1V93A

5,10-methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
292
structure length
292
Chain Sequence
MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 5,10-Methylenetetrahydrofolate reductase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 5,10-Methylenetetrahydrofolate reductase
total genus 112
structure length 292
sequence length 292
ec nomenclature ec 1.7.99.5: Transferred entry: 1.5.1.20.
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1v93A00
3APYA 3FSUA 1TJ2A 1B5TA 2FZNA 1ZP4A 1ZRQA 2FMOA 3E2RA 4O8AA 1TJ0A 1V93A 1TJ1A 1ZP3A 2FMNA 3FSTA 3IJDA 4JNZA 1ZPTA 3E2SA 1TIWA 3E2QA 4JNYA 3ITGA 2FZMA 3APTA
chains in the Genus database with same CATH superfamily
1FY6A 2PDBA 4MY8A 1B31A 1LDCA 1EIBA 4D6FA 3SO7A 4DJDD 2X2GA 3FYOA 4RX0A 1OIMA 3W73A 4UZSA 1IEIA 3GXFA 1QXLA 3UPWA 1YXYA 3GUWA 2V68A 4JR5A 2FKPA 1KV5A 1TV2A 2DT2A 3ARRA 4PMRA 1FWDC 2VQUA 1EJ7L 3LBOA 3WNMA 1YDYA 5D9PA 2VTFA 4LGXA 1UZDA 1XDJA 3AIVA 1H51A 4M82A 1VLIA 1W17A 4OU1A 2PDIA 3OGRA 5AHIA 2V67A 1HIZA 1IEWA 4LS1A 4UUIA 5DELA 3NPWA 1RZMA 4DWSD 1UBSA 5CSRA 4I3GA 1EPVA 4CNUA 3W70A 1KFKA 2DW6A 3ES8A 4AIEA 4GYJA 3W76A 1EBHA 3PF3A 2CLHA 3VILA 3VKDA 3HZ3A 1F73A 4ACYA 1B1YA 4GYFA 3LD5A 5I5RA 4LF1A 5E5CA 3I6TA 4GWEA 4INFA 2OKTA 4GYPC 5FACA 3CIVA 1LLZA 5AECA 1AH3A 4O1CA 2CC0A 3RXZA 4DWSB 3MSDA 3I6EA 4FOJA 4P7NA 4JOMA 4C6BA 4M5PA 1JPIA 2PDYA 1EDGA 2GWGA 1YNQA 2DGAA 1XGEA 3DHFA 3HPFA 3P8IA 2EG7A 1NY1A 2DVXA 3KP0A 4IPPA 3NSNA 2Q8LA 5U7SA 2GFTA 4Q8PA 4C1NB 3QR3A 4PRTA 2ZX5A 3ZZ1A 4IXXA 3W6MA 3OBAA 4G2DA 4N6FA 4CNNA 1J01A 1W3HA 3KDNA 3QW4B 3N9RA 2NT0A 1H0GA 3EX3A 4GKLA 5A8MA 1GTHA 3A5FA 2E09A 5LNWA 1A5UA 1P0DA 4XVEA 3OO2A 2UY2A 3W2UA 4GH1A 3UG5A 2Q01A 4HJWA 6PTDA 1G9HA 4GK8A 3OYXA 1R2SA 1WAWA 2P5NA 3W7LA 3VD9A 3BLEA 3LPGA 1NF0A 4CNOA 1P1MA 1EC8A 1HZYA 3E5BA 4CCCA 4ML4A 3QBUA 3VCCA 3OLIA 3ABOA 3STFA 2PSNA 1GOMA 4LVFA 1P6CA 1DPMA 2QCEA 3LTPA 2EGZA 1WBHA 4ZQPA 4PB4A 1DE6A 4DWDA 2VDGA 1YKWA 3AZRA 1EXPA 4X60A 5XIAA 2JFEX 4XG1A 4QLKA 4D1IA 3ALFA 1NWUA 2PDFA 1DWFM 3SN0A 4LCSA 4OWGA 1Q6QA 2GGEA 4UZUA 2HTMA 2C6QA 7ENLA 3CEPA 3NZ1A 3QW3A 2Y8VA 4NZ4A 1E0VA 4OIFA 4AY8A 2MUCA 4JBRA 1JRBA 1ISZA 3CZJA 3I6RA 3DBPA 3EPOA 2VFHA 4YL2A 2ZZ3A 1UZHA 3W1MA 1PEZA 3SCSA 3URBA 2YXGA 2OYLA 2DT1A 1ZAIA 2NWSA 2V69A 4LVAA 2J9XA 4PTXA 3NQVA 2P10A 4NF7A 2J24A 2Y7DA 3P84A 4Q8VA 3ENLA 4O14A 2XIQA 3TR2A 1R3VA 3IJQA 3PVFA 4QIUA 4QP0A 4JTRA 1X97A 2QMKA 3T0AA 2NQHA 3FHQA 5D2VA 3R0UA 1H4PA 1ZBKA 1A3HA 3LS9A 1VR6A 4HN8A 4FS9A 2YOCA 2X41A 4AF0A 1TG7A 2ALDA 4JTGA 1I60A 3U57A 2PF0A 1IXPA 3GVVA 1LOLA 1J4EA 4GY1A 1F8IA 4BZYA 5FESA 1C91A 2BY0A 1JD9A 1LROA 5BMXA 1S2AA 1T8QA 3WLKX 5I78A 1GZ1A 5AYYA 1V0MA 5JBEA 2PRHA 4RZ5A 3VX1A 2VM8A 5AN7A 6CGTA 1MMFA 1MQQA 2ESCA 4UTJA 3AXIA 3O9NA 1US3A 3PWGA 1KFWA 2C0AA 1Q2SA 1GYLA 1H11A 3KOYA 4HGXA 4ZZ9A 2P0IA 2VEIA 4A2RA 4TU1A 3POHA 1T5AA 1QK0A 1I0DA 1W5OA 2OMAA 4FX7A 2E8ZA 2P1FA 2TODA 2WHJA 4E5TA 2POTA 1B9BA 4QBXA 4XO6A 4X0NA 4PUDA 3B05A 3UZ5A 4XZWA 1FCVA 4AQLA 1L8PA 3GHSA 3VE9A 3NQDA 2EPOA 4QDMA 1VCVA 3WD2A 3NQEA 3HGRA 4R88A 5CGMA 1XLIA 1R9YA 1PL9A 2CETA 4LEFA 1MQRA 3M43A 2I9EA 3TWAA 3UNTA 5E09A 1ZRQA 2WNNA 4TVUA 3LU2A 4NJHA 3SUWA 1SZFA 2G96A 1XF0A 3DFNA 1H5YA 3GC2A 3NJ3A 3WLOA 1O6IA 4NILA 1ONRA 3TV8A 5HAOA 4C6PA 4D6GA 1V5XA 1CIUA 1WDQA 2EJAA 4UMCA 3P8JA 3LEPA 5EGRA 2Z1BA 3CMJA 1O5XA 1ZENA 1JULA 3UU0A 3RPMA 4DX3A 1GQKA 1NM9A 1BYBA 1NVMA 4P7QA 3CUIA 2O9OA 3R13A 3KVKA 2ACRA 2H8XA 1WDSA 4MJZA 3DFPA 5T9BG 4FR6A 2FMNA 3OZYA 4M81A 1JEZA 4JIQA 4J5NA 4DUVA 1UBPC 1KTCA 3V5CA 5JVLA 2QJIA 1E1EA 1F3TA 1KKRA 3LA4A 4RDZA 2VGFA 2WJDA 1VBRA 2NUYA 3DECA 5D30A 4GQQA 2JKPA 3IUHA 1R3QA 2PZ0A 1Q6LA 3CPUA 3RX3A 5GNYA 1GEHA 4PODA 1UD6A 3PSVA 1EJSC 2WNWA 1GHSA 3B03A 1OCBA 4V2XA 1PHQA 1C9WA 4DF1A 1QCWA 4ONVA 5E0KA 1JVNA 2Z0IA 4M24A 3BQ6A 4YS1A 4CKQA 5A1AA 3OGVA 4MAVA 4DY1A 1ALDA 1UIPA 3PUDA 3TNOA 1JYNA 4H6QA 1W37A 2WAGA 3NL6A 4LVGA 5HULA 1SJCA 3CV2A 1E0WA 1EO5A 1B3VA 4HNOA 1R2RA 3WDRA 2HNEA 4NAFB 4WOZA 4ZB5A 1JF5A 3JUGA 1KFBA 3H2CA 1Z9AA 3FXGA 4KERA 2PLJA 3UXDA 3ITYA 3WH5A 1PB0A 2XWDA 3Q94A 1JYXA 4EXAA 4QHRA 4A05A 3G0UA 1Q65A 3GYCA 2IQDA 2O55A 4Q7NA 1AZ2A 3WBXA 1K9FA 2G3IA 2TRSA 4ZBCA 3DENA 3PTQA 3OEXA 3BLKA 2WKJA 4BF7A 3SBFA 3FVMA 2J88A 3FS2A 2DEPA 3PZVA 1E72M 1YMYA 2Y5EA 4ADUA 2FZNA 3T7VA 3RX2A 4M6PA 4KCTA 1XLFA 1A5BA 1WKYA 4MYXA 4N4PA 1UOKA 4PMJA 4O19A 1V3LA 2AQWA 4Q8TA 3STGA 3C86A 3R4IA 1TIWA 2Y61A 3DC8A 1RBOB 1VBUA 2WSKA 3QV9A 5CGTA 3CQHA 2JIEA 2A3LA 4LUTA 1EEPA 2J78A 2GOUA 4HMCA 3KOZA 1OD8A 1SQ7A 3OG2A 3MUXA 4FK9A 1H50A 5FL1A 1OWQA 4Y96A 2JALA 2GGJA 3W7OA 4LPCA 5FJRA 1U5JA 1P6BA 4LUSB 4O54A 1JUBA 1M04A 1QDSA 3OVGA 3EB2A 1SFJA 3OQ8A 7TAAA 2VZTA 3B8DA 5MF5A 3GFZA 4HZ7A 1UR0A 2DH2A 1CXFA 1OFBA 2BLEA 1UW9A 4B5UA 1W9VA 1XLKA 3A12A 4KWOA 4AZ5A 1W32A 2BXZA 4XD3A 5FF0A 1V03A 3UJFA 1R30A 1UG6A 3UD6A 4LYKA 3N11A 1LP6A 2OEKA 3PULA 5CPLA 4WY0B 3N17A 4I9MA 4WJEA 3WDQA 4XKYB 3B06A 1RV8A 5A8GA 2Y6ZA 1HJVA 3KRSA 2HK0A 4WUIA 1YNPA 3QHOA 2J27A 1KRCC 4FF5A 4PCNA 3QF0A 2OSWA 6REQA 1KR1A 4IMFA 1TPC1 4IP5A 4YTUA 4AZ7A 2FH8A 4UTFA 4FOUA 1H7XA 3NIYA 4H9YA 1SMAA 1X6NA 3O6YX 4RK8A 3LHVA 4Q6JA 3TSDA 2ZIDA 3NZPA 2H90A 4GGHA 3V75A 2XSBA 4BCEA 5E1QA 1XCFA 1TPWA 4I5UA 1LWJA 3N6JA 3EMQA 1CXEA 1H41A 1OK4A 1J0YA 2ACQA 2V30A 2OB3A 4K36A 3WLLA 3IK2A 3BSHA 4QLJA 4URIA 5LIKX 5BXPA 3FEQA 5HJYA 3M46A 1ECEA 3EBVA 3H54A 2DZTA 1HN1A 3KL0A 1AK5A 2OQHA 3D3FA 3DUGA 4AIBA 3A21A 1UC4A 5D38A 5A8QA 4LAUA 3LNPA 4H1ZA 3LMYA 2Y5JA 2WB5A 5JBDA 4YN5A 4O1DA 3AQUA 3RHGA 1VJSA 3SUVA 1BLIA 4W4QA 1EJUC 2IPJA 3PFRA 4NSBA 3CS2A 3TH6A 2NUWA 2IQ0A 1L6SA 2XINA 4EOUA 2Y4SA 3TEVA 2YCLA 4I7UA 5C8BB 1BVZA 3AXKA 4DUXA 4ZGYA 1QW7A 3LLFA 1CBGA 4S1FA 3QXBA 3ZR6A 3BOLA 3MBFA 3G8RA 2QYGA 2OLHA 4HIBA 3RFAA 2HROA 3FSUA 2Y62A 3N73A 2ZCGA 4U10A 4P5UA 1ZUAX 3ZT7A 5DRCA 3PAJA 3TNBA 4C1NA 4Z17A 3DHDA 3TSBA 1NF7A 3HIJA 4GCAA 1W1IE 4MYAA 4KESA 4QJ5B 3EEGA 4B92A 2INEA 3S2MA 4L4MA 1BYCA 2X1RA 4MLJA 3CB8A 2Y7FA 4KWUA 4HPHA 4MB1A 3AWNA 1UR8A 4HNVA 3BWWA 4N9BA 1JXJA 3LBCA 4JKKA 1XLJA 2QAFA 2WVUA 1OK6A 1HQTA 2VQTA 1NU5A 1JZ7A 4V33A 1G7UA 4QR6A 4WLCA 4A29A 3SSJA 1FHLA 3KFTA 3PSWA 1B4KA 3GTNA 5HMEA 4GE8A 3S47A 1T8XA 3HU7A 1CGTA 3DYPA 5LNRA 3D6NA 1W1PA 2E5CA 3CL8A 3PNUA 2ZUTA 5JXQA 3S4TA 3DZ1A 3AIBA 1YDOA 5U4NA 4A4AA 1VEMA 4RUBA 1YEYA 1K02A 3G1FA 3OBEA 5D2XA 3FLUA 1M65A 4US6A 3RG6A 3UZWA 4J9JA 3LMZA 1DJHA 4B15A 1BAGA 3S9YA 3G8EA 4F4RA 3M4HA 1PYFA 3PB0A 3V1PA 3G0SA 4KCWA 3THUA 5K9DA 4UTTC 4PUUA 1HNYA 4A2SA 4KEMA 1YHTA 3R25A 1W3JA 3GKFA 3STPA 3GIQA 2H6RA 5HQMA 4O1FA 1BF6A 1YX1A 3L0NA 1UH3A 1F3XA 1VLWA 4AXNA 4E2BA 4IPLA 3KBSA 2SFPA 4GIYA 4IGNA 2BSLA 2DPEA 4E2OA 4CD7A 4WVXA 3K8MA 4YTTA 3ARQA 1JCTA 3QV6A 3GVWA 4NNAA 3ZQ9A 1EA9C 1P0BA 2VURA 1ZNNA 3NQAA 2WCAA 4LANA 2RGLA 2E0PA 3P6LA 3OYZA 3SECA 1NWRA 3TN5A 5J5DA 4F48A 3ZS4A 3T1GA 2ZQ0A 2P50A 2UZ9A 4DJED 3U0HA 2BHUA 3UXKA 5I7GA 4HK6A 3GG1A 3CNYA 3J7HA 3W2JA 3AMGA 4JTEA 1XI3A 3GDMA 3T6CA 3U7VA 1A0DA 4BI7A 1R8LA 4AISA 4MFDA 3WD4A 4LQ1A 4R53A 4D8AA 3NDZA 1V79A 1TIMA 1V0LA 3PR2A 4FNUA 4KWVA 4FLRA 1QOPA 1UR3M 4XD5A 2WWDA 4FXFA 5LA2A 4AWSA 2P0OA 1ZBWA 5I3KA 3NUKA 5A6LA 1GVFA 4J3ZA 2XIBA 1VEOA 4KT2A 3TAOA 4FNSA 3OU8A 1RD6A 4LB3A 1KQZA 4O1AA 3IIOA 4IPJA 2B4GA 1ZS2A 1OFOA 4HB7A 3DGRA 4H6KA 4KMQA 2Y0FA 1XR2A 3MHFA 1XLDA 5EFDA 5LIYX 3VGHA 3P2VA 4HNCA 2RDUA 4XAFA 3MKKA 2OELA 1GKRA 2ZUNA 3N19B 1WB0A 1BVWA 4ROQA 2DZBA 3JS3A 3WDHA 2Z6IA 3LPFA 3S46A 3N04A 3BK0A 2C15A 3RK8A 3E2QA 1A5KC 3JR2A 3G1DA 3P61A 2PRMA 3N15A 5IDIA 4W93A 3G1AA 4UOZA 2C0HA 1LLWA 3LI1A 2I17A 4HA1A 2E9MA 4UFKA 1GOKA 4QROA 1EJRC 3PY2A 1P48A 3JZEA 4PC8A 3NZRA 3GE7A 1R86A 1ODZA 2VFGA 3NGJA 3ICJA 1WXYA 3CHEA 1KGXA 4L4OA 4XVDA 5DRIA 2YL8A 4HHHA 2VEKA 4S2BA 2QMJA 1KO0A 4ACZB 4LC8A 3S5OA 4BY3A 2YB4A 4WR3A 2X30A 2DY3A 5FJJA 3RDKA 2VCCA 3AHZA 1AW1A 5M1TA 4PFMA 5H1WA 4PMYA 5K3VA 2VRJA 4UTMA 1YE4A 3WF0A 3UXIA 1GYMA 4NQ1A 2EPLX 2XVKA 3W86A 2X8RA 2WSQA 4F9JA 5TQLA 2BXYA 4JS3A 3A4JA 1Y5XA 2PF8A 3NFUA 3TCSA 4P8WA 1S5NA 3L5AA 1S2WA 5BU9A 3DOPA 3UZYA 4LF2A 1B5TA 3DESA 5H2ZA 2WV8A 1TWWA 3MSYA 2F6XA 2VHLA 4ZCWA 4C6KA 1IT7A 3SW6A 3N6HA 3BARA 4IJBA 1Q5MA 3CV7A 1KFEA 2A7NA 2A79A 1QATA 4XBJA 3L5LA 1DL3A 4RW3A 3TOYA 3EWBX 1NWSA 1R38A 1D7FA 1FDJA 3LHUA 1P4CA 3ZVHB 3B8IA 2E7FA 3TLLA 3L2IA 1JAEA 4TVDA 2R9RA 4C6QA 3IV8A 2ADAA 2PLMA 3MBDA 3IV3A 1ZGDA 3O16A 2BWGA 1AQMA 4UFJA 4UQDA 4C6OA 2PB1A 2OLAA 4U33A 4G1KA 5A69A 1WZKA 1YIXA 2BASA 3E0LA 5F7UA 4M6VA 5REQB 1K3UA 3WLSA 1PE1A 3UW6A 4IMGA 3A3HA 3M6DA 4CN6A 2JGYA 4OTKA 3SCPA 2GUUA 4JEJA 5DMMA 4KS0A 3DIPA 3GU1A 4H9UA 2WC3A 3VNJA 4Q22A 3LHYA 2Z28A 3W7NA 3WQPA 2NQJA 4GQRA 4WEVX 5AYBA 4GQGA 3WLTA 4DJDA 1XFCA 3AIEA 1DIKA 3USBA 2VX4A 3EXRA 2YJQA 2ZX9A 2PUZA 1VHNA 3WENA 1XCXA 3CO4A 2J66A 3BG5A 3W7MA 3BG3A 3W7KA 4TMCA 4U3AA 1V93A 4O16A 4QNEA 2BGSA 1WKFA 3IRSA 1UPMB 2G41A 3B97A 1DWAM 3NOEA 3W75A 1B3WA 2E6DA 2IKJA 1MRAA 2O9PA 1L9WA 2XFYA 1IR1A 4E8DA 4CQCA 4LNCA 4NASA 1O95A 4AF0B 2Q3OA 3IVUA 1EJXC 3AYVA 2Q8ZA 2BOFX 1WBJA 4QLLA 2WVTA 1HTIA 3MMTA 1EP1A 4FIRA 4XAPA 3V5FA 3GC5A 4LY4A 4A8IA 3OOQA 2PGFA 1E9LA 2FTWA 3LQLA 4F66A 1WDRA 5G5IA 4KIRA 4IFOA 2WLZA 4PMZA 1SW3A 5H8PA 1ZFJA 1HKVA 5C0QA 3II1A 2F61A 2QR6A 2QEZA 5XIMA 1BGGA 4LYQA 3H53A 4N9DA 4HU0A 7ODCA 3ZXWA 3HF3A 1J12A 2C13A 1FHUA 5JUVA 2V3FA 3AZTA 4KEUA 3KXQA 1JCMP 2YCIX 1QOQA 1Q7QA 4NJIA 3GVRA 1Q7MA 3CV1A 4QSHA 1JQXA 4J40A 1O12A 4WDUA 3L4TA 3HM7A 4O15A 4AD5A 3M9YA 1PTDA 3WMBA 5H6HA 3WLRA 3VMPA 1V3JA 4YTSA 1I2PA 3LQGA 1X38A 2OQYA 2ZZ6A 4MMWA 2YLAA 3MMWA 5ABFB 1RVKA 3AS0A 3DH7A 1Q3NA 4O18A 1A5LC 1UB3A 1AW2A 3QLDA 3UWEA 2XTKA 1ITXA 4ZTXA 1YE6A 4JTKA 2ZRUA 2C16A 2XIOA 1CI1A 1H1NA 4L9XA 3N2MA 2D2JA 1Z32X 4ICCX 4MAZA 4DXKA 4XZ9A 4W5UA 1VC4A 1KGUA 1S1RA 4L7ZA 3TTEA 3SCQA 4B5XA 5DY3A 4GNJA 2ZUSA 1DJWA 1JDDA 5HNTA 1FWHC 1QPNA 3TW6A 2OYMA 1W6TA 3UZZA 3LXCA 2DZUA 4NJGA 1IF2A 2G8ZA 1VP5A 4MWAD 1FRBA 1DORA 1XIEA 1K03A 4A3RA 3I7SA 3VNMA 1RA5A 3AUOA 3AMCA 5KZMA 1XD0A 2QUUA 2ON3A 1HGWA 1Y5VA 2ONEA 3MPGA 2WMGA 4M7TA 3FN9A 3KRUA 1XRSA 3RJXA 3ORWA 3OHMB 4MGGA 2OFJA 5AVHA 2ZE3A 4LUTB 2BZNA 4D71A 3CT2A 3P74A 3SURA 2H3DA 1XD1A 2WSYA 1LL7A 4TVCA 5G4HC 3VE7A 4HNLA 1UP0A 3ZT5A 3QY6A 1ZAJA 3E9AA 1OFPA 2QPXA 5EMYA 3MCNA 2GOKA 3K13A 2GUYA 2IPFA 5D09A 4FLQA 2A3CA 2DV0A 3U5YA 1BSLA 1K7XA 3ABQA 1H2JA 1V51A 4Q6XA 3TROA 3G6MA 1LQAA 3M6YA 2R1KA 4H83A 4U4MA 3FHAA 2BHYA 3DDMA 1QO2A 2CZVA 5CPQA 3UY8A 3M47A 5EMUA 3UZJA 4NG3A 1JFXA 3PJXA 3PZGA 3CH9A 3NG3A 2FDMA 1GUVA 4DBEA 3PWIA 3M0JA 1PZ2A 4G7EB 2PC4A 1E6ZA 4QTGA 3MYPA 3T8LA 3PTKA 3TVAA 3RILA 3WLNA 4NAEB 2QUNA 4CNTA 2VR4A 1EGZA 1FUYA 1VFFA 5KEZA 1ISYA 4PBGA 4YXGA 3RLGA 4NAFA 1V0NA 4PTVA 1QJWA 1CW2A 1V0KA 3KRBA 4XZLX 1Y8BA 4V15A 1OCQA 5F4SA 3MHGA 2YYTA 4F79A 3CHDA 2AL2A 1AVAA 4XK2A 3PPCA 4PMNA 3H21A 5E0FA 1UR9A 1J0IA 1L6GA 5FAJA 3UJEA 2B7QA 1RK6A 3SJNA 3A13A 1TRDA 1XBZA 4PRWA 1YTDA 3TJ4A 1M3UA 4I6KA 3OODA 3HPAA 1S3TC 1GT8A 1OADA 5FAGA 3FV9A 1C8VA 1W3TA 2Q09A 1LQ2A 2WPGA 1OT2A 4MWAC 2G95A 2WJFA 5CAHA 1U1JA 1PAMA 4US5D 1LWIA 3AROA 1DJGA 2HK1A 2V2CA 4OOZA 1W9XA 5FSEC 2BV9A 3MMUA 3EDEA 4AYGA 2QDDA 3BVJA 1OJXA 4BEQA 1KFJA 2IW0A 2TSYA 3EDFA 3D47A 1AQFA 1XBVA 1DEDA 4E2VA 1VCGA 1WXZA 2DUXA 2OCZA 1AQHA 2NLIA 4D6HA 4UXDA 4JIRA 1WDWA 1HL8A 4O0QA 1KA9F 3BW3A 4P61A 3S1UA 4XBSA 1FWWA 2Y24A 1TRIA 3B40A 3K30A 3E02A 3FW6A 2PGEA 4YU1A 4PGLA 4Y9PA 1W3KA 3HV8A 2XPKA 3GY1A 4XAGA 3LRMA 1E0TA 2FTYA 1E43A 4QISA 4H7ZA 3SGGA 5TAOA 2WMJA 3B8VA 1AL7A 1IZJA 1QUMA 3CC1A 3WNPA 4FMVA 5T9CE 2PWDA 2E40A 1RQBA 2DT3A 5EU9A 1BRLA 3GQYA 3B9DA 3C0LA 3T9PA 5F2MA 3ECQA 3LHTA 2I7GA 1V6XA 3OZOA 2YB1A 4LFYA 1MSSA 4GACA 4PTWA 2Z4GA 4W8BA 5BZAA 2WZMA 2X1TA 3C52A 3DKJA 3WJSA 1LT8A 5C54A 3ARSA 2W3ZA 1K8ZA 2XH4A 4JPGA 1RJRA 3UY7A 4PULA 5AC6A 2F6UA 4JN7A 4MY1A 3APYA 3LCGA 3ITTA 1XBXA 3REQA 5CPMA 2RDTA 4G7FA 1U5VA 2PA6A 1VIWA 2JK2A 1B9ZA 1OC7A 1KRBC 3QYSA 3H2EA 3WELA 4OGZA 1E71M 1CTNA 1J10A 1ME8A 4V27A 1P6WA 3GU9A 4TR9A 4JTTA 3W07A 2OO0A 2ZZ2A 1MWOA 4XAZA 1TO3A 2DSVA 3NWRA 2V2HA 2CLIA 2QCNA 3QFEA 1L6WA 1EFZA 1VFUA 1VYPX 2GL5A 1GQJA 4F0LA 1RP9A 4GI8A 4HBKA 1UD3A 5AYZA 5CLWA 1P0EA 3P5YA 4HSOA 8CGTA 4CNPA 3IACA 3CHFA 2FTPA 4UB9A 3UJSA 3L21A 4IZGA 4HNTA 2B7NA 2JKEA 3VGBA 1KWGA 3TN6A 2WNZA 1LRQA 5AHFA 5D2TA 3RCMA 3VYLA 1NDVA 4K37A 4C5ZA 4GG9A 4UQBA 4MF4A 1UYQA 3W1RA 4AD0A 3W7PA 3DG7A 1X8CA 4DBUA 3HGJA 4LVDA 3A47A 4PTDA 1QBAA 2WJZA 5I3HA 1H09A 1VPYA 3AS2A 3AICA 4L64A 3M0ZA 4Q8UA 3VIGA 4DYEA 4FIQA 2NQ9A 3L4UA 5DXYA 3GNNA 3V0SA 3GYEA 4P7OA 2JKAA 4ZQRA 4NNCA 1U1HA 4LV4A 2CIPA 4MJ4A 1XGDA 4IHCA 4LUIA 2ZXQA 3RR4A 4DWSC 5DN1A 3GHUA 3F1QA 2QCLA 3BZJA 3BSGA 3IANA 4K6AA 4OBSA 2V82A 4BHYA 3RR1A 3SM0A 2WKGA 4H9TA 3WQ8A 1RCXB 2GSEA 2YBTA 2DIKA 2ZADA 1TTIA 3WBYA 1F3WA 3EOOA 3FYYA 3L12A 3ZIZA 2EXOA 5K4ZA 4ZOBA 4G8TA 5K2ZA 3NOYA 3M7SA 3W85A 1RBLA 5LKYA 4GC4A 2E25A 4CQAA 4GABA 2YBUA 4H19A 1UD2A 1WKDA 1YQ2A 1I0BA 1XG4A 3S1VA 5CKSA 4W7WA 3EA2A 5C70A 1A5SA 1OEPA 3ZJ7A 2HRWA 4Q4OA 5FEWA 3BZGA 3WK2A 3U4FA 3KLKA 2FDSA 3S2CA 3B9OA 4H4IA 3WL1A 4KRTA 4JTFA 4IPNB 3OZMA 2CLLA 2E68A 3ONBA 3UVIA 3VOGA 3FKRA 4QM1A 1G1YA 3B0YA 3IAQA 4PBEA 5ECUA 4FNRA 2BX7A 1QPRA 3W71A 3MSGA 3FX4A 4E38A 4J7RA 1K70A 1BVNP 1W1YA 3THQA 4MWAA 2IPWA 1H7NA 1RLCL 5A3HA 3E0IA 2HZGA 4QGCA 1EA0A 4NIRA 4R34A 2IMRA 5GNXA 5C2CA 1ZY9A 1FCQA 5BWFA 4TIMA 2PP1A 2ZWZA 1AFSA 3EWWA 4Y2WA 4HTBA 2X1UA 3TQKA 3RITA 3SCNA 1OHLA 3EGJA 1TV5A 4TV6A 3CB3A 1F74A 3C2FA 1J5TA 5D03A 2QGHA 4BF9A 4LX4A 2P8CA 6ALDA 3PZ9A 3TN3A 4H04A 2BOGX 3GG7A 4EXBA 3PHAA 3OA5A 3L67A 2PC8A 2O7SA 3E12A 3KTCA 3KCLA 3EOLA 3WH8A 4IQDA 4FAMA 3ANVA 5CJNA 4KH2A 1ADOA 5MKGA 4XZMX 3MCOA 1KWKA 4LCQA 1LJYA 3AIWA 4JNYA 5HBFA 3ZVIA 5FF2A 1HP5A 3HG5A 4RNJA 3QC0A 4EK7A 4AWEA 3ONCA 4B9ZA 4DBWA 1HGYA 1AW5A 1HL2A 3C3UA 4AH7A 3KCOA 4R5EA 2VDHA 4LJ3A 2QT3A 4ICMA 2C79A 3HB9A 3SY1A 1MEIA 1Z41A 1IE7C 1ITCA 1YXCA 2PD9A 4TX6A 4DBSA 3OG3A 1UD8A 1Q6RA 2BGNE 3W38A 1T7LA 3T8QA 2QCMA 2WWCA 2X7VA 5BROA 2P8BA 5DCBA 3TXZA 2WZIA 1SO4A 4UOJA 1AG1O 4OUIA 1POKA 4AC7C 4DB7A 2Z7KA 4O1BA 4F0RA 1Q6CA 3VC6A 2CNCA 2A6LA 3STEA 5D32A 4AVFA 5DF0A 2PDXA 5DBUA 1GG1A 4PA8A 1UUQA 1TJRA 4DPQA 2IUZA 4XZIA 1CXLA 3GAKA 4ZB2A 2VYOA 2PWHA 4S3GA 5CPOA 5GNZA 2ZUVA 5I6SA 1VJIA 4IGSA 2V3GA 3W26A 3PBGA 2R1MA 4Y6GA 5HUOA 3W84A 1TV3A 1W8GA 4Q4PA 4Q32A 3CWOX 3R12A 4ECLA 2QPUA 1J96A 6XIMA 3KWSA 4LXFA 5CBBA 1YLVA 3O63A 3WF4A 3O6CA 2D0FA 1ZJIA 4AEFA 3LPOA 2ZVIA 2UY3A 3QPZA 4A8RA 1H1YA 1KV8A 2GVEA 3WL0A 4ATDA 1ONXA 1XX1A 2G0WA 1WYIA 1FHDA 1CNVA 4R3UA 2G37A 4YHEA 2A3EA 1W3IA 2XM2A 4WGXA 2VZOA 4I7WA 4UQAA 1UWRA 3IGXA 3A5VA 5HWMA 1W2PA 3CV6A 1SSGA 1K6WA 1WO2A 1GVOA 4WK9A 1HJQA 3R58A 3TA6A 1S2VA 3TYUA 5IM51 2FZDA 2G3MA 1XP3A 3L4VA 3RUBL 5I23A 2C14A 3ARPA 1R9XA 4AD3A 2VCAA 4JFUA 4S3CA 4Z42C 3LCIA 3NO5A 3VD3A 3IPWA 3AHTA 4UFMA 7XIMA 4Z1DA 3T07A 1XV8A 3CTLA 3GZ3A 2NSXA 4XSMA 1GJPA 4IP4A 3RU6A 4ZXLA 4GXWA 3NNTA 3GXNA 4EPDC 3FEMA 4TX9A 2QUMA 1A80A 2GJLA 2GGHA 3BJTA 1AZ1A 3QKZA 1FFQA 4YYCA 3MQTA 2J6VA 4Q3MA 3H2FA 1SW7A 1UA7A 5E9AA 5CPTA 4WDWA 1YBQA 4S3KA 5CPNA 4MB4A 1UUOA 4JTIA 3GR7A 3RLHA 2ACUA 4J27A 3UESA 1QI4A 1OSEA 2GVYA 5CGQA 3VZYA 4Q8OA 1ZHAA 2ABAA 1PKMA 5DMLA 3S9ZA 2L5HA 5E9XA 1NELA 4MFEA 5M17A 3G24A 2VKZG 2UY5A 3IK4A 3EWDA 3AIUA 1EL3A 1VYSX 3ES7A 2WHLA 3EOEA 3GB6A 2VRKA 4WIWA 3TONA 1UA3A 4Y9AA 4D6CA 2VX5A 1I2RA 3PJWA 1SFLA 3RYSA 2WYSA 2CLMA 5F2GA 4R27A 1R47A 3LTYA 2DQWA 3WNLA 5J8LA 4N4QA 3ABRA 1RUSA 5CLTA 3SRFA 2VVSA 3EB3A 2F2HA 2B7PA 5F1VA 1SR0A 4XV0A 2VFFA 3PS7A 2RAGA 1JF6A 1TPFA 4B91A 4JQ1A 1XIDA 2IS7A 1FBAA 1D8CA 3W2LA 1EGVA 2FB2A 2J7FA 2BVTA 4AHOA 4GFIA 4LBSA 4F40A 3QOKA 3WD3A 2D2HA 5CC6A 4MZ8A 5KZ6A 4RDVA 4DLMA 4LALA 2VO5A 5FJIA 3W29A 3OLGA 5LSMA 3U6WA 3L2MA 3NXFA 1RD5A 4IOTA 1GOWA 3UCQA 3CHCA 3ZR4A 1E1CA 3K4DA 4HN4A 3WUGA 3AU6A 3NDOA 3V0UA 4AD1A 2RJGA 5K9CA 5C55A 5HMSA 3WQDA 1ITUA 1PV8A 1XQKA 4PMUA 1HJUA 1MI3A 2OYKA 3CU2A 4UTUA 5BWAA 3O6AA 2BB0A 2H9AA 4O28A 1UZ1A 1VBGA 5G4WA 2QNEA 5LXEA 1TWIA 4ZO8A 5HATA 2NV2A 1A5AA 2D0HA 3EKZA 5CBJA 4DF0A 1MUMA 3THCA 3VOHA 5TNVA 4YHGA 1HX0A 5CZKA 3LNMA 4WJ8A 3U7BA 3FDGA 4CCDA 5AZ1A 2XG9A 5A2AA 5M03A 2OR2A 4ERGA 3CASA 4HU8A 3DG6A 1NWTA 4RZ6A 2E67A 2PZNA 3FJNA 5A6SA 3SGUA 3QMRA 2YDSA 4ROPA 2XDFA 1EDTA 4N9CA 1XLGA 3DHUA 1QFEA 4CVUA 3LGEA 3CJPA 3L68A 5HNNA 1RK5A 2J8TA 1GKQA 4JTUA 3VCRA 4AHQA 4LH8A 1OX5A 4AY7A 4X9SA 4JICA 5HR6A 3N12A 2QJHA 4XQ6A 4AVNA 4Z1YA 1E15A 3QZ6A 3GTXA 1POJA 2XZ9A 3UG3A 1MRQA 5JQ9A 1XUZA 4RE2A 3S83A 4AD4A 4US5A 1OG0A 3RLVA 1J0KA 3U8GA 2NW0A 2WBKA 3RGTA 1SFSA 1OYCA 2PBOA 2HXTA 2WMIB 4CEUC 3EB4A 1R3TA 3N9SA 1ZLPA 4W7VA 3URNA 4LBUA 4AHPA 4GFSA 2BNJA 4IT1A 1UR2A 2DZPA 3UR7A 3CWHA 4LBRA 4U5IA 4PTMA 3EEZA 2EPKX 4HZ6A 2ZICA 4IMCA 3QQWA 4GIEA 1T40A 4GIRA 3MKCA 2XVLA 1GORA 3G1YA 2ZOXA 4YVXA 1QI5A 2DQXA 3JVAA 3WK3A 3TC3A 3CO8A 4WJXA 4PUKA 1DQXA 4HZ8A 2NV9A 3PAOA 3SGZA 3EAUA 3GK0A 4QJ3B 1E6NA 2W61A 5FJOA 4HZMA 3TJIA 1D3GA 4FLSA 2JF6A 4GX8A 4UTWC 2P76A 5D02A 4Z2KA 3N3MA 1CDGA 4FO4A 4Q8NA 1E73M 2XSAA 3ITCA 4F0MA 2QJMA 3LLDA 3QOMA 4JTSA 1BGAA 4A3QA 1W54A 4JQ3A 2R8WA 5JH2A 4B5SA 4M29A 5LIUX 3A22A 5HDRA 3QEZA 3E38A 2GLKA 3K5XA 4WF7A 1E1FA 3UBPC 4NX5A 4OOUA 2YL5A 4ZSUA 4GD0A 4Z0SA 4DUWA 3ZJ6A 3WYZA 2ZXAA 3SCWA 3WQEA 2O7QA 2Y7GA 3KBVA 1RPXA 4JFTA 4GY7A 4DNHA 1TMLA 3E0VA 4KCVA 2OXNA 4B2DD 1TMQA 1JAKA 4AEOA 2VWSA 3S3GA 3G22A 4X2RA 4NHVA 2GJRA 1CGYA 2J13A 1PZ3A 3TCEA 3E2VA 1B2YA 1FH7A 1ECQA 4U5KA 2ZA1A 3WJZA 3PBYA 3N4EA 1TR1A 4K39A 3POCA 3JRKA 4FXJA 4M6QA 2VOTA 4BR1A 5EA9A 3RO6A 2VC6A 2GQ3A 1CWYA 1FWTA 5EMMA 1BXNA 1GYNA 3GRIA 3MMDA 5C5YA 2H8ZA 3WK0A 5FF7A 4RKAA 1F2JA 1YTKA 2CW6A 1X6LA 2WW5A 3BAYA 4AMCA 4EE9A 3IVTA 4OE7A 1CXIA 4XWUA 3AUJA 2OX4A 4P7RA 2DJXA 4MPKA 2PE4A 5I03A 4EVZA 3W2NA 3QVQA 1SJBA 1VKFA 5LA0A 2IQTA 1XIIA 3MZNA 3IJLA 1A50A 2Z2UA 4HK5A 5M2FX 4MDOA 5I3FA 4L4LA 1RAKA 1TE6A 1IIGA 1W56A 1EYEA 4D6IA 2FGBA 1K9EA 1W0MA 3NPVA 1N7KA 5LGXA 1EP3A 3LN3A 1MO0A 2WMFA 1AA1B 3V4BA 4L9ZA 1KTNA 2HE5A 1IT0A 2OX1A 3RCNA 1GJUA 1E6XM 4M19A 2G5WA 3DCPA 3KVMA 1AJ0A 1WA3A 1UWQA 1E9IA 4PUEA 3QH2A 3WK1A 1GQLA 1XLEA 2PTDA 4XKMA 1PJ9A 4EWND 2R1PA 2ZE0A 4I8YA 1XLCA 3TN4A 5F1UA 5PTDA 4DVOA 3W7GA 3URAA 4B3KA 2WZEA 4GJJA 1MVYA 1JXKA 3GTFA 3CIXA 5E6ZA 2BVYA 2XGBA 1OGSA 4GQ0A 3TFXA 5GVJA 1G6CA 4LYRA 2EHHA 3ISIX 3GR8A 3RRXA 1ME9A 6XIAA 3PB2A 5FKYA 3GVGA 3O0FA 1YPFA 4HHLA 3MO7A 1E0UA 4GCXA 1RY0A 2YDAA 3PG9A 5D9MA 4DAIA 2VEGA 8A3HA 2BHZA 1C93A 1MYRA 3LK6A 4UQCA 4EF9A 4K1GA 2QQ6A 1H7PA 1EJVC 3BW2A 4QJ4B 1FVPA 2BGQA 4H6EA 4S2CA 4DM2A 1A49A 1JPDX 5EBUA 1TYGA 2X0HA 4JL1A 2Z24A 4QITA 5I07A 1BPLB 5D4YA 5AC4A 3KL3A 3NM3A 1C8YA 3ANYA 2HBVA 1E56A 4ORIA 3BV4A 5CEWA 4R7JA 3PZOA 1RXOB 4CQ8A 1NEYA 7REQA 1ZCCA 1EHAA 3GTIA 2PDUA 4LB4A 3F5LA 3O15A 2DZSA 3WD1A 4BKNA 3KZSA 3ARWA 4HPNA 2NQ5A 2WSPA 1W3LA 3RNDA 3N13A 2HWGA 2QUVA 4C6MA 5CQ1A 3IJ8A 3VOJA 5BXSA 5K7JA 4IMDA 3M7WA 1M5WA 4NRSA 3RIKA 1KLZA 3KE0A 2RFGA 1DOSA 5LYRA 4F2UA 5CAKA 3NQFA 2VEPA 2E3ZA 1EIXA 4CCEA 3K1GA 3FJ6A 3N2CA 3E74A 4BQ3A 1SVDA 3GKAA 2BY1A 1OFAA 3ZYZA 3E3HA 2J62A 2BOEX 4A6GA 1R3YA 3MTWA 3UPMA 3G1RA 4UR8A 4QQUA 3WN6A 5CJ5A 5LZLA 1UOZA 2ISSA 3PZUA 5I3DA 1E4LA 3B0XA 3UWUA 3H8AA 2NXGA 4C6CA 4IWWA 4V1XA 3GG0A 3TJXA 4L9YA 2I56A 4NT0A 3KZPA 3HA1A 1FKXA 1TB3A 5A8PA 3PBMA 1KRAC 1UIOA 3PPHA 4DO6A 3ARUA 4OV9A 3HG3A 3PK7A 1BWKA 1LWHA 1DKWA 3A9BA 4C6NA 4GBDA 1JFHA 1O1ZA 3PP7A 4RV3A 3CEUA 4FHAA 3N9KA 3CUHA 1QHPA 4MB5A 3GXTA 1E55A 3EX4A 4AWUA 1J2WA 1EBGA 3PZMA 5B7YA 2Z1WA 5CXPA 4QAWA 2FGLA 1WV2A 4S3JA 4E3VA 4MNLA 2X16A 1QHOA 1QI3A 1TTJA 4MIMA 4A21A 3GH7A 3H22A 1GQNA 4QCFA 3TTSA 1H3GA 2C71A 3H70A 2C1GA 3ITLA 3UWZA 1B3YA 3D5HA 3DU0A 1IWAA 3NSMA 3W1XA 4KFNA 2XHYA 3AIQA 1Q6DA 4HPXA 5IBXA 3I7QA 4EWJA 1X98A 1V3KA 2QS8A 4IQLA 1J0ZA 1DTNA 5KINA 4WSHA 4XAYA 1HG3A 2QAPA 3BJSA 3ZLHA 3BDKA 4UTTA 2GGIA 1HKKA 2OT0A 1TWZA 3LTSA 2W66A 3PUEA 1PWMA 1SO3A 4XZNX 3T09A 2ZX6A 4GUFA 5CC5A 1KM6A 4S3FA 1HVXA 4LTSA 2QULA 1E70M 4OJYA 3TMQA 2QXWA 3W1UA 4AZCB 3SUSA 1R3SA 1V02A 2QJJA 3W7CA 1XBYA 1CXKA 3FNDA 3MSRA 5HQLA 1JDFA 2E5DA 4YVVA 4DN1A 1BG9A 2V9DA 1X8FA 4O53A 4GH3A 4ZQMA 2BXVA 2VC5A 3MWAA 4D6DA 3EXTA 2DW7A 3BO9A 4S23A 3DC0A 1BFNA 3T44A 4GOAA 3GTHA 2BS9A 2QDEA 5K9XA 4N42A 1LF1A 2DUAA 1X96A 2REQB 3BLIA 4H8NA 5TD4A 3SUUA 4EKJA 2QZRA 1T99A 1PKLA 3H2OA 1JGIA 1RJQA 3CZKA 2WC4A 4L5ZA 4HU3A 3EPNA 4LY8A 2ZX7A 1KRMA 1JI1A 4RDWA 1ZCOA 3VNIA 4FR1A 1XDLA 1TX2A 2PDCA 5DQPA 3U3HA 4UWMA 4U2ZA 3PJUA 5EYWA 4DELA 1L2QA 3AMKA 1A3XA 3UETA 3W9ZA 1BF2A 3LGDA 3FCPA 1L6FA 4M6UA 1E4MM 4KF1A 2WMHA 3WD0A 2QCDB 4A8LA 1TJ2A 5H8MA 1TSIA 1G4EA 1OBAA 3TQ0A 1AH4A 2W63A 1G5AA 5A6BD 4TXEA 1DBTA 1R2TA 3WY1A 2HCVA 4WHBA 3WF3A 3ZVHA 3F03K 3H2NA 3SJ3A 3W23A 4MJMA 4XSLA 1ZZMA 2QW5A 1RQEA 1JGMA 3GIYA 1DQUA 1V6YA 2J4GA 4WXZA 5C2XA 2VELA 4HPGA 1FDZA 1TFVA 3LBMA 1Z42A 2J7BA 4DIAA 1RALA 4HK7A 4BFAA 2G50A 1P0NA 1WCGA 4AZ6A 1TTQA 5HJLA 4WY0F 1DXFA 1ICQA 2FHCA 3L0GA 1Q6EA 3SSZA 1NOFA 5GJMA 1FP9A 3IJ6A 1KM0A 1VGAA 4QE4A 1UP3A 2G97A 2PBGA 3WJXA 4UCGA 3AU2A 2VP8A 3GDLA 3MA8A 4C6JA 1A4LA 1A53A 1JD7A 2VFEA 3MYOA 3W7JA 1DIOA 1GCYA 4UR9A 3G1VA 2F38A 1J6OA 4AIOA 1VFLA 1V7YA 1RLDA 2NV1A 3FA3A 3W2MA 5A6JA 1FH9A 4QS5A 3WQVA 1XM3A 1TMHA 2QDHA 1BKSA 1E6RA 4Z2HA 5MKGB 3GDKA 5HK4A 3MVIA 3WG6A 4D6JA 1EB3A 5AFDA 4RPPA 3WH6A 4D6EA 3QY8A 1ZALA 1VFTA 4O0ZA 2J79A 4BEUA 3ITGA 2WHKA 1JYWA 4HA4A 3QHNA 4GVFA 3WBEA 1HJXA 2QJNA 1H7OA 1NDYA 3TW7A 2WVSA 4ZQOA 5KETA 4OVXA 3SN4A 1F76A 3HV9A 4KFOA 2X1IA 4RV8A 2EPHA 5B7ZA 4LV9A 4AZBA 1SYTA 4B5TA 4L4PA 3OP2A 2JF7A 5AC5A 5FD0A 4LOCA 4MG4A 5TIMA 2FHBA 3GDBA 1JZ5A 4XX6A 5EB8A 2WCSA 2PCQA 4J1OA 1E5JA 1EPXA 1G7VA 3M0HA 4PL1A 1PX8A 1UKOA 2CHOA 1CENA 2FJUB 3NL3A 3GW3A 5K4XA 1XIMA 1SJDA 4Y9MA 3BCFA 1W91A 4IMEA 3QZEA 2XVPA 3ATZA 3FGCB 4GBUA 1VRXA 3TYAA 2AQVA 4GHRA 3B8SA 1FXPA 1JR1A 1ZBVA 1WX0A 3SFWA 4MTVA 5I06A 3F2CA 3TJLA 5AHMA 3RN6A 1Z7AA 2WMKA 5FI8A 3K4WA 1SO6A 2G4JA 1IZKA 2D2GA 4FSAA 3B4UA 3P14A 4O8RA 4PB3A 2V5JA 1NQKA 3AISA 3EWZA 1KFCA 2ZWYA 3MDUA 4QXIA 2P3EA 4GMEA 1BSIA 2UBPC 2I9UA 4M3PA 1OX4A 4C1LA 3GM8A 2PGRA 2WC7A 5T8GA 4PMOA 2FHFA 3W1TA 3CXOA 1EX1A 1U83A 4GI4A 2VGGA 2C1HA 4EPEC 1PSCA 3NO1A 1ENUA 3CBWA 4DZHA 2YCKX 4XIAA 3NQ7A 1KGWA 3AIRA 2VWTA 3OVRA 1WKEA 1DYSA 1V6VA 2PWGA 2ZVRA 3K4AA 1MW0A 1MXDA 4IL0A 3W7EA 2XIMA 4GVGA 1QNRA 5G1YA 1X1NA 1TPVA 4Y9NA 1IXOA 3FOKA 1KXHA 3CUGA 3RMEA 1W2VA 4YMZA 3OB8A 1Z8AA 3UGVA 4IIFA 3S2NA 2O4QA 5EKYA 1GHRA 3PNZA 4NY2A 1LRTA 2GJNA 3MANA 3MV11 3M0IA 2D22A 3S5SA 5EBAA 1B30A 4W8AA 3WLHA 1P1XA 1XLLA 2BMBA 3GXDA 5F4XA 4G9PA 4IICA 7TIMA 1XINA 3LCHA 5HNRA 3M0YA 2XFRA 1JNDA 2HDJA 1KM5A 2QDGA 4W87A 1TPDA 4IJRA 3QQ0A 3C61A 4JZ5A 2DP3A 4P8XA 4Z1CA 1XRTA 1O68A 3UXAA 1IT8A 1RJPA 3SR7A 1K8YA 1REQA 4XB3A 4Z08A 3IWPA 1GOQA 1T41A 4G5DA 4XD6A 3KTSA 5T26A 4X0VA 1C3FA 3DGBA 4PUMA 1QW9A 3O6DA 3T40A 4WY0A 2FZMA 3MJMA 5CC7A 1LBLA 1F05A 1U1UA 2OWWA 2IPGA 1SR9A 3MW7A 3VFLA 2JEPA 4B5VA 4X63A 4H6RA 4JFVA 4MB3A 3S2JA 1Q6FA 5BRPA 4JEQA 3BPWA 3NQCA 4GZJA 1XH2A 1ZPTA 3QJAA 3WEMA 4GA8A 2VZVA 2EQDA 2GJPA 1DV7A 2JBMA 2P88A 5ABHA 3WQ5A 5D2YA 3B9NA 5IRPA 2ZXBA 2ANUA 3ZJ8A 3VOFA 4NP7A 3SFKA 5BU6A 2AKZA 3BJFA 3ITVA 1WXJA 2V6AA 1KD0A 4O57A 4GISA 4YTQA 1W5NA 3PPFA 2J7EA 2ZX8A 4W86A 3M5XA 3V18A 4IUOA 1A4MA 3RRAA 5BOOA 4ZODA 3T81A 1PWLA 1T96A 3MZ2A 1IGSA 4HA0A 4CU8A 1XL9A 2NT1A 4JYDA 4AZGA 3BLFA 2B7OA 4JAWA 4KPLA 2OVLA 1SO5A 3E96A 1VS1A 2FZ8A 3BAXA 4ADTA 4YCPA 3KBWA 3FVDA 3ARVA 3BOFA 5JH1A 4PH6A 1MW1A 3CT7A 3DFYA 1ICSA 4B9YA 2FPTA 1QVBA 1ZP4A 4BWLC 4B4FA 4NUWA 4DM1A 1V8EA 3WH9A 1LZOA 3H12A 4UTLA 2D0GA 1A5CA 3ZOAA 3ARTA 2EF9A 1KCZA 2XFFA 5FJPA 1DJNA 5DANA 1GK8A 2E6FA 3EWUA 3TQPA 2I1OA 3GSMA 4MM1A 4GNKB 3QPYA 3WNNA 2ATSA 3UP8A 5A8NA 1DWGM 5C6MA 2F6KA 2D24A 4Q4RA 4Q4MA 4U28A 2CBVA 2XN1A 1BKHA 3G1HA 5J04A 3VMOA 3G3MA 2FJKA 3W2KA 3MWCA 2QVHA 4W8LA 2EPMX 3W7QA 4GUHA 1BYDA 3FA5A 3W3OA 2INFA 4ZTYA 4WSJA 2CBUA 2V8ZA 5I09A 1Q6OA 1R6WA 4CEXC 3MU7A 1P7TA 4RW5A 1CB2A 3WFZA 1SJAA 2XJ7A 4FNPA 4EIVA 2HVNA 2YYUA 5D37A 3CPRA 4KETA 1ZJHA 2I14A 1QR7A 2WK2A 1DWHM 3K1DA 1LUCA 3VGEA 5DFAA 2CLOA 1TWSA 3HPXA 3L4XA 4AC1X 4C6EA 4H8VA 3UA3A 4IFRA 2QVNA 4R9XA 4JKMA 5CG7A 5HMFA 3CLMA 5IDZA 1W9PA 4UFIA 1TV7A 2YLLA 1E51A 2HNHA 3A4WA 1JI2A 1M03A 1M7JA 2Y8UA 4IQEA 1C8QA 1YDNA 1B90A 1KXQA 5G2WA 3LI0A 4TTGA 1FWBC 1E3ZA 4K1WA 4MUPA 4HPJA 4BWLA 2X05A 1IYXA 1XIGA 3SB0A 1LOQA 3TYBA 3EWYA 3MV01 3G6LA 1CPUA 1HKMA 3K8LA 1YPXA 1HJWA 4Y8EA 4PSRA 2V63A 4F0SA 4L1WA 3RJYA 1RP8A 2BVDA 3MP3A 1WZAA 5C7VA 1GZGA 4NL1A 4P8UA 3LG3A 2CHRA 1W5QA 4F2TA 4LW7A 3IJDA 3N1AA 2FQIA 4MZYA 4M56A 4C91A 3V1HA 3VKBA 4FNQA 3R1ZA 2VENA 1KBBA 2KZHA 2UWFA 4GO8A 2UY4A 2A2IA 5AC8A 3WLJA 2OEMA 1ONWA 4QSFA 1YNYA 2CXEA 3ARZA 4LUJA 1Q7ZA 5ABFA 2XZ7A 3G18A 2PODA 2WJEA 2EG6A 4AFYA 4PUWA 2W79A 2YCJA 3W72A 3FAWA 3QV7A 1KTBA 1NTHA 4JTLA 4UC5A 5JMUA 3DYOA 3MJYA 4FLOA 3DHPA 3VNYA 3P81A 4IISA 3VAVA 3GBDA 4NYUA 3GR4A 3BLLA 1VQTA 1UWIA 3M5YA 4ZFCA 3A64A 2XYLA 4DEFA 5E70A 1XSIA 2Y5SA 3VD7A 2PDHA 3CM4A 1NDWA 5AC7A 4RE0A 1C7TA 1VD6A 1WNOA 4BK9A 2EKGA 1I2QA 4AXKA 3PM6A 3VM7A 1GPFA 3H4WA 3P93A 1R85A 2PFHA 4MZ1A 1GOOA 3QRHA 1HKJA 2NVCA 1PVNA 1VEPA 3GHRA 4CU6A 2RDWA 1GJWA 1UR1A 4K38A 1XYAA 3GXMA 4OT7A 3EZ4A 1K8CA 3O8AA 4QQ3A 3DFOA 3C56A 1PDZA 3SUTA 2WQPA 1BG4A 1NARA 2PRLA 1I45A 3O07A 1PTAA 4B5NA 2ZRZA 2PDKA 3R0KA 1LL4A 1NFPA 1OCJA 2ZC1A 2PP0A 3EDJA 4XUGA 3VFCA 4JKLA 2AL1A 1L2UA 2R14A 2CWNA 3WNKA 2HVMA 1X6UA 3AHYA 4K8EA 3LRKA 4ZEPA 4JL2A 1V6UA 1DJZA 4JN8A 3KBNA 3UYCA 2PLKA 1W1ZA 3S0CA 3P0WA 1XKYA 2WANA 2DIJA 3ARXA 3QQ1A 3HQOA 3W4RA 2B31A 1VFMA 2OOGA 2PWUA 3ANUA 5AYIA 3RM4A 1H62A 1LQ0A 3T05A 4MJ2A 3O06A 1H7WA 4HP5A 3NL2A 3W88A 4MVAA 3I10A 4E6MA 4YTRA 5KZEA 4OECA 2YPIA 4IF2A 1TZ7A 2DORA 3OBKA 1ZL1A 3I68A 4EPBC 3CAVA 1MW2A 3HBLA 4A3YA 4Q7IA 1F6PA 3CZEA 2Z25A 3MHUA 4N2YA 1R87A 2ZXDA 3BANA 3GXIA 4FP1A 4KEZA 1JZ2A 3W0KA 1IEQA 3PWAA 3KDOA 4H9XA 1JQVA 4GJ1A 1MEWA 2GYIA 2XH7A 4FXSA 3IIVA 2A6NA 4RNIA 4ZA0A 4ADSA 3NR0A 4ZSTA 1ZJAA 1EEXA 2PDMA 4C90A 1K7FA 4U2YA 3E0FA 4HTYA 3WUBA 3IIPA 3ERPA 5I3IA 1AD1A 3A23A 3UR8A 1D8WA 1XLBA 3IRDA 1KLYA 4EAYA 2CFFA 1K6AA 2PU0A 5IBXC 4LNYA 3QR1A 1SMDA 1EX5A 3HTWA 1W3NA 3ZM8A 1UWAA 3VDBA 2O92A 1N8FA 1TVPA 3L4ZA 2W92A 3F4VA 3Q58A 4CU7A 2YL9A 1TKKA 1X7IA 5DCEA 1OFRA 1WZLA 2OZTA 1R46A 4OV4A 2VR2A 3EA1A 2NXHA 3QPEA 1FOBA 1HO4A 3CL6A 4R7OA 4CGTA 3C2YA 4DZ5A 3ATYA 2V5LA 5T91A 4WKAA 4RZBA 3TLQA 1PUDA 3DYMA 3TC7A 1V6TA 3M16A 3NGFA 3CL7A 1SPQA 1S5TA 3F2DA 2ZDSA 5CJMA 3VDHA 2CU0A 2J74A 5CSYA 1IXQA 1JZ3A 3PFMA 1CYGA 2OQLA 3EX6A 2WQDA 1C29A 5L9FA 2GVGA 1S46A 2ZRWA 4ZOAA 3H26A 1C90A 1V3HA 3BLOA 1ISWA 4H3DA 4JD4A 1SGJA 1EUAA 4DI8A 3DBNA 4BF5A 1L8NA 1J0HA 1G4SA 1QNQA 6ENLA 3CUXA 3S6OA 3LYEA 2I5IA 4XTIA 2J7GA 1XLAA 1RCOB 4ERAA 4JGDA 1J9YA 4QS6A 3MI2A 4J4KA 1EO7A 3B0UX 3VIPA 3G5EA 2NLYA 3DERA 4UNLA 3U4AA 2XM1A 1YYAA 4FB7A 1TUFA 5AYXA 3OJGA 3VKAA 5GJNA 3WLPA 2PD5A 3R7MA 4LWWA 1J8VA 3OVPA 1OF8A 4TTUA 1ZSXA 4AD2A 2I16A 4GVIA 4GIAA 4ERIA 2Z2AA 1J2BA 3QZAA 3BV7A 4EPKA 3VCNA 3GZAA 1TVNA 5I2UA 4XISA 1PDYA 3KW3A 1TELA 4YVPA 4ZOEA 2RGMA 1SW0A 3WCZA 3B8TA 1GKPA 5HWJA 4NXSA 4ATWA 3DEQA 3UERA 3C0QA 4Q4QA 1TCDA 1JDEA 4KFPA 1GPWA 4IIHA 4K8HA 1F3EA 1C8XA 1V4YA 1WDPA 1XDMA 2F7FA 1ZTVA 3RO8A 2VUNA 4Y8FA 2V5DA 2A21A 4JQAA 4GVHA 1ZQ5A 4X9YA 2B0MA 3U2ZA 5ENLA 1XIBA 1ZU8A 4XIMA 4KBXA 2Z29A 2ZZ4A 5KSWA 4RNHA 5LNSA 2YFOA 4F2BA 2C18A 3WMSA 4S3BA 1XRVA 1FKWA 2VX7A 4LAKA 2Q71A 1XUUA 3HMJG 4BI6A 4JNMA 1TQJA 2CLEA 4DYKA 2HBXA 1XYZA 4XZHA 4YLWA 2Z1SA 3TX9A 3P5ZA 1MFVA 3WSUA 2HS8A 4AZCA 3R94A 1PKYA 3L0KA 4LAZA 5FEPA 4DXXA 3DFQA 3G77A 2FH6A 1S1PA 4MKVA 3SY5A 3VO0A 4K3ZA 2H3BA 2TPSA 4JN6A 2A3AA 1S5WA 4AWTA 3HPZA 3DFSA 3T0DA 1NP0A 5BOEA 1W9UA 1A47A 1TTPA 4M51A 1QHZA 4DHGA 2QCCA 4ZB0A 1M7XA 4B4HA 2VEFA 3H55A 1RH9A 2YL6A 3OA3A 3HQNA 4AZHA 3WMCA 3ELFA 5E93A 3E6EA 3BUVA 4OQVA 1BWLA 3BC9A 2PI6A 4CCZA 2GDVA 1JZ8A 1OF6A 4MKSA 5D9OA 3BTNA 1OG6A 5SWUA 2PS2A 2QCDA 3N4AA 3LUTA 3VDAA 3VUPA 2BY2A 1M6JA 5HPCA 1F6KA 1P43A 4JYFA 4TX8A 3T0TA 1FWEC 5IXEA 4C7GA 5D04C 1P0KA 3PN8A 4LEQA 2WPBA 1JYVA 1KBKA 2GJXA 3E2SA 4KKXA 4Y90A 1KXTA 4ZO6A 1V3IA 4WD0A 4DI9A 2GDUA 2WZHA 3I4EA 1G01A 1XIFA 4NZ3A 3QM3A 4HOXA 3MP5A 2OWCA 3GO2A 4YWSA 2A85A 3HG4A 2PAJA 2AKMA 2AMXA 3N34A 3LXAA 3RU8X 5DT7A 3SCTA 4JDYA 2VC9A 1M01A 2YW4A 2VD9A 3KLLA 1KM2A 3NQ6A 4YWIA 1F6YA 2YW3A 3UWYA 2J7DA 1TPUA 1TPB1 3EX1A 1G4TA 5A95A 2YX0A 2FVMA 3ZJKA 3ITXA 4K68A 1H1ZA 1O60A 4F9DA 4ZFMA 3VKCA 3R8GA 1KC7A 1O5RA 3MUZ1 2HV5A 2Q8XA 4W7UA 4QX4A 2OEJA 3LY0A 1CLXA 4E4PA 5HA7A 1CGVA 2PGWA 2Y89A 1OC6A 2DUZA 4JHZA 3W6LA 7CGTA 1K4HA 1BD0A 2V3DA 2VZUA 5HPOA 2OKOA 1QK2A 4ICNA 2HQAA 3TC6A 4BI5A 3KOFA 4FPSA 1HVQA 2W9MA 3SEPA 3TKFA 1EJWC 3WDIA 1O1HA 4B3LA 4WDXA 3I3BA 4ZL1A 3KS6A 3T2PA 3WX7A 3N14A 4UTKA 3AC0A 4CUCA 2OWXA 1FFRA 5I0DA 2GDQA 4G6CA 4OHQA 1SZEA 3GDRA 2Y88A 1KBLA 4GZEA 2J9ZA 3LDVA 2HPIA 3NYDA 4UQEA 4POCA 5M3WA 4R9OA 2C8NA 4TOQA 4QJ1A 2E4TA 4IIGA 1X1ZA 4C6DA 4P2VA 1ONEA 4AAJA 3AYTA 4OFCA 5C9UA 3QR0A 4N7QA 1VFOA 2YBVA 2PWEA 1F07A 4XKYA 2V5BA 4F0HA 3DI1A 1HL9A 3C2VA 3QYQA 4AVOA 4RNFA 2XWEA 1AJZA 4HVXA 3IS4A 3LSCA 4PCSA 5TBOA 4JDBA 3IJ9A 1DTUA 1X7FA 4QAIA 1BXCA 2NXIA 4RJEA 1JNEA 3TMLA 3YPIA 4PSPA 1OX4B 1AL8A 3B8UA 2J9YA 5I3GA 4QE5A 2PP3A 1AMYA 1W5PA 2MNRA 1S2UA 1U22A 2Z1VA 2YCLB 4FA3A 5BCAA 2CYGA 2X0YA 1Q63A 2O9TA 1WPCA 3ZO9A 3P62A 5C71A 5AHNA 4H8HA 1XGZA 5IFTA 4FEZA 1PTGA 2E77A 2QPSA 1W1VA 3Q67A 4ZR8A 2E8YA 5G4EA 4KCUA 4Z1AA 3UWWA 2QV4A 4JTAA 2CPUA 4LRTA 6TIMA 5JBFA 2OLSA 2HMCA 3AI0A 3QN3A 2P3ZA 2ZA2A 4ES4A 3RM9A 2C19A 4IPIA 1AJ2A 3HMCA 5BOFA 1OINA 3GU2A 1EQCA 1XLHA 4H9VA 1Z44A 3IEBA 3TOPA 1TWDA 2HS6A 3UG4A 3W28A 1UMLA 1OIFA 3O1NA 4TV5A 5A8OA 2XH2A 1R7OA 4YIWA 1M41A 3LCXA 1I2OA 2XH0A 4R33A 4MNMA 1YADA 4AW7A 2PWVA 5L6UA 4L6HA 4Z2GA 1M1BA 2DVUA 2YA2A 1PIIA 1QO5A 2Q6ZA 4B16A 3NVTA 6REQB 4HHMA 2W0UA 1QNSA 4IIEA 1XH0A 2INZA 3AMLA 1DWJM 4GY0A 1QBBA 1E0XA 1RSCA 3B0PA 3FKKA 1KBIA 4RXGA 2NX9A 1VH7A 5DMNA 3UR5A 2RH9A 3C8FA 1G0CA 4LU0A 4NJJA 1I1XA 3C2RA 2P53A 3CUFA 3W1QA 3EMCA 1VENA 5G1TA 5JIPA 4CLMA 1OFDA 3FY1A 2X42A 1K9TA 2VT0A 3WUEA 3BH4A 2ZZ5A 4IIBA 4DQWA 1VFHA 2V81A 1GNXA 2GK1A 2VZSA 3PTMA 3NPUA 2CKSA 4L80A 4PEEA 4LUSA 4D1JA 4M1BA 4GRSA 4Q4KA 2KAUC 2CKRA 1NIUA 1HFBA 4CQDA 4LAMA 3M41A 2O4MA 5JU6A 3BAWA 1JDAA 3S1WA 1I75A 1LM1A 4FX6M 1O66A 3LCWA 1Z3NA 5LNVA 3GX9A 3CTTA 3APTA 4HCLA 3TSMA 3QMTA 3W25A 1T0OA 3UGRA 3HO8A 1N82A 2Z1KA 1KQYA 3IARA 1SFTA 3D0CA 4AIUA 1D3HA 1EOKA 1H63A 2CZ5A 3TAKA 2XIIA 1FWGC 5DMYA 3MI6A 2QF8A 3NXLA 3M5ZA 2AAAA 3KAOA 4GGBA 1P7TB 3S5ZA 1OFQA 1JG9A 4ILSA 5EPDA 2W6RA 4NZJA 1GOXA 3NL5A 1LBMA 2ZRXA 1GEQA 4UTWA 4L61A 2QIIA 4LS2A 3GC4A 4QG6A 5C7HA 3VD4A 2QGYA 4DJFD 2Z7GA 4ZQNA 1V7AA 3WLMA 1C7SA 1REQB 2E9LA 4NZ5A 3THAA 1S2TA 1PKNA 2CLFA 3UXLA 2C91A 3W01A 5HOSA 1ODUA 3KEHA 2CESA 3S1GA 3NTYA 4J3WA 5FSDC 1TQXA 2BVWA 3TP4A 1TUXA 4IP7A 3W24A 1NOUA 2DZVA 2J75A 1XKJA 2EBNA 3MC5A 3CK5A 4H2HA 3S5NA 4DNMA 2O9RA 5HWNA 1J11A 3DX5A 1LG1A 4HNNA 2O0TA 1VBHA 2C1IA 3LRLA 3F5KA 1UWUA 2FVKA 4H01A 5DT5A 1H61A 4FNTA 4HA3A 1JPKA 1UJQA 1W5MA 1XLMA 4M0XA 3V7PA 2V0TA 2ZDRA 4N02A 2HJPA 1E6QM 2X0SA 1K9DA 2FLIA 3AHXA 4DUOA 1JCXA 1LYXA 2NZLA 3C4UA 1NH6A 3VABA 1PHWA 1MXGA 4ZO9A 1BYAA 1VJZA 4CD6A 1WOBA 4W88A 1XXXA 1H49A 5DXXA 4YJ5A 4HMDA 4J35A 1MUWA 3PZQA 1XW8A 4V28A 1JIBA 1M7OA 2FVLA 3L65A 1A0CA 1DJIA 3F7JA 4FOKA 5FJTA 1NAL1 3CQ0A 2E6AA 1XSKA 5GQBA 3CAWA 4JCLA 2CWXA 3GNOA 4UMBA 3SI9A 1OX6A 2W5FA 3TU9A 5BRBA 5IFPA 3TE9A 3ABSA 4J28A 4TMBA 4AMAA 4DJFC 1BQGA 1EOMA 2D23A 2X7WA 1OYAA 2QUTA 5CSSA 2X1SA 3HFYA 3R79A 2JQXA 1C9DA 4MY9A 3MKVA 2VC7A 3E49A 3H6OA 3W1AA 8XIMA 3CLWA 3NDYA 3BQ5A 1CEOA 5DCDA 3BCJA 1MZRA 3EYPA 2CBJA 3AYRA 1PYMA 3C2EA 4KW2A 4PB5A 1BQCA 1SU5A 2EO7A 3PZIA 5D8ZA 5EMLA 3FGCA 2E1DA 3KCJA 1NDZA 3GVQA 1ESWA 4JY9A 4MUZA 4HU4A 3Q37A 3P80A 2CXGA 4HSNA 3VUSA 4OBRA 3FJ4A 2OODA 3HURA 2PURA 4PCFA 1NSJA 4HYWA 3OHIA 1R7AA 3UVAA 3BAJA 4GNVA 1B3OA 1THFD 4W84A 1M68A 3PBVA 3A24A 5FOOA 9CGTA 5HXMA 2E6YA 3EPMA 2R24A 2EKCA 4JTDA 3W74A 2XVNA 5CBIA 3F4DA 5E6YA 4H7CA 2PTZA 3TTQA 3CQJA 1ZJBA 1JL8A 2QKFA 1YBQB 2QLYA 1RA0A 3BMVA 4Q8QA 1M53A 2BG5A 4H00A 4H8UA 3P67A 4UBPC 1PS9A 3NM1A 2G3NA 1AUSL 1W9BM 2A5HA 4UMAA 1RPKA 1LBFA 1DJYA 5D9NA 5EMKA 2VXNA 6A3HA 4ZQCA 4PUJA 9XIMA 2Z00A 4JNZA 1XPGA 1AH0A 2ZZ1A 1G67A 2V38A 3ARYA 4BJHA 1S5MA 3V5OA 3DG3A 2J25A 1EC9A 1TV8A 1FCBA 4DYJA 3QGVA 3B4YA 1G69A 2PLCA 3SADA 3XIMA 5GPRA 4XBKA 3N4FA 1VB9A 3BOXA 1QPKA 1LCOA 3A3WA 3EOUA 3SN1A 3FIGA 3M0XA 1W1A1 3LM7A 4UCFA 4DRSA 4B2DA 1HJSA 2JE8A 3U2CA 1OC5A 4RL3A 4QDPA 4O13A 1Q45A 3H7RA 1OVDA 3W00A 1I2NA 4WKHA 4ZOCA 2ZRVA 3RLUA 1OGBA 2ZBTA 1IEVA 1NFBA 5F4WA 1FWAC 2R91A 1F9CA 1E3XA 4WCJA 3U48A 2ZA3A 2OSXA 1LRNA 3CQIA 3VPLA 2DT0A 1W9DM 1YTEA 1U5HA 4NI3A 2HXUA 5GJPA 3KVLA 5FEZA 4H9ZA 3GS6A 1GVRA 2YFNA 3N2BA 3OTRA 3KBMA 4C60A 1EDQA 5H8UA 3EWXA 3TIMA 3MVTA 4HCDA 5I77A 4FI4A 1DE5A 3O3RA 3ZLFA 2PDQA 3A6OA 3A4XA 2XSXA 3KHDA 3B8WA 4RXFA 1ZBCA 1YXDA 4DJEA 3BURA 3MCMA 3WFLA 3NCOA 3UYIA 3KX6A 2GUBA 2GQAA 2OPJA 2VVNA 1HT6A 5A6KA 4ZXOA 5IHSA 2G3FA 2DZXA 1XIJA 4LRSA 1BTMA 7PTDA 3IAPA 4E8GA 3LV5A 3NZQA 2IXVA 1PPIA 2RHGA 3MI3A 5IOBA 1BWVA 3ALGA 1AQ0A 1I9CB 3WQFA 3THDA 1FHVA 1H7RA 3VTRA 3Q4DA 1N55A 3VZZA 3OLEA 5EMJA 4XZBA 4N9EA 1RHCA 4IM4A 1S3HA 2Z6JA 3VIOA 3LHWA 3E2RA 3AYSA 4WGHA 5ABTA 2OZ0A 4IIDA 3UCDA 2PTXA 1PXGA 4YYFA 4KEVA 2NVAA 2VNCA 1CLVA 1X1OA 1EF2A 3TQVA 4IMAA 1O94A 2ZUUA 3ZWSA 1QPOA 3BW4A 4XD4A 5I79A 3C0SA 1F8MA 1T6MA 1EZWA 4O1EA 3PC0A 3NURA 4J3UA 1ZB5A 3IGUA 1EUNA 1IWPA 1IWBA 1UPPA 2Y7EA 2YZRA 3UCCA 5A6BA 4REQA 4KGLA 2NSOA 3D46A 1GW9A 2DDXA 1QPQA 4PE8A 3UFYA 1JRCA 1XFBA 3P82A 1K8XA 3CZ8A 4DBDA 4CQBA 5CZTA 1O5KA 2AAMA 4E0CA 3UR2A 3I65A 4F3HA 1DWIM 5D8WA 2OZ3A 1B3XA 3UJRA 1PCWA 3FK4A 1UWSA 1VHCA 2AQOA 4IQJA 1IHIA 3T2OA 3H4XA 4PUNA 1U33A 3AXMA 4IFKA 3TK7A 3L66A 3SQMA 2WLYA 4OBTA 1DHKA 4UFLA 4JTJA 2GVJA 3HJZA 1LLOA 3TFCA 3ME3A 4ZMGA 2QIWA 4C7FA 1FQ0A 4K2SA 2GSJA 3W7DA 2E28A 3S8HA 1Y65A 3SQLA 3TYCA 2YR1A 4C7DA 4I8DA 2CZDA 2DU2A 3LZ3A 1ISXA 4IFKB 1LOSA 4IGMA 3LZ5A 2GWNA 1P5BA 3B04A 1X39A 2CERA 3HOJA 4MWAB 2XGIA 4JIEA 2W67A 3LX9A 1OYBA 5FJUA 3T4CA 1EQPA 4GUIA 3BAIA 3QC3A 2E9BA 3XINA 5LIWX 2W91A 4FX8A 5DO8A 4LYPA 1PIFA 4EAMA 3R0DA 3H7VA 3NSXA 5ABEA 3R2GA 3DFTA 1QNVA 2QHAA 1E9YB 3M07A 1CLKA 3S42A 1VRDA 3Q2DA 1KKOA 4TQTA 1F5ZA 3OIXA 4MADA 4K8GA 3CMFA 5MHBA 3BGGA 2PU1A 4DJEC 3N2OA 3N29A 4QG9A 2W4XA 3UWVA 1ITQA 3SCUA 1OT1A 2AMGA 1E4IA 5EFFA 2GGGA 1GONA 4QCEA 2CITA 4Q4SA 2IKGA 1MFUA 3SIZA 4N6EA 4UR7A 1VIZA 3APGA 3CQKA 1OGGA 1XJBA 1J6PA 2QCGA 4JHMA 4W85A 3WQGA 4L65A 4TO8A 1QTWA 4XTDA 1UR4A 2VGIA 1CGXA 3LERA 1FWSA 1CGWA 4RZ4A 2TYSA 2OT1A 1GWJA 1GVSA 4QRNA 3LV6A 1SSDA 2CHNA 2ISVA 1W8SA 3CUZA 3N25A 3Q45A 2RDXA 3AFBA 1FDYA 4AB4A 1FX6A 4S38A 4O50A 3VIJA 3P7YA 5BXRA 4MHBA 2XGZA 5LHEA 3MO4A 3EA3A 3IGHX 1WZMA 2MANA 2DIEA 1YDVA 1I8JA 1Q6GA 4ZO7A 3W87A 4MLRA 4I6VA 2EAWA 1MW3A 1GVYA 1MNSA 3QTGA 8TIMA 5H91A 3PPGA 3CYJA 3QSRA 3URQA 3NZGA 4JIPA 4PCPA 3WDPP 3PTDA 3SY8A 4ZE4A 4NKCA 4JIHA 2FIQA 4J3VA 1W1B1 4ZENA 3GNXA 5EL1A 3M64A 3AO0A 3RMJA 4BQ2A 3BLDA 1ELSA 1ADDA 4O10A 2PTWA 2Y70A 1VPXA 2R82A 1FP8A 3RCYA 1OCNA 4I9TA 4L1XA 3ID7A 3PUGA 3V35A 2DVTA 3VNKA 4P8VA 2WVVA 4HOWA 3KHJA 3M5VA 2EPNA 3IUIA 2C3ZA 3N2TA 3TTYA 1F61A 3OPSA 1B57A 5LXXA 2I5GA 4M7SA 3I3DA 3N3TA 3PBUA 2Z2BA 1JDCA 4ALDA 4QG8A 1S39A 3KRZA 4MPQA 3AJXA 4GYPA 3C5QA 3R8RA 3WLIA 4B3ZA 3PUOA 3G3DA 4AUBA 3O7UA 1E40A 2EEXA 4MNKA 1IR2A 4PMXA 3W7HA 4AU0A 2WZTA 3V0TA 4HKPA 5BXTA 2ALRA 5AHEA 2ACSA 1JCNA 2WCGA 3M0LA 4JHOA 4JTHA 1Y0EA 3NPXA 2AOSA 4JY8A 3REQB 3E5PA 4O4VA 4X2PA 3KS5A 3VI2A 1EC7A 1JPMA 4QDWA 3WMLA 8RUCA 3WUFA 3VKKA 3O05A 2PDGA 2JIWA 3VDGA 4R85A 3ZLGA 2D1ZA 2CLKA 2Y2WA 3KL5A 4JQ2A 1UC5A 3W27A 4LVBA 4MOZA 4GC3A 1FTXA 1NOWA 1Z69A 2G4FA 2GVLA 4EP8C 1W31A 5HINA 4Y9OA 1XRFA 4NJKA 1SM9A 2PWFA 4DPPA 2R6OA 7REQB 1TPEA 4GI9A 3LENA 1M9HA 1XHGA 5M5DA 3W82A 1UASA 5ABGA 5REQA 4ORMA 1D9EA 4P7LA 4HHPA 1FWJC 5HANA 2RKXA 3W7RA 3UPBA 4GPNA 2WHMA 3NEVA 1Q85A 1BTCA 3GFYA 8XIAA 3NEHA 1RY8A 4DAFA 1QNOA 3VIMA 1TE1A 4YPJA 3DXIA 2JEQA 2YXOA 5BW6A 1FXQA 3WQ6A 4JCMA 4DF2A 3GDTA 4ATLA 2QV5A 4PFHA 2IKIA 3C6CA 2BODX 3BSMA 1Q8AA 4J3SA 1HO1A 1R0MA 1S5VA 4AG0A 2DSZA 1KXVA 4NZCA 1QT1A 3VIKA 3HJEA 3T4WA 3CIWA 4HD5A 1DXIA 3TYDA 4J2MA 3B3DA 3WLQA 4NXKA 3AJ7A 2XIJA 3T0BA 4G56A 4I9JA 3H2MA 3C3NA 5D2WA 2YA0A 3SIMA 1EWEA 4C65A 5DY2A 3F5JA 4E4UA 3QMSA 2TAAA 4WRHA 4IH3A 3GWQA 3VNDA 4I5RA 5AHLA 2CLPA 4IX2A 3HPSA 4JTQA 4C5YA 4PMDA 3S1XA 4D72A 2RJHA 3AXHA 1KCKA 2HISA 3W1PA 1OB0A 4BA0A 1K1DA 3SRKA 1VBJA 3F2BA 4QNWA 5HQEA 1A5NC 3LOTA 1UJPA 4H7VA 1DXEA 3AS3A 4NZ1A 1SZNA 3EOSA 3WBAA 3R11A 2VUYA 4BQ5A 3VZXA 3WDJA 5AZ0A 2R94A 1B3ZA 1Y7VA 1Z89A 5FF3A 1XISA 3P60A 2VFDA 3WO8A 2OGJA 3U2OA 4JFWA 4RCXA 2WVVB 3QTPA 1FA2A 1UUMA 3FDKA 4MSSA 3GW0A 3CWNA 3AS1A 4GKTA 2J8GA 1Q13A 1KB3A 4PMVA 1Q2RA 3GIPA 4IG2B 3G1XA 4K7YA 1QRQA 2ZZ7A 3MUY1 2ZKMX 2HVOA 1AODA 1S38A 5CZ0A 4AX6A 1TR9A 4UQ9A 1UH2A 4HOZA 3JZUA 1JCJA 4PRRA 1J5SA 3W22A 1TJ0A 2DH3A 1BHGA 3LPPA 2D3NA 2ZRYA 1R5YA 2D2OA 3IIZA 2BY3A 5C2GA 4A3HA 1NQ6A 4S3DA 1ICPA 1ADSA 3L4WA 3VOIA 1V77A 2AGTA 1KM1A 1V3MA 3HG2A 1DIEA 3SRDA 3KUMA 4ASTA 2VMFA 3AHVA 2Z1XA 2IKHA 3R6IA 3ZR5A 3QSTA 3M1ZA 4WSKA 1UROA 3BAKA 3TZNA 1VAHA 1E5NA 1LG2A 1RR2A 5A6MA 2EG8A 2ISDA 3HQ1A 3MP4A 1GTEA 1IV8A 5HNUA 3IUDA 3M0KA 4J2PA 1UKTA 2B81A 4MKNA 3ITOA 3S5YA 3SCRA 1OM0A 3WQOA 4CVWA 4EACA 5FF4A 1FCUA 3VMNA 1CCWB 2REQA 3GXPA 1KR0A 3L2LA 1LL6A 3UWQA 1TREA 1BEUA 1HW6A 3MS8A 3WQCA 3VA8A 2H9AB 3KBJA 3VGGA 2VFIA 4Q8MA 3CMGA 2QCFA 1LORA 1CB7B 3MUAA 4D8ZA 2XFWA 3H23A 3MY9A 9RUBA 3JW7A 1I1WA 2BDQA 3HN3A 2VCBA 5FIPA 4KWSA 3WBWA 3UT0A 5TF0A 4RLIA 3M0MA 4FXRA 2V5CA 4F0KA 3GNDA 2GK1B 4C6IA 1ML1A 3STCA 1QWGA 2PDWA 4I90A 2W62A 3BE7A 4XO7A 2FZBA 4GXMA 4A3UA 2QJGA 3VU2A 1HP4A 3TR9A 1KCXA 3N2XA 3COTA 3UEQA 4ENLA 4PN2A 1EGMA 1UD4A 3KP1A 3ZT6A 1SZRA 1XG3A 3TTOA 3P0XA 2Z26A 3SCVA 4LS0A 3BMWA 2OZ8A 2GQ8A 3WH7A 5J5RA 5JIWA 4Z1BA 4A8NA 3DKLA 4NAEA 4UTHA 1N8IA 4MDPA 4L6DA 2WMIA 1MNZA 3IIXA 3CZGA 4G7EA 5KTLA 4BQ4A 4PBFA 1R3WA 3W83A 3DI0A 1W1TA 3IGSA 3EKLA 4W9TA 1MEHA 2D73A 1FWCC 3VDCA 3K8KA 5CH9A 3DFHA 3JU2A 4DXVA 3WIJA 1ZAHA 1UCWA 1JCYA 4GLEA 4NNBA 3E0WA 3OQEA 3W81A 2NX3A 1TA3A 5A6AA 1Q4WA 3CYVA 1WOAA 1KM4A 5BYWA 2YGYA 3VNLA 3TYZA 4QE1A 2RUSA 1VCFA 4IG2A 3IJ7A 1FH8A 1DVJA 5FEXA 5EY5A 4GJIA 2WSRA 3U2EA 2DZWA 4FALA 1FWRA 5I3JA 3C8NA 2F9RA 4PMQA 3ZWTA 4R7WA 1B54A 2J7HA 4PEKA 3WJWA 3QGAC 4UFHA 2OGYA 1US0A 2C7FA 1IGWA 1V6WA 2G3JA 1N8WA 2VI0A 3B0VC 1TZZA 4REQB 3T78A 2GQ9A 4GXPA 2ASHA 3RAOA 3A9IA 1DHPA 2OU4A 1O7AA 3VKJA 4GQBA 5CZJA 3M0VA 1QMLA 3DN5A 1JPHA 1KCLA 1HKIA 5CG0A 1NP2A 4LC6A 4AYSA 4DLFA 1TVLA 3LGGA 3W6YA 5I00A 1E6SM 1N2VA 3A3XA 4A35A 1E1CB 3S6TA 4JX6A 4WQ6A 1MUCA 5AY7A 1XICA 2POZA 4EX4A 3CUJA 4IJCA 1VFSA 3VX0A 3NO3A 4NRRA 1UQZA 1CX9A 4QFUA 4DO5A 4XUYA 1GVIA 3MUCA 4DZIA 2VL4A 3G1SA 1QU4A 3KOXA 3BXWA 1XC6A 3VINA 4KWWA 5RUBA 4YCOA 1CXHA 3TDFA 4QEEA 2A1YA 4A22A 4L1GA 2WXDM 3LM3A 5BNKA 4HJFA 3TUUA 3VNZA 1GW1A 2VDIA 2VR5A 1TJ1A 1G4PA 4LCRA 2D69A 3AZSA 3ZMRA 1GVEA 5AOUA 4MNJA 4NI8A 3A4AA 2V3EA 5F2LA 2AGKA 2DFAA 4S3EA 3QGKC 2VOMA 3HGOA 2CZFA 4OKDA 3T2QA 2NVDA 4I5XA 2DSKA 4H2CA 3AAMA 2VJXA 1A5MC 2ZUWA 1BRLB 4CN1A 3NQMA 1B0IA 1ISVA 1JZ6A 3K2GA 4H41A 1OD0A 3EXSA 3GAYA 4UTIA 1H5VA 5BMWA 3L9CA 4PR4A 2A7RA 4GYKA 2YIHA 3F4NA 3UG8A 1US2A 3NQBA 4DO4A 4HMNA 3SQSA 2CEQA 2DSWA 1XWYA 2Z27A 4JFSA 5AKQA 1J93A 3QY7A 1QI0A 1EYWA 1WUFA 1QOXA 1DP0A 3C0JA 1WUEA 1K77A 3USZA 4Z2LA 2FZ9A 3S9IA 2VGBA 2E1WA 3HQPA 1PX3A 2LLEA 1MZHA 2PEVA 5CCZA 1I6NA 2YSWA 2OO6A 2QF7A 1XYFA 3GBEA 1UZ4A 2VEMA 4C6LA 4Q7BA 1EZ2A 1HF6A 4O52A 2ZUMA 5DLCA 3TW9A 4EANA 3UA4A 4I7VA 2YXXA 3RPDA 4TUFA 3FFSA 1OY0A 3LXBA 1XYBA 2WNQA 1AMKA 5D33A 1RBAA 2QCHA 3WF2A 1NJJA 4D9PA 1H0IA 1C92A 3UJ2A 3LCLA 2E5BA 2XU2A 3QKEA 4V1YA 4E2DA 2VX6A 3EDKA 1YPIA 4S3AA 1IXNA 1HXJA 4F8XA 1UP2A 3NQGA 5LHFA 4GZ7A 1F4AA 2NQLA 2R1LA 1NFGA 5DBTA 1D2KA 3GFXA 4ACZA 4ZE5A 2FPYA 5G1MA 2ZTKA 2YZ5A 3W02A 3CAQA 3N6QA 4H9MA 5BRQA 2AL2B 1EKOA 1PZ0A 1L0PA 3WKZA 1GQIA 1UKQA 3P3BA 4O12A 5CC3A 4U3CA 3W7IA 3HGSA 1I4NA 5ECVA 3E1F1 4B90A 1E6PA 2GSHA 3R8HA 4KIEA 3ABXA 1VPQA 1TA3B 3RX4A 4S39A 1KBJA 2FFCA 4WKFA 1D7KA 3CH0A 1WDDA 3VGFA 4RDYA 1R9ZA 3MT1A 3WFAA 1UMYA 4RR4A 3O2LA 4HSHA 1PZ1A 3OGSA 1Q8JA 2XN2A 3BMXA 1JZ4A 4PL2A 3AWOA 2PMQA 1TX0A 3D3AA 2I5QA 4EXQA 3I4KA 1EF3A 1UD5A 1Z6KA 5LGZA 1V08A 1VZWA 3EX2A 4L56A 4JYEA 3ZFHA 1Q66A 4GUJA 2TMDA 5AB3A 5HMDA 4J3XA 3ABZA 1JUEA 2BTMA 1RVGA 4O11A 3OVQA 2F8QA 5A5WA 2PDNA 2ZC8A 4WX2A 2PDJA 2DJLA 4CD8A 2A7PA 1EWDA 3WJYA 3NA8A 3UF9A 2V5KA 3VIIA 5I02A 4HMEA 1HUVA 1CT5A 1G94A 1O4UA 3BG9A 1PIGA 1K4GA 4LSBA 3W1NA 3CZLA 4E4FA 2O56A 5LIXX 5KMYA 4RE4A 1DIDA 1RQHA 5D05A 3QFWA 4O8AA 1GVQA 3RPTA 4E8CA 4YNGA 1OABA 4O4WA 1Q4NX 4NYYA 3IVSA 3UZXA 4IX0A 5G2IA 3KM8A 1M7PA 2PDLA 1TV4A 1UKSA 3WEZA