1V93A

5,10-methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
292
structure length
292
Chain Sequence
b'MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-Methylenetetrahydrofolate reductase
publication title Crystal Structure of 5,10-Methylenetetrahydrofolate reductase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 112
structure length 292
sequence length 292
ec nomenclature ec 1.7.99.5: Transferred entry: 1.5.1.20.
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1v93A00
4JNYA 1TJ1A 3APYA 1TJ0A 1ZRQA 2FZNA 1ZP3A 2FZMA 3APTA 1ZPTA 3E2QA 1TIWA 3FSTA 1ZP4A 1TJ2A 3IJDA 3ITGA 1B5TA 4O8AA 3FSUA 1V93A 3E2RA 2FMNA 3E2SA 2FMOA 4JNZA
chains in the Genus database with same CATH superfamily
2VVSA 4H41A 1L6SA 4M0XA 1FWCC 4FALA 3BW2A 3G1FA 3LB0A 1PZ0A 3VNLA 3IIPA 4DWSD 3DXIA 4Q8UA 2DSKA 2CCRA 4V27A 3CUZA 4AUBA 1LRTA 3AIWA 1ECEA 5K7JA 1A0DA 1L6FA 3F7JA 2QXWA 4JR5A 4E8DA 3GXDA 1OC6A 3GTXA 3MSYA 1LTDA 4FLQA 4I7WA 4NP7A 4AEEA 3HBLA 4PGLA 4GIEA 3PG8A 1D8CA 5I3GA 4HNUA 1E1EA 1MQQA 1VCGA 5M03A 1O5QA 4NYUA 4EPKA 2XH4A 2FYMA 3EGJA 5EFFA 4IIEA 1TREA 1BEUA 2HZGA 3W7JA 3HPFA 1YE4A 3LM3A 5FI8A 4JL1A 2FZ8A 3O2LA 3NL3A 3SAZA 4WSKA 4IISA 3E2SA 1BD0A 2WHMA 2D2OA 4OVXA 3WNLA 5L9FA 1VENA 3H23A 1W1ZA 3IANA 1CENA 3O7UA 2NW0A 3WBYA 3EA2A 3PBGA 4DXXA 5AYZA 3CO8A 3TYDA 1E0TA 3NL6A 5D2YA 1SR0A 4OTKA 2B7NA 3SUTA 3REQB 3LCIA 4FO4A 4Q4QA 1Q6FA 1XG4A 4F3HA 3NQAA 3DOPA 4FSAA 4H7VA 3BW3A 4OU1A 3MB9A 4OFCA 1TWIA 4WY0B 1B31A 3G0UA 1SYTA 4ALDA 1QPQA 3FX4A 3WNMA 1FX6A 2I7GA 2ZADA 1A53A 2C16A 1AMYA 4A6GA 1E6RA 3DUGA 4REQA 4IL0A 4PB5A 3IGSA 2WKLA 3BTNA 3T05A 4FXJA 3TN4A 1JCYA 3TMLA 4IG2A 1HP4A 2HNHA 3NA8A 3S1UA 5CGTA 3W07A 3M0VA 4Q8PA 2RHGA 1DIEA 4KFOA 3D0CA 4YVVA 4IP5A 4NZFA 3H53A 3FA4A 4ZTXA 3KTCA 4HPHA 2CFFA 4H6QA 4JBRA 5H8UA 3WUEA 1M68A 4S3KA 1CBGA 2YW4A 1X1OA 1TWSA 3V35A 4V28A 3KLLA 4W7UA 2PDWA 4QLKA 2NVAA 4U5IA 3RM9A 1RY0A 3CQIA 3Q4DA 5JUVA 1CIUA 5B7ZA 2B7OA 1LT8A 4H9TA 1DJIA 1W32A 1E6PA 2WVVB 3EKGA 2D0FA 3CC1A 3CUJA 2VZTA 1HQTA 1P43A 4JOMA 1W5NA 3H12A 3WL0A 5G2IA 2TPSA 3AWOA 1UBSA 2DUXA 4RCXA 1HJWA 3VCCA 1H7PA 3LPFA 1OEPA 3UPMA 1FHDA 3M0KA 2V9DA 1OWQA 1ECQA 3RMJA 1E4IA 2ZWYA 2ISVA 3E96A 3GLCA 5AHIA 2C7FA 5FF0A 4CD8A 3UXIA 3DFQA 4Q8OA 2WHLA 2VX4A 4R27A 3VOHA 3P67A 1IYXA 1ML1A 3U8GA 3NUKA 3QF0A 2WSYA 1OFAA 2C0AA 1D3HA 1W9DM 2WMKA 2ZZ7A 4D71A 1EUAA 1XCWA 2P0IA 3LCHA 2BY1A 1WZKA 1HL9A 1AJZA 4TTGA 3B4YA 3W02A 1RY8A 5M5DA 1GTEA 4LB3A 2CLHA 1UR0A 2ZRUA 2WANA 4FMVA 4DELA 3H2FA 1PZ2A 3WJXA 4G8TA 4UFHA 3W1TA 4L5ZA 3ARPA 2Q8ZA 2AQWA 1OCQA 1H5YA 1KCZA 3TDFA 3T09A 3KL3A 4GXPA 2VJXA 3OVQA 3N25A 3PWIA 3OIXA 3AMKA 1ISXA 3NM3A 3TWBA 1YTEA 3NM1A 6TAAA 4FOUA 3WDJA 5FEZA 1J93A 3VIMA 4D1JA 1S1PA 1KFBA 3T7VA 3GDKA 1I4NA 2FIQA 4GIYA 2OEKA 2YYUA 2D2GA 2WC4A 4UQEA 4REQB 4UTJA 4B3ZA 1QASA 2Z4GA 4UZUA 1W5PA 1R30A 3CEPA 4KCVA 4AZ7A 4QCEA 1XLFA 2Y5EA 3LS9A 5I0DA 5LNRA 4IG2B 2X8RA 1HN1A 3CEUA 5REQA 5EYWA 4JYDA 2BY2A 3O16A 3TV8A 4DBSA 1K8ZA 4R9XA 3WMSA 4CU6A 5D05A 3BUVA 4PTVA 3WLIA 4WLCA 3GW0A 4DNHA 4QFUA 5KSWA 1MVYA 4I6VA 4Q7NA 2W66A 1TR1A 4Q4SA 1OF6A 2ZRYA 5EY5A 1S2UA 4B3KA 1JQVA 1VJIA 1CDGA 4BF9A 4X3ZA 3HOJA 4HP5A 3NURA 5LGXA 1K4HA 1XI3A 3OB8A 3UWWA 3W7KA 3MUXA 3GG0A 4BCEA 4KW2A 1FWNA 3WX7A 4B5TA 1KR0A 3ARTA 4AQLA 2JGQA 1LG2A 3E74A 3A47A 5I79A 2XN2A 2VX5A 1SR9A 1P4CA 2E8ZA 4PRTA 1GJUA 3STPA 3NVTA 1B2YA 1C3FA 4UNKA 1XLKA 1WXYA 1VPYA 1XUZA 3N2XA 4PUWA 4DRSA 4N42A 4PR4A 3I7QA 1RCXB 4YHEA 2BXYA 3LDVA 4Y9NA 1CXEA 3LRMA 1WAUA 2PP1A 1WA3A 4O8AA 5CC7A 3WNKA 4PBFA 1UKPA 2JKPA 1BPLB 5C6MA 1UR2A 3VM7A 1KXVA 3IVUA 3ORWA 5LIYX 4GQ0A 1OGGA 3CWOX 1DXIA 2P50A 3K30A 3MPGA 2DQWA 3DGBA 4PBEA 2P3EA 1XC6A 1SO5A 1R2RA 2AQVA 3W2NA 1N8FA 3DG6A 4C6EA 1XPGA 5FSDC 1S2CA 1OG0A 4XWUA 3SGGA 3L5LA 1P0NA 1JF6A 1H09A 1SO3A 4ZGYA 2PLKA 4QNEA 3NVDA 5KTLA 3QR1A 3WLNA 2PDYA 3E02A 3IGXA 1AG1O 2V2DA 3AO0A 4E3TA 5LA2A 4D8LA 1NH6A 1SZEA 3T2OA 2F6UA 3N15A 3DHPA 2Q01A 5AECA 2W0UA 3TP4A 2VX6A 4ZMGA 3DENA 1N8WA 3C2EA 2QDGA 4K2SA 1X97A 2F8QA 3IS4A 3W84A 4XZ9A 1D3GA 2O9TA 3THUA 4B5XA 1V02A 2DJXA 3NDZA 2BGQA 5E70A 1KGUA 2W9MA 1S2WA 3VZXA 4AYSA 4H9YA 5HMDA 1GVOA 3ARUA 5ABEA 2E6AA 4ADSA 3G1YA 1YDNA 3SCSA 2XVPA 1M3UA 2WPBA 2X30A 3STEA 1HTIA 4XIAA 4XD3A 1IWAA 1Q6LA 3GNOA 5REQB 5MKGA 1KA9F 1FHLA 3GO2A 3G2GA 2PDFA 1OCBA 1V6YA 1TWWA 3OLGA 2PI6A 3ZR6A 1SMDA 1JULA 1A47A 2WSKA 1KM5A 1V51A 1OFDA 3GUGA 4NAEA 3E38A 4J2PA 1PWMA 2X09A 3KP0A 3V1HA 1UQZA 1TWZA 3M0LA 4M1BA 4Y9MA 3UW6A 3EWUA 4Z2IA 2OYMA 4X22A 1T8XA 4B91A 1W3KA 1XSJA 3ID7A 8CGTA 4DWDA 2J62A 2DIKA 2D22A 1OZQA 4DJFA 3BLPX 5FF4A 1RK6A 3CZ8A 5EMYA 4U4MA 3W87A 2RDWA 3HQNA 4AEFA 1DQUA 3S6DA 1MFUA 3EDKA 3BDKA 5EFDA 1ZAIA 4J3WA 4BHYA 4IFRA 4RXFA 3OBEA 3S4TA 4IPIA 3LSCA 3P5ZA 3POCA 5BU6A 2D0HA 2R1PA 1WX0A 2VEKA 5LNWA 3APYA 3PUEA 3ARXA 4AY7A 1EXPA 3V16A 1F4HA 2QF8A 2A3CA 1ZU8A 3B8DA 1JPMA 1VH7A 3UCQA 1KD0A 2WWDA 4UR9A 1NP0A 1TCDA 3SCUA 4DVOA 4XUYA 4L1GA 1MW2A 3LG3A 4NYYA 4G56A 3F4WA 3CL8A 2G0WA 5SWUA 3OG3A 5A6TC 4YNGA 1FVPA 4JN8A 1F3WA 1DXEA 5JBFA 3H2NA 4EAMA 1QVBA 3B3DA 2J7CA 2WKGA 5BMWA 2ALRA 1RQEA 4ORIA 2OCZA 4PFHA 3T0BA 2PTXA 3MU7A 4BQ4A 1P48A 2HROA 2J4GA 4QAWA 3CZKA 3W7MA 5DO8A 4OKDA 2H8XA 3VDGA 1JG9A 1GPWA 3RG6A 3WNPA 3MHUA 1NFGA 2CLKA 1NSJA 4KGLA 1X8CA 1LP6A 1S1RA 3PNZA 1EF2A 3TYBA 3RITA 1GYNA 1ZZMA 3QY7A 3GVGA 1R7AA 3LERA 1PSCA 2QQ6A 2Y7DA 1T40A 1RPXA 4J35A 1BHGA 1QTWA 4GOAA 5HMEA 2V2HA 4IP7A 2TODA 2Y4SA 3GNNA 3V0SA 2ZRVA 4GYKA 2QCMA 3ENLA 1AD1A 1DE6A 1X38A 3E0WA 1RAKA 2MNRA 4NXSA 5G2HA 4XSMA 4XZHA 1Y5VA 4OOZA 3WF1A 1E72M 3CT2A 1XRSA 3H2OA 4O1CA 4M82A 1K77A 4S23A 1KXQA 2Q3OA 1J8VA 1J5SA 4TMCA 2FH8A 1Z42A 1F6KA 5MKGB 3GAKA 1FXPA 3VDAA 4S2CA 4IGSA 3OLIA 4EIVA 3G0SA 3OYXA 5EA9A 4W89A 1PE1A 4QE5A 3VCRA 4MPKA 4NAEB 3KRBA 3TZFA 1JZ2A 3ARZA 5AHFA 3M47A 3TONA 3UYIA 1CXHA 2DZSA 1E1FA 4XZNX 3DI0A 3WH7A 2X1RA 3CL7A 4D6CA 2JIEA 4EPEC 2QVHA 2XU2A 3OJGA 1A4MA 3DFSA 4UQBA 3P2VA 1VS1A 2ZRXA 5F1UA 2NUWA 4GI4A 1G4SA 4JTSA 3BW4A 4J5NA 3AXKA 4IHCA 2RDTA 1UD4A 2OG9A 3LBOA 4I9MA 1P5BA 1H61A 4AD0A 3CAQA 4GXMA 2RKXA 4QSFA 4IXXA 1RBOB 2DIEA 3S83A 3M6DA 1BYAA 2IKHA 4GZEA 4M5PA 1DIOA 4IJBA 3PC0A 5AHLA 1IQ8A 1IHIA 5EBAA 3RHGA 1UD6A 1ITUA 2DVXA 3ARSA 1F2JA 3I7SA 5A3HA 2YFNA 5CKSA 1WQ5A 2FPVA 2OSWA 3PR2A 3VE9A 2Z29A 2X2GA 4C6CA 3M16A 1VLIA 4K8EA 3I3EA 1KFJA 3T42A 1Z3NA 4LT9A 3Q45A 2WVSA 2ZX8A 4ATLA 3LD5A 2UZ9A 4ZR8A 2WOQA 4O57A 7TAAA 5I78A 1XLHA 4LCSA 1IF2A 2O4QA 3N6HA 3R89A 1P6BA 1W17A 1Q3NA 3LENA 5CPSA 1VGAA 1L6YA 3URQA 4JTTA 3B8VA 1ZP3A 3C5QA 5ABHA 2YCLA 3FJ6A 1B30A 1E0VA 2B7PA 3DG7A 4O10A 4CQAA 1V0MA 1BTCA 1DPMA 4QP0A 1U5VA 3S6OA 5BZAA 4BFAA 3RJYA 3HJEA 2O7QA 3TJXA 4AY8A 3SUVA 2CKRA 1B90A 2Q71A 1F7BA 4M6VA 1GGOA 1D3CA 1KM2A 3UZ5A 1CLXA 3AFBA 3VMPA 3PTQA 5HQLA 2PDPA 1TPDA 3SZ8A 3IUHA 1EWDA 2WCGA 3CQJA 4IGHA 4N2YA 3TA6A 4HT3A 4UQDA 1CLVA 4FP1A 3PSWA 1OCNA 1TJ2A 5I00A 3EAUA 1FQ0A 4FNQA 1NWUA 2GQ8A 1XBVA 4WGXA 1XC4A 4HU0A 5D38A 2FPYA 1LLZA 3W1MA 2J74A 1NFBA 2HPMA 4O1EA 1E70M 1W3JA 2ADAA 2E9LA 2O7SA 4JEJA 2X05A 1Y8BA 4US5A 1L8NA 4LTSA 3P3BA 5A1AA 4MB5A 1YPXA 2BDQA 4XBSA 2WMJA 1EJ7L 2AL1A 4ERGA 4H4IA 2NSOA 1FA2A 2XH7A 5G4HC 3SGUA 4XZLX 2FTWA 1UUOA 3WSUA 4M7TA 4D6HA 5LNUA 1YDVA 3R5EA 2YYTA 3RNDA 1I9CB 4WD0A 1H7RA 5AVHA 5I3HA 6A3HA 4EAYA 1XSKA 5D2WA 3VVGA 1UWTA 1GOOA 2IQ0A 3U7BA 4BK9A 4ERAA 4MLJA 3SCOA 3LQGA 3FCPA 4KEMA 4QJ4B 4FX8A 2H3DA 1LLWA 4HHLA 1YEYA 1YPIA 4M3PA 1WCGA 3NZRA 1QCWA 1YKWA 4H9ZA 3ITYA 1WB0A 3O8AA 3TC7A 3HG5A 4HMEA 3B0YA 4ZXLA 1XV8A 5TF0A 5L6UA 1US3A 2VFIA 4NZ1A 1X8FA 1L2QA 4V1XA 4XAGA 3BCFA 4NX0A 1R0MA 3UJSA 1XLMA 4DBDA 2PLJA 4L1WA 3TX9A 2J7BA 4A05A 2E6YA 5ECUA 3W4RA 5BMXA 1TV4A 5KZDA 2IXUA 4J3ZA 4GZJA 1ADDA 3N9KA 5GJPA 1C7SA 1Q2RA 1GEHA 3KRZA 3KS6A 4I90A 4UTTC 4DBWA 1V3MA 2OJPA 1S38A 1MW3A 2QW5A 1DWHM 3P81A 4C90A 3OVGA 4S2BA 5M1TA 2ZFAA 4LAOA 2WHKA 4S3EA 3RPTA 1ZBCA 2YCLB 3N3TA 3NO1A 3OYZA 4NHVA 3SR7A 5HDRA 3T6CA 3V0UA 2V3GA 1MDLA 4LU0A 1Q4NX 1Q6DA 3T0DA 5DCEA 3AYTA 4NKCA 1IWPA 4ZVJA 1EA9C 5I7GA 5T9CE 2OZ3A 1GJPA 3EDEA 1U5JA 1XLBA 3NWRA 1FKXA 3IAPA 5H8PA 3ECQA 5B80A 3L4TA 3R13A 2OOGA 1DQXA 4D6DA 3WFLA 4B5SA 3W1LA 2O56A 3ZXWA 3M64A 1AFSA 5CPOA 1ISZA 4J9JA 3IGUA 3CUXA 4XBKA 1H1YA 2WZEA 3WG6A 1V77A 3W7OA 2ZC1A 1E0WA 3WEZA 4ZZ9A 1CGWA 4AHPA 2PWHA 1SO4A 2ZUVA 2FFIA 1F6PA 4YTRA 3PUDA 1REQA 4UQAA 1UWRA 1W0MA 2OODA 3RF9A 1WE5A 2ZA1A 1DEDA 2I57A 3MCOA 3E5PA 1U1JA 4JTHA 2NVDA 2R91A 4Z42C 1GQLA 4WGHA 5H6HA 4HMCA 1OT1A 4UNLA 4JHZA 4AZBA 4DIAA 3WF3A 3VD4A 3C0JA 2HBXA 2J9XA 1DE5A 1EOKA 1J0IA 2Y1HA 4ZB0A 1UOKA 3VIGA 2TYSA 2XGBA 3S2JA 1IT0A 1EBHA 2A3BA 2GGHA 2A3HA 4F9DA 4H9UA 2BXVA 1UPMB 3FSTA 2I5IA 1HJQA 2DUAA 2JQXA 4J27A 1BSIA 3TN3A 3VNJA 1D8WA 4IMGA 1J0ZA 4IMDA 1Q13A 3AS2A 2W6RA 2DORA 5F4WA 2CLEA 1TX2A 1A50A 1TIMA 3PUOA 2XISA 3CQ0A 4KS0A 1VAHA 1NF7A 1POJA 3N13A 3TLQA 3WQGA 1YXDA 1EYWA 1UA7A 1OZMA 3PTKA 5LXXA 1FH7A 4ACZA 1E6XM 3ZJKA 1IXQA 4DY1A 3T0TA 4KGJA 3LHYA 4J4KA 4A3QA 3DFYA 4O54A 3K13A 1OFRA 2YA0A 1KB3A 1W3HA 1YE6A 1UQYA 4AZ6A 3AIBA 3EA3A 4US5D 3R8GA 5JU6A 5DFAA 5CH9A 1M7JA 4LB4A 1N82A 3W23A 1PKLA 2ACQA 1TJ0A 2AL2A 4DZ5A 4YMZA 1FUYA 1TTQA 1W2PA 2GQAA 4LC8A 4Q33A 3EX3A 1QHZA 1NOWA 1XCFA 2MUCA 2XIJA 4TIMA 4Y6GA 3G1SA 3S46A 4IUOA 1F3EA 3BJSA 1W5MA 2JKEA 1H7XA 4C6KA 4HBKA 1EL3A 1RBAA 4IMAA 4MTVA 1QBAA 1F73A 1KXTA 3T78A 1TIWA 3SCWA 3TYAA 1EFZA 3G22A 5JXQA 2HDJA 3R8HA 3VNDA 1UH2A 2YPIA 3PFMA 2AGTA 2G3FA 1T96A 3LOTA 4I8DA 3TQVA 3OZPA 2PU1A 5D2XA 2GWNA 1V3KA 3Q37A 4PL2A 1WDSA 1QI3A 4OWGA 3ATYA 3WDHA 4GGBA 2DPEA 5D8ZA 4O8RA 4AC1X 4WZHA 2D73A 2E77A 4PRRA 3UPBA 2PGFA 3K4DA 3NIYA 3VIJA 1PHWA 1LQ0A 1KRBC 4IQLA 1YTKA 2EPNA 1XLIA 4RK8A 4B3LA 2I1OA 1OY0A 1REQB 4HHHA 3TQ0A 3FDGA 3UG5A 5E9AA 5D04C 3CHCA 3B05A 3RO8A 1ODZA 3EB4A 1WDPA 3LK6A 1QOPA 2W63A 1A0EA 1Z32X 4YTSA 1MRAA 3ITGA 3LQLA 1OGBA 2BVTA 4P5UA 4O1FA 1FWWA 1RA0A 3UCDA 3L12A 1IIGA 3PM6A 3QJAA 4EP8C 1V0NA 3CPUA 1ZCOA 3MO7A 1I6NA 2QDEA 3AHVA 1E15A 3TXZA 3EZ4A 3QHNA 2DT2A 3SRKA 4Q4KA 5DMMA 3UR8A 4LYQA 2BOEX 2E4TA 3M5ZA 3CZGA 1C8VA 2X7VA 3C4UA 4LS1A 2Q8LA 1TVLA 1L8PA 5DX7A 1Z69A 3ZSSA 2QJNA 4E4FA 4W4QA 3EDFA 3NQVA 2BNJA 1EO7A 5C70A 5DMYA 1J2BA 5HMSA 3ATZA 1XL9A 1XCXA 3DG3A 4QJ1A 2VHLA 2I9UA 4ACZB 4AD2A 3VDCA 3LEPA 4MYXA 4AWSA 1RZMA 3SADA 3TOYA 1VFMA 1GQIA 2CHOA 2C3ZA 1RJPA 1ZJIA 1WZAA 2P1FA 4CNNA 1TZZA 4HOXA 2PDCA 3D5HA 3O6AA 4HD5A 3P0XA 3GNPA 1KC7A 1PBGA 3NQDA 4ZSUA 2XINA 3CL6A 2AL2B 1F9CA 5GPRA 6ALDA 2I5GA 2B31A 2ZCGA 2ANUA 2EJAA 4C6IA 1UR1A 4L4OA 2DY3A 1VHCA 1X7FA 2J7DA 5LNSA 5HQMA 4Q8WA 4H8NA 4HZ7A 4HNOA 4E2OA 1U5HA 3LI0A 3AHYA 3B0UX 1H7OA 2QT3A 4ZQOA 2FJKA 1EQPA 3NSNA 1R8LA 4G1NA 1WDRA 3GXFA 3AMCA 1M03A 3PBWA 4MLRA 1G67A 1VYPX 3MMTA 4AYGA 3PZGA 1I75A 4PUMA 1UJQA 2ISSA 2EGZA 1UASA 1FCUA 2RUSA 4CGTA 2Z1XA 4FNPA 3L5MA 3W85A 3WF0A 4EXBA 3H6OA 4ROQA 1G4EA 4XAPA 2D1ZA 3P93A 2ZZ5A 3ABZA 1VF8A 4JQ3A 4PMXA 1W9VA 3GHRA 4DZAA 1G94A 1V3LA 3UNTA 5CJ5A 4YN5A 1I2QA 2BTMA 4PA8A 3QOKA 1TV2A 1Q85A 1QO2A 3UGRA 3NTYA 5F2LA 4RNJA 1EH9A 3AI0A 4IPJA 1XDJA 2Q02A 2ZX6A 4YVXA 4RPQA 4PUUA 2Y7GA 2A21A 4IXHA 1E9ZB 1ISYA 4XKYA 4F8XA 4HNVA 3WEMA 3UVAA 4ZSTA 1LDCA 1F76A 2DH3A 1X1NA 4HMDA 2YZ5A 2FZNA 5F1VA 1M41A 4IIFA 1UWSA 1KR1A 7CGTA 3UWVA 3VA8A 1HJSA 1V79A 4MZYA 4O1AA 3P8JA 1TPH1 3BAKA 2FB2A 4W7WA 2W62A 3SUWA 2G97A 3TA9A 2VFDA 5AYXA 1TE1A 4JTIA 1MXGA 3TYEA 1JI1A 3TSBA 4A35A 3GIPA 4AVOA 1J0JA 1GYLA 1IIHA 4F48A 2R94A 1GOMA 1K4GA 5CZKA 1RBLA 2ZUMA 4RL3A 1EQCA 1C91A 3NEVA 2J79A 4DO5A 4CVWA 4PBGA 4GI8A 4XVEA 5FAJA 1JPKA 3T07A 1GQKA 4ICNA 3UG8A 3QZAA 4Q7IA 3DIPA 2B0MA 1PIGA 3ZT5A 2XTKA 4NY2A 5FJPA 3WK3A 3ZMRA 1FWJC 1A5LC 2CWNA 1YMYA 3WLRA 1EF3A 3CAWA 3BMXA 2Q3RA 3DKLA 4E8GA 4QBXA 4UTTA 1ZBKA 1DORA 2BOGX 3GRIA 2GGJA 3C3NA 1EJVC 2PC4A 4DQWA 3HQPA 3VZZA 6CGTA 4ZB5A 1MYRA 4BKNA 4Z2JA 2PF8A 3OZYA 1EPVA 3GK0A 3F5LA 1XIDA 1UKOA 5DF0A 4GQBA 5C2CA 1E4LA 3ZWSA 1OX4B 1RJQA 4AD3A 3APGA 1PB0A 1GPFA 5E0CA 2J24A 1J4EA 2DSWA 3PJTA 2VGFA 5E0FA 2DZWA 1A80A 1PPIA 2J25A 1BYDA 4LBUA 1VCFA 4CN1A 1OT2A 4TMBA 4PUDA 3CUHA 1LZOA 3KTSA 3BQ6A 4J1OA 4MY8A 1SUXA 3ALFA 4KT2A 4UFLA 4AVFA 3BV7A 4JZ5A 1O1ZA 4OOUA 1H63A 1WO2A 5FESA 2DT3A 2E9MA 1E5JA 3PZNA 3PUGA 3O0KA 1AUSL 1LJYA 4OIFA 2J7EA 3T4CA 1KKOA 2DSUA 4N6FA 1EZWA 1BVWA 3ZLFA 3NOYA 3OW1A 3P82A 1KQZA 2EAWA 4Z08A 2HNEA 1CXIA 3VC6A 5I07A 4H6RA 2PRHA 2CZEA 3UQNA 2DT1A 3W3OA 3W81A 3ARRA 1SM9A 2QJMA 3H21A 4E4PA 5HK4A 3MI6A 3QM3A 1RLDA 2E5DA 1SZFA 4C5ZA 4HA0A 2NXGA 1IGSA 8RUCA 2G3MA 1DP0A 1IR2A 2DVTA 3G1XA 1EZ2A 4XKYB 2V3EA 4LVGA 1B3OA 4IFKA 1DJZA 4OBTA 1E9YB 1VCVA 1QPRA 4KF1A 2G5WA 4YLWA 3FKRA 1AQ0A 1Q7MA 4H8VA 3WNOA 3WMCA 4NZ5A 3FYOA 4JXCA 3HIJA 3BC9A 5FEWA 2DSZA 5K9CA 3D3AA 4GO8A 3K5XA 4W5UA 1TVPA 1XP3A 4S3GA 4LV9A 3NJ3A 3UEQA 3OODA 1VBUA 2XZ7A 2OQHA 3COTA 3KX6A 2TAAA 3OP2A 4J3XA 4S3FA 3VIKA 3BSMA 4ZE5A 3VGGA 3N19B 4NSBA 1BFNA 1K7FA 5GVJA 4L4LA 3H2AA 2PWDA 4AZCA 3L4VA 2D20A 3PAJA 1HKMA 3A4AA 2CHNA 5C9RA 4RDWA 3WQOA 3ITLA 2PCQA 2EG6A 3GR7A 3TTSA 2EKGA 3HPZA 3KHJA 1JZ7A 1QNOA 3CUGA 4CNOA 4WSHA 4DAFA 4MDOA 4Z1DA 2WZMA 3MA8A 2OKTA 3ITCA 5IXEA 3W7DA 1ZB5A 3MYOA 2ZOXA 3W73A 3R6IA 1J96A 3MBDA 1C29A 1JEZA 1ZQ5A 3T08A 3M43A 2BOFX 3Q58A 4QS6A 2VVNA 1F6YA 4L64A 1KWGA 5DXYA 2G3IA 4C7GA 4BEUA 4GUHA 4PODA 3G8EA 3TIMA 2F9RA 1JDDA 1V7AA 2QMKA 3VO0A 4JICA 3CBWA 1XLJA 5C0QA 4PFMA 1EGMA 1B3ZA 2Q6ZA 4IM4A 2HCVA 2YXGA 1W8GA 4A8IA 1MDRA 4C6PA 5LZLA 2PP0A 1AODA 4X60A 3VM5A 1CTNA 1JAKA 4W8AA 1WDDA 3ARQA 3CMFA 3QR3A 4UXDA 3BLIA 3S1VA 4FNUA 3KP1A 2WQPA 5JVLA 1FWAC 4N9CA 1JZ4A 2QJIA 5CGQA 2OU4A 3WD4A 4O53A 3SDOA 1ZPTA 3TROA 4FLSA 4MFDA 4JCMA 5HINA 4HIBA 3TCEA 3P84A 3ITVA 1GEQA 2E1DA 4GYFA 4O4WA 1ZSXA 3IEBA 4LF2A 3W7IA 1K6AA 1W5QA 4NRSA 2WSPA 1H1ZA 5BRQA 4A3YA 3ZT6A 4JDYA 1EGVA 3E3HA 3M7SA 1EDTA 3RCNA 4G1KA 3UYCA 3KW3A 4HA4A 1P1MA 3WH8A 5TIMA 3WLMA 1Q6OA 5GNYA 1TX0A 4BEQA 4MF4A 1OQFA 2CWXA 2Y8KA 3GXMA 4F0MA 3SCTA 4R33A 1J12A 1EX5A 2GFTA 5LA0A 1Y7VA 2CBUA 5D33A 3BG5A 4H00A 3VTRA 2YFOA 7XIMA 1S5NA 1ZJAA 3G5EA 1SW7A 1OYBA 1Z41A 4EK7A 3GBDA 1R7OA 1UPPA 2J66A 5LNVA 2PLMA 4ZO9A 1QU4A 3GIQA 2XGIA 3STCA 2IS7A 1IXOA 3BLDA 2EHHA 1XYAA 4JS3A 3TFXA 2XVGA 1FWFC 1ZJHA 4AZCB 4LYRA 3THCA 4UC5A 2VEFA 4LX4A 4WX2A 3TZNA 1K8YA 5M3WA 2J7GA 1KRMA 4KWOA 1BYCA 3GFXA 1A5OC 3WH6A 1BF2A 4P61A 2GLKA 2HJPA 1AQMA 3EX6A 1A3WA 4KCWA 2Z1WA 3M5YA 3KHDA 3USZA 4C6JA 3O07A 3MYPA 2WLYA 1VRXA 3NAVA 4Z0SA 4AZGA 5JIWA 4KRUA 4GACA 4L56A 4K1WA 1CW2A 3NXFA 5A6SA 2PE4A 4QCFA 2BZNA 4MZ8A 1B1YA 4QISA 1AVAA 3W53A 3N6QA 3NZ1A 3ZJ8A 2PTZA 3KRUA 1W9UA 1GKQA 2ONEA 1UC5A 1PX3A 1L0PA 2HTMA 5E93A 4E4UA 4UOZA 3NOEA 1JYNA 3AU6A 5MHBA 3EX4A 3PZTA 4OZOA 5G4EA 3AIUA 1KBLA 2PS2A 1F8IA 3H2MA 4XISA 1WZLA 1NP2A 4ZENA 1K9EA 3W9ZA 3CAVA 3SB0A 1WUEA 1AZ2A 2A3LA 3CASA 1WZMA 4J28A 4KMQA 1XR2A 2OWCA 2WJEA 2W79A 1R3RA 5KZMA 3QLDA 4ZEPA 3CGTA 2WQDA 1RHCA 4EE9A 2C1HA 4NJHA 3PZIA 1RALA 3IAQA 1ME8A 1TPUA 4GUGA 4P7NA 1F5ZA 1VFHA 3LMYA 1Q2SA 3ANUA 1UW9A 4R7JA 3BAWA 4KWSA 3HF3A 3FEQA 5A2CA 3VINA 4L9ZA 3CUFA 3NQFA 2OEMA 1FTXA 5PTDA 3RDKA 1JZ3A 3CIXA 3PZMA 5CJNA 5IDIA 4UFKA 5FF7A 4HK6A 3PWGA 4X2PA 4H9XA 4QGCA 2PZ0A 4HU3A 3PNUA 3R10A 2W67A 2BS9A 4JTFA 4AC7C 4IICA 3LGGA 2NQJA 1B3WA 3HQOA 3W1PA 5TAOA 2OQYA 3POHA 2V5KA 4UR7A 3OLEA 4JX4A 1D9EA 3SECA 4YJ5A 3WF2A 3CXOA 1IEVA 1CXKA 1P0BA 3F4VA 3AHZA 1E43A 1I60A 3HFTA 3NQBA 3RCMA 4J2MA 2ZZ3A 4R53A 5HNRA 5CPTA 4EOUA 1G7VA 5DMLA 5F2MA 4PL1A 4CEXC 4WKHA 1XICA 3TAKA 4LBSA 2GJRA 3QV9A 2TMDA 3WQFA 5LIWX 3IRSA 2BY0A 2ZQ0A 3G3DA 1YTDA 4D6JA 2VUYA 3I6RA 4H1ZA 3APTA 3E2QA 3MSRA 4M6QA 3FGCA 2DZPA 4EPBC 1R9YA 4GQQA 2PRMA 2J88A 3KOFA 4CQDA 1FHUA 4O14A 1FDJA 4ZB2A 4TVCA 4Q6JA 5J04A 4RE2A 3ABOA 4AISA 1HVQA 4HN8A 2OWWA 5D09A 5A69A 1LOQA 1SW0A 4XIMA 1JFXA 3RJXA 3W00A 4XAZA 4CCCA 3FA3A 1HNYA 1XUUA 2A6LA 1GHRA 2QMJA 1EPXA 1O68A 2XJ7A 4QHRA 3T9PA 4PCTA 4E38A 1M04A 3RLHA 4E2VA 5A2BA 5ENLA 2V69A 2G3NA 4Q22A 4AWEA 4GG9A 4O4VA 3FS2A 1I1XA 3PPFA 4AX7A 1FH8A 1IWBA 2D23A 3KVJA 2PAJA 4Q32A 4E6MA 3HMJG 1HXJA 2V67A 5CSUA 4CD7A 3SUUA 4LUTA 1HKIA 4O0ZA 1VYRA 2QUUA 4GCAA 2ZUSA 4LY8A 4A22A 1HL2A 2EPKX 3HN3A 4ZCWA 1MI3A 1XKYA 4I9TA 2QIIA 2X2YA 1KO0A 4AEOA 5BCAA 1FH9A 3C2YA 1ADSA 1E3XA 4QIUA 1ISWA 4HSOA 2D2HA 4UFJA 1GZ1A 1B4EA 1TJRA 1X96A 4RZ5A 3LHTA 4PB3A 1M9HA 1MZHA 3SCRA 3N2CA 2IPFA 3GWQA 2VELA 3NPUA 1XINA 1R3YA 1PYMA 3HM7A 2GK1A 3WLPA 5AKQA 3T81A 5AC7A 2V6AA 1RJRA 2Z1KA 3STGA 1PUDA 3U7VA 1XYFA 4HCDA 3OHIA 1BYBA 2VXNA 1XX1A 3FVDA 3IK4A 3KL5A 4L4MA 3QMRA 2BVWA 2HEJA 1GWJA 3ES7A 4P2VA 3EDJA 1KM1A 4HJFA 3UXLA 1DJYA 1R9XA 5CPNA 3T8LA 1HVXA 4YIWA 3AWNA 4TR9A 2V68A 1BWLA 4EXQA 4QDWA 2GZXA 3CLMA 1Q6EA 4KRTA 3FN9A 3N9SA 3WQ8A 3WFZA 1UR8A 1F3TA 1TPFA 3M0JA 3N2BA 2WHJA 3MCNA 2PDHA 3WD1A 2FGZA 4UFMA 4IWWA 1RQHA 2F2KA 3SGZA 5KZ6A 3S0CA 2WNZA 1FP8A 2ALDA 3B0VC 3JUGA 3R43A 1PKYA 5D9PA 4ZOCA 4XAFA 3RXZA 5MF5A 3MQTA 3QKZA 4EF9A 1SFJA 4XVDA 4PEKA 2ZA3A 7A3HA 4JD4A 5AYBA 2VRQA 1JZ8A 1W1IE 1AD4A 1PIFA 2A7NA 3T44A 1M1BA 3U4FA 1UMLA 1XGZA 2C18A 1K7XA 3PHAA 1V5XA 4MDPA 4DF1A 4R3UA 4LS2A 3FGCB 1UB3A 2VP8A 4N0RA 1MW0A 3PB2A 3IUDA 3ABXA 5EPDA 1JL8A 7PTDA 4ZXOA 1M01A 2BB0A 3DAQA 5HWMA 2YBVA 4ZOBA 5K9XA 4LXFA 1EOMA 2PDJA 2YL9A 3U2EA 1N2VA 3D46A 4IH3A 4JTQA 5A8NA 4F2UA 3HURA 4HU4A 3O63A 4Q4MA 3M9YA 3LRKA 1A3XA 4MZ1A 4Z2GA 5I23A 4PMJA 3VYLA 1LUCA 1EC7A 2DZTA 3P61A 1HUVA 2PU0A 4UB9A 3R4IA 1ZAJA 3T0CA 1FCQA 2PD9A 3WDRA 5IOBA 2UY3A 4RE0A 4JAWA 4NAFA 1X39A 3BMVA 3C0QA 1BXCA 1RH9A 4LUTB 2CZ5A 2EG8A 4Q7BA 3BPWA 3LLFA 4OE7A 1CWYA 2R82A 3N18A 4O1DA 4JTAA 1UH4A 1T99A 4B15A 1MSSA 3I4EA 4FIRA 5GNZA 3LV5A 2HK0A 1XKJA 1P0EA 3PTDA 2KZHA 1EHNA 3L67A 1QHOA 5C2GA 4JGDA 5A6MA 4R85A 4F66A 5FEPA 2ZTJA 4UCFA 5D8WA 1HT6A 1IV8A 3IJ6A 4UTHA 3L4ZA 1V6WA 3EDDA 3CHDA 1NOFA 2CEQA 3ANVA 3GXIA 3H24A 3M44A 4QE4A 2GK1B 4ZBCA 3O6CA 1A0CA 3WQCA 1Q63A 4GC4A 4IIHA 2OWXA 4DUXA 5IRPA 1SMAA 4EACA 1JXJA 2CKSA 1TPB1 4TXEA 2WMFA 2ZX7A 3S5NA 1OJXA 4ZE4A 2QUNA 1RCQA 2REQA 3VIHA 1QATA 3M5VA 1KTBA 5A8MA 4M51A 3MJMA 3MSDA 5HBFA 3SQMA 1FCBA 4L61A 3KBMA 1GQNA 1RR2A 3QW3A 2D0GA 2IPWA 2GUUA 3DH7A 4BR1A 1Q8JA 1NDYA 4P8VA 1IZCA 1PZ1A 3WDPP 3UESA 4GUIA 1R38A 5C54A 2X40A 4D72A 4GRSA 3DESA 4U5KA 2PWEA 3UP8A 1DIDA 3IIZA 3KS5A 1VIWA 1QW8A 4G9PA 3R1ZA 1RPKA 4NZCA 5E6YA 3N12A 1FWSA 1KV8A 2PF0A 4JFVA 2VGGA 3F5KA 4XUGA 3OG2A 3AUOA 1NU5A 4DLFA 4LEFA 4BS0A 5BRBA 2RDXA 5E09A 1PCWA 2VTFA 3EXTA 4LOCA 3NYZA 4IP4A 3DYPA 5HJXA 3BOLA 3WLSA 1ZALA 3W1AA 4S38A 4CUCA 3L68A 4K38A 3CIVA 5AYIA 1MEWA 1IEQA 2W4XA 1E0XA 4J3SA 1HO4A 4RR4A 2H9AA 2PDUA 3UY8A 3WY1A 2ACRA 4FA3A 3QGAC 1FWGC 1SPQA 1SQ7A 3PG9A 1KFWA 1OCJA 3VMOA 3IVSA 3OA3A 4J40A 4IIGA 2WVUA 3KE0A 5AYYA 3ZO9A 2UWFA 3MI2A 1EP1A 4RNFA 3W22A 4WDXA 3RX2A 1LUCB 1OBAA 2EF9A 1RP9A 1TJ1A 4B2DA 1F8MA 3WBAA 2YW3A 4DJFC 3FHQA 3LPPA 4YCPA 4UIOA 1CXLA 3LYEA 2QJHA 3S47A 3UF9A 2RH9A 2LLEA 4NAFB 3SURA 4PH6A 3RCYA 1NWRA 5I77A 3V18A 1IEXA 1Y5WA 1EDQA 3CUIA 2E7FA 3MUCA 3GNDA 4M81A 5I3KA 3EEGA 3LPGA 3UZYA 1EIXA 1F4AA 5IFTA 1J11A 2XFRA 2BHUA 3U2OA 1TPWA 2PD5A 3NG3A 3KCJA 3QPZA 4BWLC 3WD2A 1E6ZA 2ZC8A 3GKAA 3MZNA 4GUJA 3GM8A 5A6KA 2FTYA 4CNSA 3WLLA 4QX4A 5C9ZA 3PAOA 2WBKA 4TX9A 2DFAA 4ASTA 3S5OA 4O15A 3K8KA 4JTGA 3B0PA 3VGEA 1LRNA 3G18A 2GJLA 4DF2A 4H6EA 2E25A 4GVGA 4NNBA 1ONWA 3QZEA 5AZ1A 3GDBA 3NQMA 4JYEA 4D6GA 1XH2A 1CYGA 1WXJA 2JKAA 1YXCA 3DZ1A 3PZOA 3VKDA 3CMGA 4OGZA 1XRFA 2REQB 4A8NA 2BBFA 4IZGA 4JN7A 1THFD 4TV6A 1H41A 2CLFA 3HG4A 3EMZA 3UR2A 1E3ZA 5G2WA 2GVGA 4HTBA 1P0KA 5FIPA 4K37A 3ZLHA 4HGXA 1JZ6A 1P1XA 3H7UA 1WKFA 2JEQA 3KM8A 1W2VA 2V5LA 1ODUA 3TMQA 1UWAA 4NU7A 2WNQA 1ONRA 2Y0FA 1DWIM 2PDBA 1TVNA 2PDIA 4ZQCA 1ADOA 3CQHA 1UA3A 4GA8A 1V6TA 1V3JA 1Z7AA 1S46A 2PDNA 2BHYA 2BWGA 2Z2AA 1VR6A 4HNNA 4XD6A 4UWMA 3FSUA 3AS0A 3DDMA 6ENLA 1OX5A 1SU5A 1YPFA 2WMGA 4FLOA 2YKKA 2J6XA 5RUBA 1GOIA 3VIPA 4JTRA 1UZ1A 2ZUTA 2EPLX 2A6NA 3MWCA 1H2JA 4HYVA 4LC6A 1V7YA 4BI5A 3W70A 1LBLA 1DJNA 2H9AB 2V63A 3WELA 1UR9A 2RGLA 5FKYA 4LS0A 2INEA 3N2TA 1EYEA 3H2EA 4OHQA 3CPRA 1CECA 4CNTA 1YADA 2G95A 1RD6A 3HV8A 2V5DA 3I4KA 4HPXA 3AOFA 5AVNA 1T0OA 4MB3A 4EVZA 1N8IA 5F2GA 3GNXA 4B16A 3CWHA 4IOTA 3SI9A 1Q6CA 3I3DA 3A3HA 4H7CA 3VGDA 3T2QA 1SSGA 1J79A 3UY7A 4X9YA 3S2MA 4RX0A 4R34A 3L5AA 2AAAA 2OLHA 4CVUA 3U2CA 3PVFA 1B3VA 3TOPA 1RCOB 4W7VA 1QPNA 3WH9A 5FF2A 1DWFM 1HKKA 1T8QA 1GOXA 1FFRA 4UZSA 3MP3A 4FOKA 1AW2A 3K4AA 2NLIA 2R9RA 2QGYA 4PYSA 1J9YA 3L2LA 3TJ4A 3GB6A 3P62A 5AHMA 2OYLA 1GUVA 3I7RA 3UWZA 3URBA 4Z0JA 6PTDA 1G9HA 2F6XA 4CNUA 4Q8QA 3TNBA 4C1NA 1X7IA 3K46A 4GY0A 1S2TA 3GUWA 3ZS4A 4C6OA 2QEZA 4ZFMA 3UJ2A 4S3BA 2QCLA 3EWYA 2Y8VA 4WIWA 2FVLA 5HNUA 4HHMA 5HULA 1KQYA 4KCTA 1FOBA 5CAHA 3RRXA 4LVFA 5EMJA 3WLOA 1EP3A 3GIYA 1TRDA 5FJOA 1KM3A 3L0NA 4L80A 4HKPA 2FZMA 4PMVA 1UP3A 4LV4A 4PSPA 4P7QA 3KBSA 2UBPC 1CX9A 3WQ5A 1KCXA 4R9OA 5JH1A 3MP5A 4WQ6A 3FEMA 4MWAC 3QV7A 2ZX5A 5CC5A 5CC6A 3W6YA 1KKRA 4DJED 1W1YA 2HPIA 2GDUA 1K3UA 4H9VA 3TXVA 3QHMA 4PTMA 3J7HA 4DI8A 3HU7A 2XIMA 3BAXA 1W5OA 4MAZA 1HJVA 3U3HA 1JF5A 1L6GA 2GQ9A 2XUCA 3LCWA 4YCOA 3BLLA 3G3MA 1WP6A 3WKZA 2QDDA 4IL2A 2BGSA 3I6EA 3GSMA 4C65A 1A5AA 3GBEA 2XVNA 5CZTA 1IXNA 1GVRA 4IFOA 1GK8A 1AQHA 4J3VA 3THDA 4US6A 4PCFA 2E5CA 2E40A 2VCCA 3M4HA 4KBXA 1KGWA 4GQRA 3PPGA 2OGYA 4UQCA 3O1NA 3QFEA 3GHSA 3ONBA 2X1TA 2OVLA 4KIRA 3W1UA 4ML9A 3GTHA 2ISDA 3V36A 3ZIZA 3GTFA 3THAA 1VBHA 2PTDA 5FAGA 3AYVA 4FXSA 4YVPA 3JVAA 4RXGA 4N4PA 3K4WA 4EWND 1VC4A 5DCDA 2DW6A 1GZGA 3CTLA 1TSIA 4JTKA 4H83A 1ITQA 4NG3A 4QJ5B 1W1TA 4HA3A 4M1RA 1SZNA 1W1VA 1V0LA 3R25A 1ICSA 1R3TA 2NWRA 3EWDA 1VZWA 2XVLA 2CERA 1NEYA 2R14A 3WL1A 1V03A 3BVJA 5BU9A 1XSIA 3LPOA 3LX9A 1BKSA 1TA3A 4FNTA 4Q8MA 1TV5A 3ZR4A 4MVAA 1XG3A 3T2PA 1UD5A 1W1B1 2C1GA 4RZ4A 4F0SA 1MUWA 3STFA 1WOAA 1U22A 3R2GA 2G8ZA 3QMSA 5I24A 3L23A 3C2FA 2HBVA 4RW3A 2VZSA 1ONEA 3S2NA 3SJNA 2DSVA 2HMCA 4RZ6A 4C1NB 3LNMA 3CQKA 3W2JA 2V5BA 3EXSA 4NILA 3ZZ1A 1A5MC 1PX4A 4FF7A 4XD5A 2FTPA 4DNMA 3S1GA 3GFZA 3EPNA 3I68A 4I8YA 3A23A 1XD1A 3VNMA 4CEUC 4C6LA 2P8BA 1H11A 1GONA 3VD5A 3OTRA 3SN1A 5J8LA 3L2MA 3ONCA 5DQPA 1UMYA 4GNVA 3BOFA 4ZOEA 2GDQA 3KLKA 2W92A 4GISA 4JTUA 1ONXA 1MXSA 1IEIA 1YLVA 3WK2A 3VFLA 4C7FA 3PFRA 4AIBA 2QS8A 2VR2A 3NSXA 1W9XA 1XIFA 3R8RA 1D7KA 1XHGA 4L9YA 3W82A 3DFPA 4FX6M 1QNVA 4KEZA 1JPDX 3W6MA 1NJJA 4QQ3A 3FK4A 4X2RA 2QJJA 1JAEA 1I45A 3N4AA 4HQVA 1R2TA 2HS8A 4GX8A 1R46A 2Z7GA 1TO3A 3WLQA 1U33A 1GVYA 1CLKA 1CEOA 1NM9A 5CZJA 1SJCA 4DLMA 5LIKX 4KERA 2R8WA 1XLLA 1QW9A 1O6IA 1XYZA 2Y70A 4R7OA 1GTHA 3GE7A 4Z1AA 2FMOA 1LBMA 2VCAA 4PMQA 5CCZA 1D7FA 5CBIA 1EJUC 2CZDA 2VEMA 1ZGDA 3TW7A 2PODA 3QBUA 3HGJA 5CJMA 2ZUNA 3G1VA 3SFKA 3VXGA 3V5OA 1VJSA 3JU2A 4UMBA 5TD4A 1GOQA 3VOIA 3CS2A 3JZUA 5CSRA 2D2JA 1SJAA 2GSEA 2SFPA 3LBMA 3ZM8A 2CBIA 1BSLA 2VFEA 3CNYA 2VEGA 1U83A 2PCEA 1KWKA 1PIIA 1E40A 4UR8A 3H55A 4GBDA 1MEIA 4N9BA 4AHQA 3KBVA 3BG9A 3QGKC 2V8ZA 1QNQA 3B8SA 4IT1A 3QSRA 3KCLA 1Q8AA 5CLTA 3IGHX 4PSRA 2GGEA 1HJXA 2QUTA 1B4KA 4UTLA 1DV7A 1HZYA 5E1QA 1MZRA 3MWAA 5BOOA 1DWJM 3P7YA 3W2UA 1TA3B 3BE7A 1Z9AA 4LANA 3UG3A 3W38A 4CKQA 4GY7A 3H4GA 2Z26A 3N73A 2VC6A 4C1KA 1S3TC 3C0SA 1LLOA 3EYPA 1DHKA 4AFYA 5ABFA 3BH4A 3BLEA 3EMCA 4BWLA 3XISA 3LHVA 1J0KA 3QFWA 3CH9A 3SCQA 4DXKA 4YYCA 1QWKA 2YIHA 3A4WA 5IHRA 1FWBC 4KCUA 3BV4A 4DPQA 1FDYA 1JCMP 3G6MA 3S5SA 2EPOA 2P10A 1XWYA 2PA6A 3QR0A 4LFYA 3AXIA 4GVHA 3U4AA 3WBWA 1C8YA 3PPCA 4G6CA 2CBVA 2WNNA 1H49A 2Q09A 2QZRA 4NXKA 5KEZA 2J6VA 4MIMA 3KXQA 2Y63A 3VU2A 1UR3M 2WC7A 1KGXA 3FAXA 1J0HA 3PS7A 3W7RA 4H3DA 2VD8A 4AG0A 2VDHA 3AAMA 3QXBA 2C1IA 3B97A 4AB4A 3WMLA 2ZZ4A 1IEWA 5AOUA 3NFUA 3XIMA 4LH8A 4H7ZA 1O5KA 1VHNA 1OGSA 1G4PA 4QTGA 2PTWA 1A5BA 4UMCA 1HJUA 1L9WA 4JIPA 3U6WA 1UROA 2DIJA 5A2AA 2YLLA 4ZOAA 2XIQA 2YDRA 3SRDA 2A2IA 2DZVA 2DV0A 1DBTA 4GXWA 1A5UA 2D3NA 4W8BA 3FXGA 4W85A 1UKQA 1MO0A 4GNJA 3RRAA 2E9BA 4W8LA 3W2LA 3W7HA 4IJRA 1DYSA 2OR2A 4QDMA 4GO9A 3W75A 1P6WA 3GXNA 2FHFA 1XYCA 5U4NA 1KBBA 4JNZA 3ZQ9A 4AXKA 3L4WA 2FH6A 3PPHA 2VURA 4U2YA 2HVOA 1W56A 2ATSA 1EC9A 3NPWA 3MHFA 5K4XA 5JH2A 3FJ4A 4C6BA 1LF1A 1XLAA 2QCCA 4HSHA 1LBFA 2FVKA 3FKKA 2PDMA 3EOLA 4JIQA 1F74A 1V8EA 2DQXA 4ZFCA 3B9NA 4DWSA 1G5AA 3Q67A 1HKVA 1QDSA 4GVFA 3PY2A 1PX8A 4O17A 5C2XA 3WF4A 3WN6A 5HPOA 1V02E 3M7WA 4K8GA 4IQEA 1ZLPA 2Q8XA 4MKNA 2ATMA 1LYXA 2YA2A 3URNA 1RXOB 5U7SA 4Q8VA 4KKXA 2WWCA 3HA1A 5C8BB 2NT0A 2PURA 1JD9A 3MMDA 3PBMA 5DRIA 2HSAA 2VC5A 3DFNA 3QYSA 2OQLA 1ZAHA 4EXAA 1E71M 1KTNA 3AXXA 4GYPC 2IKGA 2CPUA 5EU9A 3CV2A 7ENLA 2PP3A 4AIUA 3TN5A 4AWUA 5C5YA 4KWVA 1GT8A 1A5KC 5FJJA 2CLMA 1WXZA 4FEZA 3THQA 3IK2A 1LQAA 1JXKA 1B54A 1SJDA 3L9CA 1RQBA 2CW6A 5ABFB 1PCKA 2Y8UA 3JZEA 4QQUA 3QSTA 1JGIA 3B03A 5G5IA 1LOSA 1JUBA 3K1DA 3HB9A 4QLLA 2AAMA 1E6SM 4PC8A 2YLAA 4LF1A 1H4PA 1RVKA 2CYGA 2XWDA 3L66A 3FYYA 1VRDA 1XIEA 2XIBA 3M0XA 3KOWA 3OEXA 1LL7A 4K68A 1OSEA 2OT1A 2IUZA 1LWIA 4PB4A 5BOFA 4JHMA 3LM7A 3L2IA 1I0DA 4EPDC 2FGLA 2FVMA 4JY8A 3VKAA 3NDYA 3V4BA 2YB4A 3EOEA 1LM1A 3U9IA 3NNTA 4QAIA 1YNYA 3DHUA 4PMZA 1Z6KA 5FL1A 4MWAA 2GJXA 4F2BA 2BLEA 4WUIA 5FJTA 1CGXA 3TR2A 1DJWA 1MWOA 5B7YA 4DJFD 1WKDA 5CPLA 3O0FA 2EG7A 4ZTYA 4XSLA 1KBJA 1GNXA 4J7RA 1KLYA 3TSMA 2ZBTA 4HVXA 1C9DA 4WOZA 5A8PA 1QI0A 2CNCA 3SSZA 1P0DA 3WLTA 3CIWA 3W1RA 4RJEA 4XZMX 3AXMA 1ZENA 4H9MA 2WJFA 2DZXA 3W1NA 2V81A 5KITA 5EMMA 1HGWA 1YRRA 4DZHA 1PO9A 3AU2A 1TJPA 3OOQA 1TWDA 4LUSA 1DHPA 3JW7A 3GS6A 3V5CA 1S3HA 1TRIA 1KNWA 3ZSTA 4F79A 3M5XA 4ZO6A 4H6KA 3WBXA 2HQAA 2Z00A 1Q6GA 1BWVA 2YL6A 1R87A 2V38A 3N14A 5KZEA 4LNYA 1GOKA 4NASA 2PBGA 4GPNA 3CJPA 2D24A 4N9DA 3C2RA 2B81A 2VDGA 3MY9A 4G7FA 6XIAA 3CYVA 3EXRA 4NZ3A 3DN5A 4WY0A 3UZXA 1G69A 3WQDA 3CHFA 1AL8A 3GVQA 2HXUA 2NV9A 2OB3A 2ZKMX 4RDZA 1K6WA 4GBUA 1JJKA 5C9UA 2HISA 3WQ4A 3TFCA 2DGAA 4CQCA 1B9BA 2YDAA 5I3IA 1I1WA 4F0HA 3VNZA 3B9EA 3O6DA 3GHUA 2OZ0A 2O4MA 1XIHA 4Z2KA 2NSXA 4WXYA 3USBA 3DHFA 3PWAA 4PCPA 1VFLA 2YXOA 3OLDA 3UCCA 4R88A 3SRFA 5CQ1A 3EA1A 4P8UA 4GJJA 1K8CA 3QKEA 1UOZA 1MUCA 3FY1A 5LSMA 3SO7A 1K03A 3TR9A 4WY0F 4QRNA 4N9EA 5CG0A 3WQEA 2OFJA 3HPXA 3FW6A 4IPNB 3NQ6A 4P7RA 2WBGA 4UQ9A 1SGJA 1KV5A 2ZUWA 3W7GA 1S5WA 3E2VA 2ICSA 2EPMX 5CC3A 2NWSA 3S5ZA 3WLJA 1QK2A 2GGIA 2W91A 1VEOA 1TPVA 3QPEA 1WV2A 1YIXA 2QAPA 4DB7A 1UIPA 3GR4A 1AQFA 3NQ2A 3CT7A 4ZA0A 1PL9A 1VFTA 1GQJA 1O66A 3GH4A 1JGMA 4MWAB 4CCDA 2GJXB 2OGJA 1XGDA 2O9RA 2EBNA 4ADUA 1JDFA 5K3VA 2ZVRA 2NQLA 4JKLA 1XIGA 1FP9A 3IACA 1RVGA 3WYZA 2J9YA 3BJFA 3EWCA 2Z1SA 4CN4A 2ZZ2A 4NJGA 4HOZA 3OQEA 2E67A 3O9NA 4MSSA 4N7QA 5A94A 5A6AA 1OG6A 4GCXA 5LGZA 2ZICA 4KEVA 4D8AA 3QW4B 2PDQA 3MV01 3BURA 3HPSA 1NF0A 1OX6A 1GG1A 3W72A 3VKBA 1A49A 2O9PA 1GVIA 4I3GA 1HKWA 3E0VA 1YHTA 1QUMA 4LUSB 1T6MA 3AROA 1AW1A 4A29A 5I2UA 1TMQA 3GVRA 1TELA 4DBEA 4MWAE 1XBZA 3SUSA 1LCOA 1LL6A 1SSDA 4JIHA 4JTJA 3LA4A 2E6FA 1CPUA 4JQ4A 4B4HA 1HF6A 3RU8X 2Y7EA 4OQVA 2X7WA 3F03K 5I6SA 3A21A 4K39A 5A8GA 3KWXA 2XIOA 3GC2A 4HNCA 3VGBA 4AIEA 2YCIX 3FOKA 3S42A 4E5TA 2G96A 4GINA 4MWAD 3S2LA 4TV5A 1SZRA 4U3AA 4HZ8A 4O13A 1M6JA 4LSBA 2YBUA 3DYOA 1DJQA 4XZBA 1UD2A 2WC3A 1ZY9A 1ITCA 5DT7A 1TZ9A 2QUVA 3GD6A 5I06A 4W88A 1EUNA 3ZJ6A 4Z2HA 4RUBA 3E49A 4IF2A 1UZ4A 3ZVIA 3DX5A 1XYLA 5C9WA 1RUSA 3IJIA 5D9OA 4ACYA 3WJZA 2I5QA 2GJNA 3GFYA 1E55A 2PPGA 3R0DA 3HGSA 3GX9A 1J18A 2XWEA 1G1YA 1SZGA 4WDWA 1LQ2A 2J47A 2YX0A 1RSCA 2ABBA 1JFHA 1EJWC 1UHVA 3ZOAA 4GH3A 1DVJA 1JNDA 2XIIA 3L4YA 2V3FA 3N11A 2PRLA 4D6IA 1B0IA 2L5HA 1WKYA 4KH2A 5DEZA 1DWAM 2XSXA 2XM1A 2XSBA 3PZQA 5EGRA 1HG3A 4PCNA 1GJWA 4YU1A 5IHSA 3L21A 4BY3A 4A3HA 4AZIA 1ZCCA 2OX1A 3ITTA 4JQAA 1UP0A 4N4QA 4ZODA 1JPIA 4E2DA 1TQJA 1XDMA 5H8MA 3N9RA 2PWGA 1V6UA 2IMRA 4BI6A 1JCXA 2HWGA 5HJLA 2EKCA 4JIEA 5JMUA 1ZS2A 3A13A 2F38A 3BGGA 1KM0A 5BXPA 4MKVA 1K9FA 1ZFJA 2C91A 3FDKA 3KBNA 4XO7A 3UWEA 3OBAA 3M07A 1QW7A 2QCGA 4C6NA 3ZT7A 2A0NA 1W8SA 3QY8A 4D2JA 1XF0A 3C56A 1HGYA 2I17A 5DANA 1MXDA 2GSHA 3H7VA 4U33A 4JEQA 3PJWA 4EWJA 5A8QA 1VFUA 1WDQA 5H2ZA 1OIFA 1TKKA 5FA5A 3IV3A 1R5YA 1EP2A 3RILA 3VE7A 2OEJA 4HB7A 3B9DA 1EO5A 1JYXA 3JRKA 3G24A 5EL1A 3M0HA 4IGMA 4PMDA 5DBUA 4MOZA 1UKSA 3U5YA 3LHWA 3WK0A 2XHYA 3CMJA 3GTIA 4S3AA 1GZJA 1YBQA 3H2CA 4GH1A 5EB8A 4U10A 4JFUA 5EMUA 2KAUC 3TU9A 4NUWA 4KFNA 5ABGA 4BZYA 3C8NA 3KVMA 5CLWA 2JF7A 4K7YA 7REQA 1PS9A 2VZUA 3LY0A 3D3FA 4I6KA 1L2UA 4C91A 1NIUA 4GYPA 4AD4A 4IIDA 3B4UA 4AMAA 3AYSA 3W7QA 1ICQA 2DP3A 3LI1A 4I7UA 3U0HA 3G1AA 4PCSA 3EWXA 1MEHA 1P7TA 2FKPA 4ZQNA 2GYIA 4DYKA 4Y7EA 5E6ZA 3F4NA 5F4XA 3N04A 3FJLA 4MNMA 3GYEA 1W3IA 4D6FA 4LCRA 4HSNA 4L7ZA 2YDQA 1IE7C 3VD7A 4FF5A 1VBRA 4O28A 1FHVA 3UWUA 4L6HA 4Q4PA 5KINA 2J13A 5CG7A 2IW0A 1Q6RA 3I10A 1M53A 2AOSA 3MKVA 3S1WA 4PE8A 4DBUA 3PZUA 3RM8A 1EXBA 5DELA 1FWEC 1JUEA 3FVMA 4X63A 4GZIA 3TNOA 3FAWA 4IMFA 4IQDA 4XZWA 3SN4A 4ZL1A 2DZBA 3UD6A 4DEFA 3R12A 4AY1A 3WMBA 4WVXA 5LIUX 1XISA 1XLEA 4C60A 3IJLA 3WQVA 1W3NA 4E2BA 2HE5A 2OMAA 4I9JA 3R58A 3TE9A 3W76A 1Q6QA 4K3ZA 1BQCA 1H7NA 2CXEA 4C6QA 3IVTA 5HMFA 4M6UA 1HP5A 1V3IA 1GCYA 5JBEA 3NDOA 5FJIA 3C8FA 3B06A 3WQWA 1X98A 3MC5A 2VOMA 3SSJA 1KRAC 4PMOA 3B8UA 3E0FA 3TUUA 5AHNA 2IKIA 4F2TA 1GG0A 3NSMA 1W3TA 1E51A 2X42A 3W1QA 3UZZA 4HHPA 5I3JA 1ZJBA 1M7XA 4ERIA 3W7CA 4Q3MA 2Z0IA 2XFYA 2QCFA 1NTHA 1R3WA 2BHZA 3PK7A 3LHUA 5IM51 4A4AA 3W74A 1T5AA 3HFYA 1UG6A 2INZA 5CGMA 5DXXA 3VD9A 2RFGA 4GI6A 2ASHA 2Y89A 3ZR5A 1OK6A 3GDMA 4I5XA 3QH2A 4GHRA 3EWBX 1VJZA 3K2GA 1HIZA 3E6EA 1OC5A 1E73M 3FA5A 3B8IA 2FFCA 4NJKA 4GIRA 3WQ6A 1H3GA 4DF0A 3DU0A 4CCZA 3WJSA 3M41A 3OVRA 4KWUA 3PSVA 4YHGA 4TVUA 4GJ1A 4ATWA 3UPWA 1YBQB 3IJ8A 1WAWA 2EO7A 2ABAA 3ANYA 4BF5A 3O15A 2NVCA 1XLCA 1TZ7A 2J77A 2F2HA 2I14A 2QV5A 4H01A 3T55A 3E0IA 4X61A 1JZ5A 3BG3A 4ZQRA 7REQB 1OVDA 4MFEA 3EWZA 3GH5A 4WF7A 1IR1A 4JQ2A 2BVDA 3GDRA 4PTXA 1P7TB 2WXDM 4KRZA 4M8UA 4HPGA 2XM2A 3WUBA 2NQHA 1OK4A 2QAFA 1K02A 1FDZA 3IARA 1NQKA 2YOCA 3FV9A 3RM4A 3VX0A 1OINA 3W25A 2A7RA 2GGGA 5D9MA 1PJ9A 4HPNA 1S39A 1ZP4A 2BP1A 3BAYA 4G2DA 1LROA 1U1HA 3VILA 1Q7QA 2Z6IA 1JRCA 4GC3A 4GI9A 2YZRA 2YCEA 3UT0A 3ME3A 3NGFA 4HU8A 2X1UA 5BYWA 2IQTA 3KDOA 4GABA 1JYWA 3A4XA 4RLIA 3WO8A 1FKWA 4RZBA 2FLIA 3IIOA 4C5YA 4AVNA 1AH3A 3RLUA 3A64A 2AKMA 3VAVA 4Z17A 1V0KA 3WUFA 2NV2A 2ACUA 2OT0A 4O18A 1E5NA 2WB5A 1BRLA 1NWTA 1GVQA 1MW1A 3NZQA 3WDIA 2DH2A 2WZTA 2VRKA 1JDEA 4AZHA 4GK8A 3A5VA 2WMIA 3ZYZA 3LTYA 3K8LA 4YTTA 4GQGA 2VO5A 1H62A 1UWQA 3KTXA 3UNDA 1W3LA 2NX9A 4UTWC 4J3UA 2AKZA 4M19A 4JIRA 2XVKA 3AIEA 2PC8A 4FS9A 4AF0A 4QJ3B 5DLCA 3RAOA 3AS3A 3C0LA 3CWNA 4JX6A 4U28A 4BA0A 1XDLA 3MW7A 3BO9A 2YR1A 1SFSA 3N4EA 2ZE0A 2CLOA 5E0KA 2VNCA 3W27A 4IUGA 3H7RA 4N6EA 1KXHA 3RIKA 2QIWA 3NQEA 4CD5A 1EKOA 4ES4A 3UR7A 4KETA 4MG4A 1MMFA 4B90A 1XFCA 3GKFA 2QV4A 3QHOA 3VIFA 4E0CA 4F0RA 4WDUA 5TNVA 5I03A 1C8XA 1TQXA 3L65A 5HAOA 3U57A 2BV9A 4D1IA 3K1GA 1BAGA 4B9ZA 5FCZA 5HOSA 1QJWA 5CZSA 5BOEA 1LOLA 2CHRA 1BGAA 2VWSA 3NO5A 3MKKA 3UJFA 4M29A 3ITXA 1XJBA 5CBJA 1YNPA 2FPTA 3H54A 2WZHA 4FR6A 2EQDA 1PDYA 3ZFHA 4C7DA 4B9YA 1JCJA 1EC8A 1AMKA 3LTSA 3LRLA 3PTMA 5K9DA 3R0UA 3EB2A 4XBJA 4QNWA 3A22A 2JE8A 3OZMA 5I09A 3LCLA 1DXFA 1MQRA 2QCNA 4JNMA 5HA7A 4HPJA 2VRJA 3E0LA 3VNIA 2XGZA 3K8MA 1VD6A 2OOFA 3A9IA 3RLGA 3E9AA 4PEEA 1V08A 4K36A 1OFPA 1JPHA 4CD4A 2DUZA 1RV8A 3E12A 5D03A 3I6TA 2Y61A 4LQ1A 3UZWA 1O7AA 3IJQA 4UMAA 4BQ5A 1PYFA 1XD0A 1J2WA 1ICPA 3FYPA 1OD8A 4GZ7A 1ESWA 3BZJA 3WENA 4GUFA 5I5RA 5D9NA 4M56A 4NI3A 1J5TA 2YJQA 5E9XA 2IQDA 4P7OA 1EEXA 6REQA 4IJCA 4MGGA 2PWUA 1K70A 1M65A 2NXIA 3GQYA 4UTKA 3RR1A 2BFGA 3OZOA 3OHMB 1YW1A 4W9TA 1BRLB 1YNQA 3MKCA 1UD3A 3QPYA 3IIVA 4PTNA 1SFTA 1BG4A 3VOGA 2PDLA 2G4FA 2G4JA 1FY6A 5GJMA 2BX7A 1NFPA 2WMIB 3VMNA 1KM4A 2Y5SA 1XIMA 1EA0A 3VD3A 3MMWA 3FFSA 4E3VA 4LRSA 2E68A 8A3HA 1TPC1 1OB0A 4G5DA 1XGEA 4G7EA 3M1ZA 5FJRA 1WBHA 4AF0B 3SM0A 2D69A 1R6WA 1LL4A 2PGRA 4RV3A 3KBJA 2H3BA 2WMHA 4GY1A 3S5YA 2C8NA 2VQUA 2AMXA 1XIIA 2Z28A 1XPYA 1YDYA 1POKA 3NCOA 4RE4A 1KCLA 3AYRA 2JGYA 4HK7A 4MJ2A 5BXRA 3BARA 2XH2A 2CZVA 1E9LA 1QI4A 5TQLA 1JI2A 3OQ8A 4WK9A 4I9AA 4WOQA 3VCNA 3GC5A 2ZXAA 3S2CA 4QDPA 1X6NA 1XYMA 3BL3A 3VFCA 4PTDA 4MNJA 3S6TA 4LVDA 4I5RA 2V3DA 3MCMA 2QCHA 3WJYA 2GJPA 4XD4A 3DFTA 4IFKB 3SCVA 3QV6A 3R7MA 4FNSA 1R3SA 3NQ7A 1H1NA 3AIRA 3BGAA 3AMDA 1US0A 1DL3A 4PUJA 3CH0A 1PTDA 5DBTA 5HWNA 2V30A 1I2PA 1C92A 2AMGA 1ZBVA 4AD5A 1OC7A 4CQ9A 2JF6A 1XW8A 1ELSA 1NY1A 3DFOA 5DY2A 4PMUA 1GW1A 1PHQA 4MM1A 3LMZA 4H8HA 4PULA 2BXZA 5HNNA 1PVNA 4LEQA 1XLDA 5J5RA 4JY9A 3B9AA 1OF8A 4U3CA 3H8AA 4ML4A 4L65A 1R3VA 5BNKA 2XZ9A 1I2NA 4S3CA 3IJ9A 2ISWA 5C55A 1TTIA 4U2ZA 1UKTA 1QNPA 4MNLA 2GUYA 2NUYA 3W71A 3KOZA 3QLLA 2NQZA 1OFEA 2X16A 4OT7A 2F61A 2FZ9A 4OV9A 4B5WA 2R1LA 3RLVA 3BGJA 3O05A 1TPEA 4Q8NA 4DN1A 2CXGA 4W86A 3N1AA 1XXXA 2YCKX 3B8TA 3RX3A 3FHAA 2ZRZA 5DY3A 4EKJA 4XO6A 2A79A 4LYKA 4FXFA 3LSBA 6REQB 1XIBA 3MANA 2OO6A 3TQPA 3IJDA 1Q45A 2WSRA 5H91A 4CCEA 4HA1A 4DAIA 3VI2A 1E1CA 5K2ZA 2UY2A 3PB0A 4ZQPA 3DHDA 1CNVA 1WUFA 3F2DA 3G77A 3ZJ7A 3A3WA 1Z89A 2DU2A 5D2VA 3ES8A 6XIMA 3N2OA 3OU8A 3PZVA 5F2IA 1SVDA 5C7VA 1QXLA 1H7WA 3CZJA 4NZJA 3LNPA 4QLJA 1KFEA 3CB8A 3WDQA 1AZ1A 1PDZA 1F07A 2QHAA 1A4LA 3AHTA 1QK0A 2VEPA 4G7EB 3HQ1A 4GYJA 3PJXA 1J0YA 1QMLA 5T26A 3ISIX 4JHOA 1O95A 9XIAA 1XQKA 4DX3A 2BSLA 2OO0A 2VWTA 1DTNA 3UA3A 4OECA 4HOWA 4XAYA 4O1BA 2E09A 3FIGA 3CO4A 2VQTA 1FWTA 2QVNA 5ABTA 2YSWA 4KFPA 3BJTA 5AZ0A 3T4WA 4MY1A 4Q4RA 4OUIA 4F9JA 3BQ5A 4W84A 3VKKA 4LYPA 2J9ZA 9XIMA 1XBXA 1H0IA 4X9SA 3SQLA 1UIOA 1BKHA 2V2CA 4EF8A 2O0TA 4C6FA 1CCWB 4CN6A 3H70A 3A4JA 2ZIDA 2FJUB 2BVYA 1V93A 3HZ3A 4F4RA 1TR9A 3GZAA 3U5UA 4H2HA 4TQTA 1OABA 3LCFA 3F1QA 2VD9A 4UUIA 1B3YA 1UP2A 2FGBA 1CGUA 4JKMA 5LHFA 3N17A 4A21A 9CGTA 4UOQA 3ARWA 4C1LA 4RKAA 1FFQA 4WRHA 4RNIA 3S8HA 1PWLA 5BW6A 4ICMA 2OYKA 3EMQA 4LAZA 2A85A 5HR6A 3NO3A 4DYEA 3A3XA 4LNCA 1TTPA 4FOJA 1J6OA 3GC4A 3JR2A 5CAKA 2QYGA 1F61A 4O50A 4BJHA 5D37A 1OM0A 4PMYA 3W0KA 2ZRWA 3QRHA 1HFBA 2JIWA 5C7HA 1R86A 2FDSA 1ME7A 4QITA 2FHCA 5CSYA 3UWYA 5HATA 4AU0A 1VFFA 3AICA 3QTPA 1AJ0A 5LIXX 4RDVA 3G0XA 3EOUA 2XN1A 1DJXA 5K4ZA 4AW7A 4ZO8A 3ALGA 3SEPA 5FACA 1GHSA 3NL5A 2UY5A 3LLDA 1KCKA 4O11A 4TX8A 4Y9OA 1CZ1A 3W26A 2XFFA 3GXPA 1Q7ZA 1QFEA 1W54A 3P80A 2GQ3A 4DM1A 4JFSA 1E1CB 1NVMA 1G01A 3W7EA 4EANA 2WCSA 3FNDA 4GWEA 4NJIA 1DKWA 5GQBA 3DGRA 4QXIA 1G6CA 2BY3A 3TW6A 3N29A 3ABSA 1ZBWA 2C6QA 1N55A 4IX0A 3BAIA 1O94A 2C71A 1GVSA 3VABA 2XDFA 3TJLA 2RGMA 4UTWA 2ZXDA 4FX7A 5CXPA 4HYRA 3H26A 5G4WA 3N34A 3TW9A 4F40A 1HW6A 3TYCA 1XRVA 3DKJA 1E0UA 1NAL1 1JCNA 1UJPA 4AHOA 3VKJA 4GIAA 3T8QA 4URIA 2QCDA 2PDGA 4OUEA 1F3XA 1XQLA 1O4UA 3LCXA 3QV8A 1SJBA 1KBKA 3MMUA 3KL0A 4DJDC 2BODX 3AXHA 3LZ3A 3NR0A 3AIQA 3VDBA 3E2RA 2P76A 4ATDA 1GORA 2XPKA 4ROPA 5DRCA 3IRDA 3SCNA 4QSHA 4UNIA 3MSGA 4FHAA 3SBFA 1FWRA 2E8YA 2HE8A 3W2MA 4WR3A 3P60A 4R7WA 4LVAA 1R9ZA 3DC8A 4AMCA 2OZ8A 4FK9A 3V3WA 4TTUA 1WNOA 2HK1A 4JPGA 4Y9PA 2OSXA 3B04A 4GJIA 4LCQA 2E6DA 1R85A 2NQ9A 3S3GA 4DUOA 1LG1A 3N6JA 1I8JA 2Z27A 3OBKA 3P74A 2V0TA 3OO2A 2G50A 3RU6A 2GOKA 2XH0A 1DWGM 4WXZA 3B9OA 3NL2A 3CHVA 5HANA 2VEIA 5A6BA 1GKPA 4LGXA 3IPWA 3LGDA 1PZ3A 3TTQA 3Q65A 2E28A 3SJ3A 2TRSA 1R2SA 4H8UA 2CITA 2Y6ZA 1PXGA 1I2OA 3KZPA 1I2RA 3DCPA 9RUBA 2BG5A 1ENUA 3L0GA 4HZ6A 4Q8TA 4IPLA 3CLWA 3EX1A 4QG6A 4PUEA 1MNZA 4AWTA 3RPMA 4UCGA 4ORMA 4BI7A 2YB1A 4X0VA 4GE8A 3RK8A 4JIIX 3QVQA 1AK5A 3M0MA 3HGRA 2ESCA 3MUY1 4FNRA 3LU2A 2GUBA 2VDIA 2QUMA 3S1XA 1GKRA 3LXCA 4IQJA 4NRRA 3WZ0E 4B5NA 1AW5A 3LN3A 2VENA 5A6JA 5T91A 5ECVA 1RA5A 3EOSA 3PF3A 2DW7A 3CB3A 1QHPA 4YWSA 1OHLA 4TX6A 4CU7A 2VR4A 1UBPC 1R3QA 4RW5A 4WJEA 4MJ4A 4WJXA 1OYCA 3NPXA 2W61A 2B7QA 1BGGA 2QLYA 1QOQA 1GW9A 3OA5A 5XIAA 1QI5A 3N2MA 5FOOA 3ARYA 5D32A 3TQKA 4V1YA 4PUKA 2EEXA 3DBPA 3GR8A 1VQTA 2YL5A 2X1SA 1AJ2A 1JYVA 5E5CA 2NV1A 4K1GA 2J8TA 2POTA 4NIRA 4Y2WA 2DZAA 5M17A 2QCDB 5HUOA 3MVIA 3PZ9A 3NGJA 3ZVHA 4CQ8A 3VOJA 3NEHA 2FHBA 3UG4A 1VKFA 1B9ZA 1UWUA 3UERA 4XTIA 4GKLA 3V0TA 2VFHA 4N02A 1OX4A 2QF7A 3P8IA 2ZXQA 3OGVA 2XFWA 3D47A 3KWSA 3MVTA 5T9BG 3EKZA 4WDTA 2WM0A 3UR5A 2FMNA 3BCDA 1XS2A 1MFVA 5A5WA 1G7UA 4JNYA 2V5CA 2Y24A 4FR1A 2CU0A 5AHEA 3LTPA 2J8FA 4NJJA 1W6TA 2VR5A 3C6CA 4QE1A 3A12A 3GU2A 3KZSA 3CV7A 3V75A 3VNKA 5FSEC 8XIAA 1IT7A 3R11A 1O60A 3VOCA 2QPUA 5C9XA 3M0ZA 3VGHA 3L7RA 1IZKA 3O6YX 1DIKA 1UZDA 5FL0A 1QR7A 3FXYA 3AMLA 5KETA 3CZEA 3P14A 4JL2A 3PP7A 2JEPA 4ZO7A 4Z1CA 4GKTA 4HYWA 2INFA 4QM1A 1M7OA 2OLSA 5AN7A 4PMNA 2X41A 5LXEA 4IGNA 4O52A 1GVFA 4V2XA 2DT0A 1UH3A 1PTGA 2F7FA 3DEQA 4MB4A 2QKFA 3EWWA 1VBGA 1T41A 2DVUA 2J78A 3TVAA 3UBPC 3E5BA 3TN6A 3ZLGA 2YCJA 5IBXC 1QT1A 3LGEA 4ZQMA 1V3HA 3KDNA 2PB1A 3M46A 5D4YA 2E1WA 2VFFA 4Y90A 3SQSA 2P0OA 5AC8A 3MI3A 3GG7A 4FI4A 3UFYA 4JYFA 4MADA 4YS1A 3KVKA 2C0HA 3VOFA 1S5TA 3NQ8A 3QGVA 5A95A 4UBPC 4PN2A 1BF6A 2H8ZA 1Y5XA 4W87A 2J7FA 7TIMA 4QEEA 3V5FA 2CLPA 5EKYA 1US2A 4TVDA 3AZTA 1BXNA 2Z1BA 1EX1A 1JDCA 5HWJA 1QRQA 2Z7KA 4CLMA 4B92A 2O55A 5HNTA 4Y8FA 2HS6A 2W27A 3C52A 1G4TA 3LLXA 1DOSA 3NYDA 4P8WA 5T8GA 3QQ0A 4PMRA 3CM4A 4O12A 2Y88A 1PKNA 5BWFA 3QC3A 1U30A 4YTUA 2P8CA 3EB3A 1TUXA 2GVJA 4K6AA 2ZX9A 4LBRA 3EPMA 3VIOA 3BAJA 5A8OA 1FWIC 2GPTA 3AIVA 3ICJA 1VFSA 1QNRA 4NX5A 3AALA 1J6PA 6TIMA 3T1GA 4MNKA 1RK5A 1JIBA 4XQ6A 4UOJA 2VZOA 3QMTA 2WJDA 4ILSA 1YQ2A 2G37A 3SCPA 4MPQA 1AH4A 1BG9A 4FPSA 4P8XA 3GHTA 3GTNA 3EX2A 2AQOA 4JTEA 4K8HA 4ADTA 4RV8A 5A6BD 1ZL1A 1KTCA 3T40A 3ZVHB 8XIMA 3N4FA 1MNSA 7ODCA 1W9BM 2Y7FA 4ECLA 5CPMA 3QEZA 2WYSA 2JFEX 4GLEA 3U48A 1EBGA 4L6DA 3BICA 3EEZA 1H60A 4D9PA 4QS5A 2Y85A 5CBBA 1K9TA 1QBBA 2PSNA 3L4UA 1DJHA 4PUNA 1E9IA 3EKLA 5JBDA 3WK1A 4LPCA 1KM6A 5DMNA 1MQPA 4HNTA 3MTWA 4WHBA 4D8ZA 4Y9AA 3RMEA 3S9IA 1CI1A 4X0NA 2YA1A 1QOXA 5LHEA 1YXYA 1ITXA 1N7KA 3GY1A 3WIJA 4XTDA 3TEVA 3WBEA 3GU9A 3AJ7A 4GNKB 4MB1A 3R94A 3MUAA 4TO8A 3W1XA 2IKJA 3V7PA 4D6EA 5I3FA 3SY1A 4O19A 3SY8A 3GG1A 5HXMA 1Q66A 4NF7A 4UFIA 4QROA 3P6LA 4DM2A 2G41A 1UZHA 4S1FA 1C7TA 2A4AA 2P53A 1ME9A 4B4FA 2VZVA 5J5DA 3TTOA 3TLLA 1JQXA 3RN6A 1DJGA 5HR7A 3NQGA 1DQWA 4XG1A 2GVYA 4Q6XA 1W37A 3UXAA 4RE3A 4GX9A 3TH6A 1EWEA 3NZPA 1OFQA 2OTDA 3DERA 5CSSA 4OBSA 4LVBA 1C8QA 4INFA 1VYSX 5LA1A 3WFAA 5HUPA 1PKMA 1W91A 1JVNA 4Z1YA 1OADA 2W5FA 3F5JA 4DWSC 1EDGA 4POCA 4C6MA 2X0HA 1GVEA 1ZTVA 4WSJA 4LUJA 5LKYA 3I3BA 4CD6A 4NI8A 4NNAA 3W88A 1CGYA 3KCOA 3CV1A 1KW1A 2QR6A 4L1XA 3PBVA 2WZIA 1QPOA 5IDZA 3Q2DA 3MHGA 3WUGA 1KFLA 3DFHA 2BGNE 2UY4A 5TBOA 3ZWTA 2IXVA 4DUWA 2F84A 4U31A 4V15A 4HNLA 1HL8A 3KBWA 2AGKA 1TE6A 2B4GA 3GNRA 4NT0A 3CYJA 4FXRA 1W9PA 4LAMA 4A8RA 2ZWZA 1B3XA 1VFOA 4DJDA 3UWQA 4S3JA 2HVNA 4DO7A 2Z2BA 3WEOA 3HGOA 4E8CA 4L6OA 3F2CA 3UVIA 4AZ5A 5HJYA 1EHAA 2WCAA 4QG9A 3CZLA 3IUIA 4DXVA 3VNYA 2PZNA 5D2TA 3S9ZA 3GYCA 3DECA 4JCLA 3WD3A 3SFWA 4MAVA 1Z44A 3VDHA 1M7PA 3QQ1A 3W83A 1UUQA 4WKFA 5IFPA 2Y2WA 2YL8A 1UWIA 2VT0A 1UR4A 4O16A 3NZGA 3L4XA 3EBVA 3SN0A 3TSDA 2I9EA 3CHEA 2RJHA 3GG8A 3C2OA 2R1KA 1SO6A 2GL5A 3PANA 3VUSA 3CPGA 2Z1VA 4WKAA 4B2DD 3BSGA 4DO4A 2CETA 3BMWA 3VUPA 3W7LA 4TU1A 2R1MA 2WJZA 1BVZA 2ZVIA 3IIXA 2RAGA 4Y96A 1GOWA 4OV4A 1KRCC 3MO4A 3W24A 1EJSC 1EGZA 5C71A 1BWKA 1QI2A 4EX4A 1KBIA 4Q4OA 5A6LA 4JKKA 2WK2A 3IJ7A 4HJWA 1BXBA 1OIMA 1TCMA 3P5YA 3MDWA 5HPCA 4S39A 3UA4A 3U2ZA 3KVLA 1H51A 1VPXA 4JQ1A 4BQ2A 1C9WA 2H6RA 3P0WA 5EBUA 4A3RA 2Z24A 4Y8EA 2NLYA 3C61A 3HJZA 1E6QM 3GW3A 3YPIA 1JCTA 3ITOA 2H90A 2POZA 2HRWA 3BWWA 1NWSA 3NPVA 2J8GA 3VGFA 3FJNA 4KQNA 2VC9A 4UTUA 4NQ1A 4A2RA 1NOUA 2O92A 1XIJA 2JK2A 4OJYA 4YWIA 3QQWA 3RFAA 2V5JA 4DYJA 2MANA 2PDXA 2Z2UA 1E56A 5BWAA 5CPQA 5G1YA 3HMCA 3MS8A 4A2SA 2EXOA 3MP4A 3PBUA 3UJEA 2WSQA 3OGRA 4M80A 5F4SA 5H1WA 3TKFA 3BLOA 4WEVX 4GVIA 4WCJA 4LAKA 4MUZA 4NNCA 3TC3A 1LWHA 1O1HA 2C15A 1TFVA 4MY9A 1SFLA 5KMYA 4K7VA 1PAMA 1S2AA 2DZUA 4JTLA 4MYAA 8TIMA 1UUMA 1HKJA 2JALA 2NQ5A 1JD7A 3GDTA 3LV6A 3AS1A 1V4YA 4MHBA 1NDWA 3VPLA 2VI0A 3O06A 3VIIA 4AIOA 2R1NA 3A9BA 3IWPA 3S9YA 1BQGA 2VUNA 2NX1A 4TUFA 1QO5A 3GH7A 1NDZA 3GVWA 1ZRQA 3LBCA 1QNSA 4LY4A 3W6LA 2ZZ1A 4MKSA 1JRBA 2WAGA 3QYQA 4DJEC 2X0SA 3PBYA 2J7HA 1UYQA 2E0PA 3BLFA 4AX6A 1XH1A 1HO1A 3AJXA 4LALA 1RP8A 2OELA 4B5VA 2QULA 2PUZA 3URAA 3MUIA 4H19A 1G0CA 2PBOA 3AHXA 3INPA 2EJ1A 5HQEA 4OBRA 3B0XA 5XIMA 2FZDA 1XBYA 1VBJA 2VGIA 3CK5A 3W29A 4M24A 4CU8A 3NXLA 4YL2A 4V33A 2RJGA 2XG9A 2Y62A 2ZDSA 5BRPA 4HMNA 3F4DA 3H4WA 3AZRA 3TK7A 3PN8A 1XH0A 1EIBA 5FF3A 5G1TA 4JFWA 2XSAA 3AQUA 4R5EA 3RO6A 3UXDA 3CAKA 1Y65A 2F6KA 3SRHA 3BXWA 5IBXA 1EB3A 2Z6JA 1AL7A 2BASA 2Z25A 1S5MA 1W1PA 2WM1A 3A6OA 2DEPA 4LJ3A 1B57A 2ZZ6A 4BQ3A 3BZGA 4MMWA 2TSYA 3ELFA 2VCBA 3UGVA 3HV9A 2YGYA 3AUJA 3LZ5A 4I7VA 5BROA 3ABQA 1JCLA 4BF7A 1H50A 4DJDD 2PGEA 1VPQA 2PLCA 2BMBA 3A24A 2OLAA 4KPLA 1BLIA 1X6UA 2FQIA 4GMEA 4DHGA 3UXKA 1TMLA 2GVEA 1HX0A 1VIZA 3KOXA 1IT8A 3F2BA 2ACSA 3BK0A 4HCLA 2EPHA 1CGVA 1Q5MA 3WD0A 2C79A 1H0GA 3BANA 1O12A 2A7PA 2VC7A 5FJUA 3W01A 1XM3A 3DC0A 4RPPA 4YPJA 3RR4A 3GVVA 4PTWA 2OPJA 3RGTA 3SY5A 1LWJA 3L0KA 3WLHA 4KEUA 1E4NA 1UD8A 1Z48A 3GXTA 2R24A 4XB3A 4QR6A 3SIZA 2NXHA 3II1A 3TTYA 1RD5A 3XINA 4PRWA 2A1YA 2PFHA 3AMGA 4DPPA 3CV6A 4AD1A 3TAOA 4CQBA 1FXQA 1W31A 3GAYA