1V8WA

Crystal structure analysis of the adp-ribose pyrophosphatase of e82q mutant, complexed with so4 and zn
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
154
Chain Sequence
b'RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRQLAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAHPAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 35
structure length 154
sequence length 158
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8wA00
2QJTA 3P5TA 2RRKA 1HX3A 1MK1A 3P6YA 2CL3A 3O61A 3O52A 2GT4A 3RH7A 2JVBA 4YOQA 2R5WA 4KYXA 1XSBA 1V8WA 3X0JA 5CFJA 5ANWA 3DUPA 3OGAA 1GA7A 3X0SA 2KDWA 2FMLA 4NFXA 1IRYA 3ID9A 2DHOA 1V8LA 2A8TA 2GB5A 5ANVA 1VHZA 1XSAA 1JRKA 2J8QA 1VRLA 1PPVA 1U20A 1V8UA 5DDGA 4N1TA 5DPKA 1G0SA 3GG6A 1MQWA 1NQZA 3Q91A 3FSPA 3SHDA 1QVJA 2B2KA 1PUQA 1RYAA 1VC9A 5FSOA 1X84A 2B0VA 4KG3A 1V8RA 3I9XA 2VNQA 4IJXA 3FFUA 4MPOA 1VC8A 2AZWA 2FVVA 3U53A 3GWYA 1HZTA 1KTGA 2KDVA 5I8UA 4S2YA 1MP2A 5IW4A 4JZVA 1PUNA 3KVHA 1NQYA 4V14A 1VHGA 3ZR1A 2A8SA 5FSNA 1SOIA 4C9XA 1SZ3A 1G9QA 1TUMA 1VIUA 2I6KA 1NFZA 4JZUA 3H95A 1PPWA 2O5WA 3BHOA 3I7UA 3A6UA 3R03A 2A8PA 3FJYA 4S2WA 5C8LA 2VNPA 4ZG0A 3O69A 1X51A 5ISYA 3GZ6A 5GHIA 1MR2A 1Q27A 2ICJA 3X0NA 3N9UA 2DSDA 1I9AA 3EF5A 1SU2A 2DSCA 2G73A 4NFWA 4N1UA 3FCMA 3X0OA 3I7VA 4S2VA 4YPHA 2PNYA 5DD4A 1MQEA 2DSBA 1V8VA 3BM4A 3X0IA 1K26A 1V8TA 2DUKA 3GRNA 4ILQA 3X0KA 5IW5A 1Q54A 2QJOA 4KTBA 1KHZA 3O6ZA 1V8MA 2GT2A 3BAPA 3MCFA 4KG4A 5ANSA 2XSQA 3X0QA 5C7TA 2YVPA 2YVNA 5C7QA 5DEQA 1VCDA 3ACAA 5GHQA 1PPXA 3AC9A 3SONA 3X0RA 2I8UA 1X83A 2O1CA 2B06A 2G74A 5ANUA 5FSLA 3QSJA 1V8NA 3F13A 4C9WA 5CFIA 2I8TA 2W4EA 3HHJA 3Q2SA 4JZSA 5GHNA 5ANTA 1OW2A 4HFQA 2A6TA 1RRSA 2YVOA 4DYWA 3GZ5A 3EEUA 1KT9A 1SJYA 1V8IA 1R67A 5BS6A 5LPGA 4S2XA 2Q9PA 3O8SA 3FK9A 3WHWA 1VIQA 1PVFA 3HYQA 3N77A 1V8SA 2YVMA 3Q93A 4HVYA 3G0QA 5GHJA 2FKBA 3J7Ye 3L85A 1XSCA 3X0MA 5GHMA 2A8RA 3CNGA 3F6AA 4YPRA 1RRQA 5GHOA 1JKNA 5FSIA 4K6EA 3SMDA 4JZTA 3A6VA 3GZ8A 2YYHA 1Q33A 2O5FA 5HZXA 3MDIA 1VK6A 1V8YA 3MDGA 3DKUA 3A6SA 4ICKA 1F3YA 5FSMA 3MGMA 1MUTA 3EESA 3COUA 3X0LA 3ZR0A 5FSKA 5GHPA 1PUSA 2PQVA 3E57A 3Q4IA 1K2EA 2ICKA 3EXQA 2A8QA 3X0PA 3Q2TA 2QKMB 3Q1PA 3A6TA 5BONA 1NFSA
chains in the Genus database with same CATH superfamily
2QJTA 3P5TA 2RRKA 1HX3A 1MK1A 3P6YA 2CL3A 3O61A 3O52A 2GT4A 3RH7A 2JVBA 4YOQA 2R5WA 4KYXA 1XSBA 1V8WA 3X0JA 5CFJA 5ANWA 3DUPA 3OGAA 1GA7A 3X0SA 2KDWA 2FMLA 4NFXA 1IRYA 3ID9A 2DHOA 1V8LA 2A8TA 2GB5A 5ANVA 1VHZA 1XSAA 1JRKA 2J8QA 1VRLA 1PPVA 1U20A 1V8UA 5DDGA 4N1TA 5DPKA 1G0SA 3GG6A 1MQWA 1NQZA 3Q91A 3FSPA 3SHDA 1QVJA 2B2KA 1PUQA 1RYAA 1VC9A 5FSOA 1X84A 2B0VA 4KG3A 1V8RA 3I9XA 2VNQA 4IJXA 3FFUA 4MPOA 1VC8A 2AZWA 2FVVA 3U53A 3GWYA 1HZTA 1KTGA 2KDVA 5I8UA 4S2YA 1MP2A 5IW4A 4JZVA 1PUNA 3KVHA 1NQYA 4V14A 1VHGA 3ZR1A 2A8SA 5FSNA 1SOIA 4C9XA 1SZ3A 1G9QA 1TUMA 1VIUA 2I6KA 1NFZA 4JZUA 3H95A 1PPWA 2O5WA 3BHOA 3I7UA 3A6UA 3R03A 2A8PA 3FJYA 4S2WA 5C8LA 2VNPA 4ZG0A 3O69A 1X51A 5ISYA 3GZ6A 5GHIA 1MR2A 1Q27A 2ICJA 3X0NA 3N9UA 4J7GA 2DSDA 1I9AA 3EF5A 1SU2A 2DSCA 2G73A 4NFWA 4N1UA 3FCMA 3X0OA 3I7VA 4S2VA 4YPHA 2PNYA 5DD4A 1MQEA 2DSBA 1V8VA 2CZRA 3BM4A 3X0IA 1K26A 1V8TA 2DUKA 3GRNA 4ILQA 3X0KA 5IW5A 1Q54A 2QJOA 4KTBA 1KHZA 3O6ZA 1V8MA 2GT2A 3BAPA 3MCFA 4KG4A 5ANSA 2XSQA 3X0QA 5C7TA 2YVPA 2YVNA 5C7QA 5DEQA 1VCDA 3ACAA 5GHQA 1PPXA 3AC9A 3SONA 3X0RA 2I8UA 1X83A 2O1CA 2B06A 2G74A 5ANUA 5FSLA 3QSJA 1V8NA 3F13A 4C9WA 5CFIA 2I8TA 2W4EA 3HHJA 3Q2SA 4JZSA 5GHNA 5ANTA 1OW2A 4HFQA 2A6TA 1RRSA 2YVOA 4DYWA 3GZ5A 3EEUA 1KT9A 1SJYA 1V8IA 1R67A 5BS6A 5LPGA 4S2XA 2Q9PA 3O8SA 3FK9A 3WHWA 1VIQA 1PVFA 3HYQA 3N77A 1V8SA 2YVMA 3Q93A 4HVYA 3G0QA 5GHJA 2FKBA 3J7Ye 3L85A 1XSCA 3X0MA 5GHMA 2A8RA 3CNGA 3F6AA 4YPRA 1RRQA 5GHOA 1JKNA 5FSIA 4K6EA 3SMDA 4JZTA 3A6VA 3GZ8A 2YYHA 4J7HA 1Q33A 2O5FA 5HZXA 3MDIA 1VK6A 1V8YA 3MDGA 3DKUA 3A6SA 4ICKA 1F3YA 5FSMA 3MGMA 1MUTA 3EESA 3COUA 3X0LA 3ZR0A 5FSKA 5GHPA 1PUSA 2PQVA 3E57A 3Q4IA 1K2EA 2ICKA 3EXQA 2A8QA 3X0PA 3Q2TA 2QKMB 3Q1PA 3A6TA 5BONA 1NFSA
chains in the Genus database with same CATH topology
2QJTA 3P5TA 2RRKA 1HX3A 1MK1A 3P6YA 2CL3A 3O61A 3O52A 2GT4A 3RH7A 2JVBA 4YOQA 2R5WA 4KYXA 1XSBA 1V8WA 3X0JA 5CFJA 5ANWA 3DUPA 3OGAA 1GA7A 3X0SA 2KDWA 2FMLA 4NFXA 1IRYA 3ID9A 2DHOA 1V8LA 2A8TA 2GB5A 5ANVA 1VHZA 1XSAA 1JRKA 2J8QA 1VRLA 1PPVA 1U20A 1V8UA 5DDGA 4N1TA 5DPKA 1G0SA 3GG6A 1MQWA 1NQZA 3Q91A 3FSPA 3SHDA 1QVJA 2B2KA 1PUQA 1RYAA 1VC9A 5FSOA 1X84A 2B0VA 4KG3A 1V8RA 3I9XA 2VNQA 4IJXA 3FFUA 4MPOA 1VC8A 2AZWA 2FVVA 3U53A 3GWYA 1HZTA 1KTGA 2KDVA 5I8UA 4S2YA 1MP2A 5IW4A 4JZVA 1PUNA 3KVHA 1NQYA 4V14A 1VHGA 3ZR1A 2A8SA 5FSNA 1SOIA 4C9XA 1SZ3A 1G9QA 1TUMA 1VIUA 2I6KA 1NFZA 4JZUA 3H95A 1PPWA 2O5WA 3BHOA 3I7UA 3A6UA 3R03A 2A8PA 3FJYA 4S2WA 5C8LA 2VNPA 4ZG0A 3O69A 1X51A 5ISYA 3GZ6A 5GHIA 1MR2A 1Q27A 2ICJA 3X0NA 3N9UA 4J7GA 2DSDA 1I9AA 3EF5A 1SU2A 2DSCA 2G73A 4NFWA 4N1UA 3FCMA 3X0OA 3I7VA 4S2VA 4YPHA 2PNYA 5DD4A 1MQEA 2DSBA 1V8VA 2CZRA 3BM4A 3X0IA 1K26A 1V8TA 2DUKA 3GRNA 4ILQA 3X0KA 5IW5A 1Q54A 2QJOA 4KTBA 1KHZA 3O6ZA 1V8MA 2GT2A 3BAPA 3MCFA 4KG4A 5ANSA 2XSQA 3X0QA 5C7TA 2YVPA 2YVNA 5C7QA 5DEQA 1VCDA 3ACAA 5GHQA 1PPXA 3AC9A 3SONA 3X0RA 2I8UA 1X83A 2O1CA 2B06A 2G74A 5ANUA 5FSLA 3QSJA 1V8NA 3F13A 4C9WA 5CFIA 2I8TA 2W4EA 3HHJA 3Q2SA 4JZSA 5GHNA 5ANTA 1OW2A 4HFQA 2A6TA 1RRSA 2YVOA 4DYWA 3GZ5A 3EEUA 1KT9A 1SJYA 1V8IA 1R67A 5BS6A 5LPGA 4S2XA 2Q9PA 3O8SA 3FK9A 3WHWA 1VIQA 1PVFA 3HYQA 3N77A 1V8SA 2YVMA 3Q93A 4HVYA 3G0QA 5GHJA 2FKBA 3J7Ye 3L85A 1XSCA 3X0MA 5GHMA 2A8RA 3CNGA 3F6AA 4YPRA 1RRQA 5GHOA 1JKNA 5FSIA 4K6EA 3SMDA 4JZTA 3A6VA 3GZ8A 2YYHA 4J7HA 1Q33A 2O5FA 5HZXA 3MDIA 1VK6A 1V8YA 3MDGA 3DKUA 3A6SA 4ICKA 1F3YA 5FSMA 3MGMA 1MUTA 3EESA 3COUA 3X0LA 3ZR0A 5FSKA 5GHPA 1PUSA 2PQVA 3E57A 3Q4IA 1K2EA 2ICKA 3EXQA 2A8QA 3X0PA 3Q2TA 2QKMB 3Q1PA 3A6TA 5BONA 1NFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJT A;  3P5T A;  2RRK A;  1HX3 A;  1MK1 A;  3P6Y A;  2CL3 A;  3O61 A;  3O52 A;  2GT4 A;  3RH7 A;  2JVB A;  4YOQ A;  2R5W A;  4KYX A;  1XSB A;  1V8W A;  3X0J A;  5CFJ A;  5ANW A;  3DUP A;  3OGA A;  1GA7 A;  3X0S A;  2KDW A;  2FML A;  4NFX A;  1IRY A;  3ID9 A;  2DHO A;  1V8L A;  2A8T A;  2GB5 A;  5ANV A;  1VHZ A;  1XSA A;  1JRK A;  2J8Q A;  1VRL A;  1PPV A;  1U20 A;  1V8U A;  5DDG A;  4N1T A;  5DPK A;  1G0S A;  3GG6 A;  1MQW A;  1NQZ A;  3Q91 A;  3FSP A;  3SHD A;  1QVJ A;  2B2K A;  1PUQ A;  1RYA A;  1VC9 A;  5FSO A;  1X84 A;  2B0V A;  4KG3 A;  1V8R A;  3I9X A;  2VNQ A;  4IJX A;  3FFU A;  4MPO A;  1VC8 A;  2AZW A;  2FVV A;  3U53 A;  3GWY A;  1HZT A;  1KTG A;  2KDV A;  5I8U A;  4S2Y A;  1MP2 A;  5IW4 A;  4JZV A;  1PUN A;  3KVH A;  1NQY A;  4V14 A;  1VHG A;  3ZR1 A;  2A8S A;  5FSN A;  1SOI A;  4C9X A;  1SZ3 A;  1G9Q A;  1TUM A;  1VIU A;  2I6K A;  1NFZ A;  4JZU A;  3H95 A;  1PPW A;  2O5W A;  3BHO A;  3I7U A;  3A6U A;  3R03 A;  2A8P A;  3FJY A;  4S2W A;  5C8L A;  2VNP A;  4ZG0 A;  3O69 A;  1X51 A;  5ISY A;  3GZ6 A;  5GHI A;  1MR2 A;  1Q27 A;  2ICJ A;  3X0N A;  3N9U A;  2DSD A;  1I9A A;  3EF5 A;  1SU2 A;  2DSC A;  2G73 A;  4NFW A;  4N1U A;  3FCM A;  3X0O A;  3I7V A;  4S2V A;  4YPH A;  2PNY A;  5DD4 A;  1MQE A;  2DSB A;  1V8V A;  3BM4 A;  3X0I A;  1K26 A;  1V8T A;  2DUK A;  3GRN A;  4ILQ A;  3X0K A;  5IW5 A;  1Q54 A;  2QJO A;  4KTB A;  1KHZ A;  3O6Z A;  1V8M A;  2GT2 A;  3BAP A;  3MCF A;  4KG4 A;  5ANS A;  2XSQ A;  3X0Q A;  5C7T A;  2YVP A;  2YVN A;  5C7Q A;  5DEQ A;  1VCD A;  3ACA A;  5GHQ A;  1PPX A;  3AC9 A;  3SON A;  3X0R A;  2I8U A;  1X83 A;  2O1C A;  2B06 A;  2G74 A;  5ANU A;  5FSL A;  3QSJ A;  1V8N A;  3F13 A;  4C9W A;  5CFI A;  2I8T A;  2W4E A;  3HHJ A;  3Q2S A;  4JZS A;  5GHN A;  5ANT A;  1OW2 A;  4HFQ A;  2A6T A;  1RRS A;  2YVO A;  4DYW A;  3GZ5 A;  3EEU A;  1KT9 A;  1SJY A;  1V8I A;  1R67 A;  5BS6 A;  5LPG A;  4S2X A;  2Q9P A;  3O8S A;  3FK9 A;  3WHW A;  1VIQ A;  1PVF A;  3HYQ A;  3N77 A;  1V8S A;  2YVM A;  3Q93 A;  4HVY A;  3G0Q A;  5GHJ A;  2FKB A;  3J7Y e;  3L85 A;  1XSC A;  3X0M A;  5GHM A;  2A8R A;  3CNG A;  3F6A A;  4YPR A;  1RRQ A;  5GHO A;  1JKN A;  5FSI A;  4K6E A;  3SMD A;  4JZT A;  3A6V A;  3GZ8 A;  2YYH A;  1Q33 A;  2O5F A;  5HZX A;  3MDI A;  1VK6 A;  1V8Y A;  3MDG A;  3DKU A;  3A6S A;  4ICK A;  1F3Y A;  5FSM A;  3MGM A;  1MUT A;  3EES A;  3COU A;  3X0L A;  3ZR0 A;  5FSK A;  5GHP A;  1PUS A;  2PQV A;  3E57 A;  3Q4I A;  1K2E A;  2ICK A;  3EXQ A;  2A8Q A;  3X0P A;  3Q2T A;  2QKM B;  3Q1P A;  3A6T A;  5BON A;  1NFS A; 
#chains in the Genus database with same CATH topology
 2QJT A;  3P5T A;  2RRK A;  1HX3 A;  1MK1 A;  3P6Y A;  2CL3 A;  3O61 A;  3O52 A;  2GT4 A;  3RH7 A;  2JVB A;  4YOQ A;  2R5W A;  4KYX A;  1XSB A;  1V8W A;  3X0J A;  5CFJ A;  5ANW A;  3DUP A;  3OGA A;  1GA7 A;  3X0S A;  2KDW A;  2FML A;  4NFX A;  1IRY A;  3ID9 A;  2DHO A;  1V8L A;  2A8T A;  2GB5 A;  5ANV A;  1VHZ A;  1XSA A;  1JRK A;  2J8Q A;  1VRL A;  1PPV A;  1U20 A;  1V8U A;  5DDG A;  4N1T A;  5DPK A;  1G0S A;  3GG6 A;  1MQW A;  1NQZ A;  3Q91 A;  3FSP A;  3SHD A;  1QVJ A;  2B2K A;  1PUQ A;  1RYA A;  1VC9 A;  5FSO A;  1X84 A;  2B0V A;  4KG3 A;  1V8R A;  3I9X A;  2VNQ A;  4IJX A;  3FFU A;  4MPO A;  1VC8 A;  2AZW A;  2FVV A;  3U53 A;  3GWY A;  1HZT A;  1KTG A;  2KDV A;  5I8U A;  4S2Y A;  1MP2 A;  5IW4 A;  4JZV A;  1PUN A;  3KVH A;  1NQY A;  4V14 A;  1VHG A;  3ZR1 A;  2A8S A;  5FSN A;  1SOI A;  4C9X A;  1SZ3 A;  1G9Q A;  1TUM A;  1VIU A;  2I6K A;  1NFZ A;  4JZU A;  3H95 A;  1PPW A;  2O5W A;  3BHO A;  3I7U A;  3A6U A;  3R03 A;  2A8P A;  3FJY A;  4S2W A;  5C8L A;  2VNP A;  4ZG0 A;  3O69 A;  1X51 A;  5ISY A;  3GZ6 A;  5GHI A;  1MR2 A;  1Q27 A;  2ICJ A;  3X0N A;  3N9U A;  4J7G A;  2DSD A;  1I9A A;  3EF5 A;  1SU2 A;  2DSC A;  2G73 A;  4NFW A;  4N1U A;  3FCM A;  3X0O A;  3I7V A;  4S2V A;  4YPH A;  2PNY A;  5DD4 A;  1MQE A;  2DSB A;  1V8V A;  2CZR A;  3BM4 A;  3X0I A;  1K26 A;  1V8T A;  2DUK A;  3GRN A;  4ILQ A;  3X0K A;  5IW5 A;  1Q54 A;  2QJO A;  4KTB A;  1KHZ A;  3O6Z A;  1V8M A;  2GT2 A;  3BAP A;  3MCF A;  4KG4 A;  5ANS A;  2XSQ A;  3X0Q A;  5C7T A;  2YVP A;  2YVN A;  5C7Q A;  5DEQ A;  1VCD A;  3ACA A;  5GHQ A;  1PPX A;  3AC9 A;  3SON A;  3X0R A;  2I8U A;  1X83 A;  2O1C A;  2B06 A;  2G74 A;  5ANU A;  5FSL A;  3QSJ A;  1V8N A;  3F13 A;  4C9W A;  5CFI A;  2I8T A;  2W4E A;  3HHJ A;  3Q2S A;  4JZS A;  5GHN A;  5ANT A;  1OW2 A;  4HFQ A;  2A6T A;  1RRS A;  2YVO A;  4DYW A;  3GZ5 A;  3EEU A;  1KT9 A;  1SJY A;  1V8I A;  1R67 A;  5BS6 A;  5LPG A;  4S2X A;  2Q9P A;  3O8S A;  3FK9 A;  3WHW A;  1VIQ A;  1PVF A;  3HYQ A;  3N77 A;  1V8S A;  2YVM A;  3Q93 A;  4HVY A;  3G0Q A;  5GHJ A;  2FKB A;  3J7Y e;  3L85 A;  1XSC A;  3X0M A;  5GHM A;  2A8R A;  3CNG A;  3F6A A;  4YPR A;  1RRQ A;  5GHO A;  1JKN A;  5FSI A;  4K6E A;  3SMD A;  4JZT A;  3A6V A;  3GZ8 A;  2YYH A;  4J7H A;  1Q33 A;  2O5F A;  5HZX A;  3MDI A;  1VK6 A;  1V8Y A;  3MDG A;  3DKU A;  3A6S A;  4ICK A;  1F3Y A;  5FSM A;  3MGM A;  1MUT A;  3EES A;  3COU A;  3X0L A;  3ZR0 A;  5FSK A;  5GHP A;  1PUS A;  2PQV A;  3E57 A;  3Q4I A;  1K2E A;  2ICK A;  3EXQ A;  2A8Q A;  3X0P A;  3Q2T A;  2QKM B;  3Q1P A;  3A6T A;  5BON A;  1NFS A; 
#chains in the Genus database with same CATH homology
 2QJT A;  3P5T A;  2RRK A;  1HX3 A;  1MK1 A;  3P6Y A;  2CL3 A;  3O61 A;  3O52 A;  2GT4 A;  3RH7 A;  2JVB A;  4YOQ A;  2R5W A;  4KYX A;  1XSB A;  1V8W A;  3X0J A;  5CFJ A;  5ANW A;  3DUP A;  3OGA A;  1GA7 A;  3X0S A;  2KDW A;  2FML A;  4NFX A;  1IRY A;  3ID9 A;  2DHO A;  1V8L A;  2A8T A;  2GB5 A;  5ANV A;  1VHZ A;  1XSA A;  1JRK A;  2J8Q A;  1VRL A;  1PPV A;  1U20 A;  1V8U A;  5DDG A;  4N1T A;  5DPK A;  1G0S A;  3GG6 A;  1MQW A;  1NQZ A;  3Q91 A;  3FSP A;  3SHD A;  1QVJ A;  2B2K A;  1PUQ A;  1RYA A;  1VC9 A;  5FSO A;  1X84 A;  2B0V A;  4KG3 A;  1V8R A;  3I9X A;  2VNQ A;  4IJX A;  3FFU A;  4MPO A;  1VC8 A;  2AZW A;  2FVV A;  3U53 A;  3GWY A;  1HZT A;  1KTG A;  2KDV A;  5I8U A;  4S2Y A;  1MP2 A;  5IW4 A;  4JZV A;  1PUN A;  3KVH A;  1NQY A;  4V14 A;  1VHG A;  3ZR1 A;  2A8S A;  5FSN A;  1SOI A;  4C9X A;  1SZ3 A;  1G9Q A;  1TUM A;  1VIU A;  2I6K A;  1NFZ A;  4JZU A;  3H95 A;  1PPW A;  2O5W A;  3BHO A;  3I7U A;  3A6U A;  3R03 A;  2A8P A;  3FJY A;  4S2W A;  5C8L A;  2VNP A;  4ZG0 A;  3O69 A;  1X51 A;  5ISY A;  3GZ6 A;  5GHI A;  1MR2 A;  1Q27 A;  2ICJ A;  3X0N A;  3N9U A;  4J7G A;  2DSD A;  1I9A A;  3EF5 A;  1SU2 A;  2DSC A;  2G73 A;  4NFW A;  4N1U A;  3FCM A;  3X0O A;  3I7V A;  4S2V A;  4YPH A;  2PNY A;  5DD4 A;  1MQE A;  2DSB A;  1V8V A;  2CZR A;  3BM4 A;  3X0I A;  1K26 A;  1V8T A;  2DUK A;  3GRN A;  4ILQ A;  3X0K A;  5IW5 A;  1Q54 A;  2QJO A;  4KTB A;  1KHZ A;  3O6Z A;  1V8M A;  2GT2 A;  3BAP A;  3MCF A;  4KG4 A;  5ANS A;  2XSQ A;  3X0Q A;  5C7T A;  2YVP A;  2YVN A;  5C7Q A;  5DEQ A;  1VCD A;  3ACA A;  5GHQ A;  1PPX A;  3AC9 A;  3SON A;  3X0R A;  2I8U A;  1X83 A;  2O1C A;  2B06 A;  2G74 A;  5ANU A;  5FSL A;  3QSJ A;  1V8N A;  3F13 A;  4C9W A;  5CFI A;  2I8T A;  2W4E A;  3HHJ A;  3Q2S A;  4JZS A;  5GHN A;  5ANT A;  1OW2 A;  4HFQ A;  2A6T A;  1RRS A;  2YVO A;  4DYW A;  3GZ5 A;  3EEU A;  1KT9 A;  1SJY A;  1V8I A;  1R67 A;  5BS6 A;  5LPG A;  4S2X A;  2Q9P A;  3O8S A;  3FK9 A;  3WHW A;  1VIQ A;  1PVF A;  3HYQ A;  3N77 A;  1V8S A;  2YVM A;  3Q93 A;  4HVY A;  3G0Q A;  5GHJ A;  2FKB A;  3J7Y e;  3L85 A;  1XSC A;  3X0M A;  5GHM A;  2A8R A;  3CNG A;  3F6A A;  4YPR A;  1RRQ A;  5GHO A;  1JKN A;  5FSI A;  4K6E A;  3SMD A;  4JZT A;  3A6V A;  3GZ8 A;  2YYH A;  4J7H A;  1Q33 A;  2O5F A;  5HZX A;  3MDI A;  1VK6 A;  1V8Y A;  3MDG A;  3DKU A;  3A6S A;  4ICK A;  1F3Y A;  5FSM A;  3MGM A;  1MUT A;  3EES A;  3COU A;  3X0L A;  3ZR0 A;  5FSK A;  5GHP A;  1PUS A;  2PQV A;  3E57 A;  3Q4I A;  1K2E A;  2ICK A;  3EXQ A;  2A8Q A;  3X0P A;  3Q2T A;  2QKM B;  3Q1P A;  3A6T A;  5BON A;  1NFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...