH A;  3EES A;  5GHJ A;  5GHM A;  1RRS A;  2RRK A;  3GRN A;  1V8Y A;  5GHN A;  5ANS A;  3SON A;  1V8I A;  3CNG A;  5ANW A;  3I9X A;  5ANT A;  3ID9 A;  3R03 A;  1V8N A;  1Q33 A;  3N77 A;  3O8S A;  3MCF A;  2PNY A;  5C8L A;  3X0K A;  3I7V A;  5BS6 A;  1F3Y A;  1NFZ A;  3Q2S A;  1V8W A;  2B06 A;  2GB5 A;  3X0I A;  4S2X A;  1HX3 A;  2KDV A;  4KTB A;  5GHP A;  1RYA A;  2FVV A;  3OGA A;  1I9A A;  3Q1P A;  1GA7 A;  5IW4 A;  1XSB A;  5GHI A;  1XSC A;  2I8U A;  5CFI A;  1MUT A;  2G74 A;  4NFW A;  3X0N A;  1MQW A;  3BAP A;  4DYW A;  3A6T A;  3A6S A;  3A6V A;  1V8V A;  1PPX A;  1X83 A;  3EXQ A;  2AZW A;  3X0L A;  3GWY A;  5FSO A;  3F6A A;  5BON A;  2YVP A;  3O69 A;  3F13 A;  1JRK A;  3U53 A;  3G0Q A;  1KT9 A;  5FSL A;  2KDW A;  1SJY A;  4J7H A;  4KG4 A;  4JZT A;  1OW2 A;  2I6K A;  5LPG A;  4YPR A;  1X51 A;  4JZV A;  1NQZ A;  2G73 A;  1V8R A;  5DD4 A;  3HYQ A;  3Q93 A;  3SHD A;  5DEQ A;  3X0M A;  3N9U A;  1TUM A;  1PPV A;  3O61 A;  1JKN A;  1XSA A;  2R5W A;  1PUQ A;  1V8M A;  1PPW A;  1V8S A;  2J8Q A;  3RH7 A;  2GT4 A;  4HFQ A;  3X0O A;  2A6T A;  3FFU A;  1VRL A;  4N1T A;  2ICJ A;  5HZX A;  1QVJ A;  5FSN A;  4MPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...