1V93A

5,10-methylenetetrahydrofolate reductase from thermus thermophilus hb8
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
292
structure length
292
Chain Sequence
MKIRDLLKARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-Methylenetetrahydrofolate reductase
publication title Crystal Structure of 5,10-Methylenetetrahydrofolate reductase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 112
structure length 292
sequence length 292
ec nomenclature ec 1.7.99.5: Transferred entry: 1.5.1.20.
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1v93A00
3FSTA 1B5TA 1ZRQA 3APYA 4JNYA 1TJ0A 1ZPTA 1V93A 1TJ1A 3APTA 1ZP4A 4JNZA 2FZMA 3FSUA 1ZP3A 1TIWA 3E2QA 3E2SA 3ITGA 2FMNA 2FZNA 1TJ2A 4O8AA 3E2RA 2FMOA 3IJDA
chains in the Genus database with same CATH superfamily
5FF2A 3D47A 4Y9PA 4AMCA 3TQVA 1M1BA 1VJZA 4PUEA 4GACA 2HTMA 2JKAA 1H1NA 3IARA 1WQ5A 3KVKA 1DE6A 3GNPA 2BVWA 4PA8A 3LXCA 5CAKA 5C9ZA 1OABA 4KRUA 5ABGA 2NSXA 2QKFA 3WJSA 5CEWA 1MZRA 5KTLA 3KUMA 3W29A 1YEYA 3T0BA 5FL0A 3N73A 2FVKA 2OLSA 2ZZ2A 3GW0A 1SFLA 1WUFA 2QCLA 4V2XA 2JKPA 1X97A 3L4ZA 3ONBA 1BTMA 3OVRA 1WDQA 1Y65A 2PLMA 5K2ZA 4HCLA 1OC6A 2I7GA 1Q5MA 4IMCA 2FTPA 5DANA 1DXIA 5EYWA 3CT2A 5FF7A 1GPFA 3S5SA 4XSMA 3FYYA 3PK7A 2DDXA 3T8QA 4FI4A 3A3HA 3A4WA 3DBPA 3EWZA 1CDGA 5A1AA 1VCFA 5I3IA 1XDLA 4GUFA 2R82A 3PB0A 4MWAE 5FCZA 3E0WA 1QAPA 4NZ4A 1NY1A 4M6VA 4IX0A 1TWIA 2OXNA 5I77A 5F1UA 1TTPA 2PDBA 2UWFA 3AALA 4MWAD 2ALDA 3Q45A 4RNIA 2X0HA 5BZAA 1KTNA 3DAQA 3VCCA 1E0UA 3VA8A 3TYUA 4X9SA 3P6LA 1J0IA 5H8UA 4IFKA 1QUMA 2V9DA 1J93A 1REQA 2VC6A 3W38A 2FHCA 3TJLA 3T07A 1A0CA 4J40A 2XHYA 4E2BA 1VBRA 2WW5A 3M0MA 4GI9A 4ATDA 4OU1A 4KEVA 3LMYA 3H21A 4I7VA 3FAWA 3N29A 3T0AA 1I2QA 4GNJA 4QM1A 3QLLA 3QHOA 2FVMA 3R8HA 5EMLA 3L0GA 3UWYA 2C0AA 2XN0A 2QNEA 4ZO6A 3CIVA 4B16A 4IMAA 4QG9A 1X7IA 2OO0A 3GTIA 4GC4A 2IPJA 2ZX6A 3G3MA 2WSPA 3BPWA 3Q67A 3MSGA 3ARRA 2BODX 5FJTA 1ZJBA 3Q94A 4H9UA 1FBAA 3B05A 3L5AA 2JEPA 1MDLA 2DT1A 2GLKA 2C71A 4BZYA 1FWGC 4KETA 1AMYA 4DXKA 3GDMA 4DUXA 2GDQA 2WZMA 3TJXA 4QE5A 4B3ZA 2WK2A 4DXVA 3LN3A 1XISA 8XIAA 4O54A 3GXPA 3EMQA 2O92A 1ADSA 4KCVA 3M5ZA 3EWDA 1WYIA 4REQB 2XZ9A 4NZ3A 4Q8UA 2H8ZA 3LCWA 4TOQA 3UA4A 4U2YA 2YCLA 3UF9A 3PUDA 5EBAA 1Q6FA 1X1OA 1XYMA 4UQDA 1UOKA 4AZ6A 3VNDA 2X1SA 1UIPA 5REQB 1UWIA 1Q8AA 3BARA 5F2IA 5E5CA 4NAEB 1GZGA 1YADA 1PDZA 4MB3A 5D9NA 4I9JA 3NZQA 3LHYA 3AXIA 1RA5A 3WBAA 2P0IA 2YA2A 3A47A 1G4EA 4Y6GA 3LGGA 1PHWA 2WSRA 4XBJA 1VJIA 4WGXA 4GJIA 4K8HA 3ZXWA 1QNVA 3QJAA 1LQ0A 2E77A 2PDPA 1DTUA 1ICQA 2WWDA 2W79A 2ISSA 4CD4A 2GSJA 3ME3A 1B1YA 2X41A 4LAUA 2W9MA 3E6EA 3DIPA 3XISA 1ZZMA 5AHLA 3K4AA 1EJXC 1PBGA 1RLCL 3SCSA 4K37A 3V35A 4AD4A 4CNPA 1TE6A 5IBXC 2BY1A 1FWFC 4HA4A 3VE9A 3CUXA 3EPOA 3MCNA 5IHSA 1BXBA 4A2RA 1QI2A 1O5KA 4W7UA 1VIZA 1A3WA 4I9MA 2P3EA 4QRNA 3HG2A 3BG5A 2DV0A 4PEKA 4B5NA 3G1FA 1S5VA 3T42A 3WDJA 2CLLA 4EAYA 3RHGA 1UD2A 1U22A 3R12A 3N4FA 4EX4A 3MPGA 2ZUMA 5A2BA 2WZEA 4ZOCA 2QUNA 4PH6A 5JH2A 3P5ZA 2YBVA 1VEOA 5M1TA 1L6SA 1PKMA 3GFYA 2FTYA 3F4NA 1QK0A 1B3YA 1AMKA 4OV9A 1GTHA 1W1ZA 3AHTA 2YZ5A 3TC6A 1XLFA 3W6YA 4LAKA 5I6SA 3BURA 3NL3A 4HPGA 5IFTA 1WDWA 1HL8A 3MBDA 1QW9A 3WQCA 2VEGA 3CWNA 1YPXA 1OB0A 3RXZA 4JTSA 3E0IA 3WF1A 1YRRA 2A79A 1M7JA 4Z2IA 4A8NA 1O94A 3MSRA 5JIWA 2E67A 1KFJA 3GDKA 1TCMA 2Z24A 4QCEA 2FZBA 4NAFB 1BRLB 2AL2A 1C7TA 2GWNA 1V6TA 3DFSA 4E2DA 3OQEA 3UNTA 5IHRA 1JGIA 1U5VA 2B7OA 3CU2A 2PLJA 1OM0A 2G96A 5D38A 3XINA 2B31A 4RUBA 3VVGA 3UESA 3W28A 2ZZ7A 3VXGA 4H8UA 3W81A 2A7RA 4AD2A 3TJIA 1A0EA 1UZDA 4YN5A 4A6GA 3EEZA 4EXQA 3NL2A 4GXMA 2FTWA 4RZ6A 2HPIA 3CV2A 2HS6A 1JI1A 3DG6A 3LNPA 1BEUA 2NQJA 4PUUA 1KCKA 1SPQA 4EKJA 3KHJA 5IFPA 4QE1A 3VIFA 1FXQA 2EEXA 2NV2A 3CXOA 3AJXA 4O11A 4KGJA 2PDUA 4JYFA 3WUFA 5BOEA 4IMDA 1XBXA 4JYDA 3OBKA 4ZO8A 4BY3A 4HZ8A 6XIMA 1MEWA 3GTNA 1H49A 1T8QA 4G1KA 1M6JA 1OC7A 2DGAA 3ARXA 4JTLA 4Y8EA 3WQWA 1VBHA 2DUXA 1DXFA 3WMSA 1Q85A 2J8TA 1PVNA 4ZSUA 3L68A 1ADOA 1QPQA 3S1XA 3P14A 3O8AA 4Q8QA 3GU2A 3VCRA 4S1FA 4ZL1A 4AEEA 5DXXA 4YXGA 2PDYA 1KFLA 2PP0A 3MUXA 4G1NA 3AUOA 3OU8A 2XM2A 1KBLA 4EANA 4QLKA 1B3OA 1IQ8A 2PEVA 2CBIA 3QHNA 3KWSA 1TJ0A 3VNZA 2VR4A 4YWSA 3S6TA 2DP3A 4UQCA 1K8CA 4FA3A 2FVLA 2ZRXA 3OTRA 2BNJA 3FA5A 3WQDA 4GQGA 4NZJA 1V77A 2J7FA 2VRKA 3KVMA 3VDAA 4PTVA 2WNQA 4NZFA 3A6OA 5G1MA 5B7YA 3BGGA 1IXNA 1XKYA 3IJ7A 4GABA 3W2MA 4M56A 2EPOA 1OX6A 1V4YA 4J1OA 2ACSA 3D5HA 3PSWA 2VO5A 2J6VA 2WMIA 1FP8A 4H4IA 3NGJA 4JFUA 4M6PA 4AZGA 3WLMA 4HMNA 1XYBA 3GD6A 2JBMA 1EJWC 4YJ5A 4BCEA 1US0A 4DUVA 2BXVA 2WKGA 1JYXA 3AHYA 4HK6A 3EX4A 4GGHA 1ZGDA 3UU0A 2ZBTA 3RRAA 3WF0A 2IPWA 2VT0A 2O9TA 3IJIA 3EAUA 4QDWA 4O0KA 2H9AA 3NSMA 4RDWA 2AAAA 1NJJA 2PLKA 3T08A 2J25A 3WMBA 1ECEA 3GRIA 4F2UA 3LCIA 1EP3A 2HBXA 1P6BA 5HMSA 3QPEA 4O14A 3VDHA 2W63A 4FLRA 3GAKA 1LROA 3GUGA 3MUZ1 1MXSA 1DJGA 4OVXA 5RUBA 5AECA 3HGJA 3PC0A 3WH5A 2YYUA 2CXGA 4YHEA 2QR6A 5I00A 3LHUA 2E1WA 2OLAA 4ZCWA 4FO4A 5LHFA 3H4XA 4LJ3A 5I3KA 2VFFA 2YJQA 4MDPA 3OEXA 4PN2A 3MMDA 4AZ7A 1HX0A 1OT2A 1GQNA 2HPMA 4J4KA 1P1XA 1AH3A 4IQLA 2BVTA 3IACA 4HA3A 2CLFA 2PDXA 2HVNA 2WHMA 3CPUA 4HSHA 5CZ0A 4A3HA 3MI6A 3W1AA 3THAA 4JIQA 1NFBA 4PZVA 3QZAA 3EZ4A 4HN8A 4M29A 3K46A 4QS6A 3II1A 3KBJA 1KFCA 2YL8A 3EPMA 3L4UA 1H51A 2C13A 2V2DA 3HG5A 4KQNA 4O16A 2XIIA 1HKWA 3GQYA 5K3VA 3I7QA 3TTOA 2ICSA 2RDXA 1ZNNA 2Z28A 2XFWA 3BV7A 5KZ6A 4FIRA 3F4CA 2F8QA 3S5OA 3UPWA 1FFQA 3BDKA 1RR2A 1X8FA 1FWDC 1UC5A 1M7OA 1HIZA 5J04A 3WFZA 2VD8A 2VX7A 1JR1A 3TC3A 3W7QA 4FP1A 2ZDSA 3ZIZA 2PF8A 1KXHA 3E9AA 2D24A 4JTTA 4Y9MA 5D33A 2WSYA 3I65A 3PUGA 7XIMA 5A6TC 1TREA 3RK8A 4QBXA 3LGDA 3T81A 1Z48A 3S2LA 2E6FA 5EU9A 1DOSA 1HL9A 3DYPA 1XXXA 1E9IA 4R85A 4US5D 4JEJA 1F3WA 1PTDA 1E0XA 3ABRA 4WVXA 1POJA 2JGQA 1GW1A 4TTUA 2HSAA 1RPXA 3VINA 3LYEA 3FSUA 4OKDA 1RVKA 5GNXA 1EBGA 4GKLA 1V6YA 2IW0A 3F2CA 2XGZA 4UFMA 1B3ZA 1O1HA 1CCWB 1NQ6A 3OHIA 5GNYA 2QJGA 3WNNA 3MY9A 2E09A 3VGGA 2AMXA 3LHVA 4QSFA 2TPSA 2G8ZA 1UH2A 2O55A 4QX4A 3MP3A 2UV8G 5DELA 4JHMA 1W2PA 3AS1A 1W32A 1G01A 1YBQB 2WM1A 1PKYA 4QGCA 4U3CA 2X8RA 2XSXA 1TPUA 1LT7A 1VYRA 1NF0A 3SSZA 4J3VA 1UWTA 4W7WA 1SFSA 1KFBA 2GGHA 2BGQA 3CQHA 2C19A 1TUFA 3PZIA 3VMPA 2NUWA 3TMLA 1XC6A 4C7FA 1EJRC 3AOFA 4O1EA 2IQ0A 4M7TA 6PTDA 3L4XA 4XZIA 1E55A 2WAGA 1JAEA 3RCYA 5I2UA 2PZ0A 1YPIA 4J3SA 4Q8OA 2X40A 4NG3A 1IYXA 4WCJA 3S9YA 3NAVA 3UR8A 5CAHA 3UBPC 3QR3A 4BEQA 4WKHA 4DAFA 4JTKA 3W2NA 3L5LA 2PP1A 2VMFA 1ZUAX 3QVQA 3QV7A 3N04A 4J9JA 3ATYA 4LPCA 1PHQA 2I9UA 2CLEA 6XIAA 1XLAA 3MMUA 1T0OA 2X09A 1SFTA 1YNQA 4G7FA 4V28A 3G1SA 3MBFA 3PSVA 3W7OA 1GOWA 3AI0A 1R47A 2QCDA 4GH3A 1K4GA 3PJWA 1WXYA 1T8XA 3V36A 4DYEA 5C9WA 3CWHA 4WY0A 3W7DA 1V3IA 3UYIA 4FLOA 2CZVA 1HJWA 4S3KA 4HOXA 5IXEA 4S2BA 4QCFA 1XGDA 1ZS2A 1QHOA 3NQ2A 1OX4B 1TV7A 2P88A 3DERA 5G4EA 1CYGA 4KRTA 3R8RA 1XRFA 3AMCA 1EKOA 3UVAA 3VOCA 3RR1A 1EUNA 2GDUA 1C92A 1DIDA 1IV8A 3HOJA 2CBJA 1Z42A 4AC7C 3WEOA 1KKRA 1AVAA 1Y5XA 1RALA 3W1UA 1ZJHA 1I1XA 4O50A 4DO6A 3W88A 1MO0A 4NX0A 4J2PA 2QAPA 2G4JA 4B2DA 5LIWX 2YIHA 1OYCA 1PZ0A 4UFIA 3CUFA 4X3ZA 3VFLA 5IOBA 1UA3A 2FJUB 3GWQA 1K8XA 2VGGA 5AOUA 4QG6A 2ZFAA 3HV9A 1QBBA 2BHUA 1UD4A 1EP2A 1ML1A 5KZEA 1LQ2A 4C5ZA 3JS3A 4NU7A 4PE8A 4A05A 2Y63A 2BWGA 4J28A 2EG6A 4UCGA 1KW1A 2OTDA 4UCFA 1LL6A 1DYSA 1E15A 4WOZA 5AB3A 1F5ZA 1ODZA 4OOUA 3WUGA 1AZ2A 1AJ0A 3CT7A 1AA1B 1YMYA 4CN4A 1S39A 1EF2A 3BJSA 1RD5A 2I16A 1VFOA 1BF2A 3ABZA 4NL1A 3ABQA 3IAQA 4IPNB 3GHRA 2PP3A 5A6AA 1B4KA 4GGBA 1BVNP 3I7SA 3EA3A 1PX4A 1CX9A 3UJSA 4IJBA 1AW2A 3N12A 5GPRA 5A8PA 2J8FA 2ZRVA 1Z6KA 4RZ5A 5DMYA 3ANYA 3H12A 4JICA 1IE7C 4BWLA 2DZVA 1M3UA 2Z1SA 1LBFA 1H50A 3N3MA 3WBYA 3L4YA 2C7FA 1XCFA 4JCMA 5BOFA 2DZWA 2FGZA 3VDBA 1GNXA 4Z42C 4C90A 1Q4NX 4AW7A 2O9OA 3IIPA 1KM5A 2D3NA 1WKYA 2OJPA 3HU7A 1S3HA 3G6MA 4GJ1A 4GLEA 1DWIM 1VRXA 3LCFA 3O63A 5DCBA 4AWEA 2VOTA 2YBUA 2DW7A 2E68A 5CSRA 1L2UA 2GSHA 3PULA 2G97A 1IEQA 1DWJM 1GG0A 3T0DA 5D4YA 2HCVA 1L8NA 3SUSA 4LXFA 4WJXA 3STCA 2AKMA 1ZU8A 1O68A 3QW3A 2J27A 5B80A 4XB3A 2ZUTA 5F1VA 3STGA 5KMYA 5BMWA 4IG2A 1ZBKA 4A29A 3PNUA 4XKYA 1VEMA 1SYTA 3T40A 4JEQA 1O12A 2ZUVA 2GWGA 1QWGA 1ONWA 1GKPA 3THUA 1REQB 2XSAA 1ISXA 2DIJA 2VZSA 3V3WA 5K9DA 5HPOA 3N25A 1E40A 5LSMA 3T09A 4JFSA 2YDAA 4A3YA 4JX4A 4UIOA 4C6DA 4UTFA 1HFBA 1H2JA 2EKCA 2TRSA 3OIXA 3RPDA 2VEPA 4G7EA 5EMJA 4ZXOA 1J5SA 3WK0A 3LLXA 5TBOA 5EFFA 2WC3A 4CU7A 3KTCA 2YA1A 3UG8A 1XLLA 2B4GA 3CMFA 2G41A 2IKGA 3EWCA 1GZ1A 1XLJA 3N2MA 2B0MA 2J88A 4N6EA 1OFRA 4FPSA 3KRUA 3ITGA 1UR2A 4BF5A 2GJLA 4EXAA 1ZY9A 1TB3A 2CESA 1MW3A 2ZX7A 3P8JA 4NQ1A 2O7QA 2NLYA 3H2CA 1PWMA 1PYFA 3VIOA 2E25A 1UZ1A 2JGYA 1ZCCA 4NJJA 3H7RA 2J7DA 2R1NA 4D6DA 3H2EA 4H01A 3GAYA 3GFXA 4KGLA 1NQKA 3LCLA 5JIPA 1V3KA 1VFLA 1CXEA 1IWPA 1UWUA 1PCKA 2J66A 2PTWA 3QMRA 3RG6A 4A4AA 2J78A 2HE8A 2EGZA 2QHAA 1ZP3A 3NQ7A 5E09A 3KS6A 3POHA 5FEZA 4K8GA 2I9EA 3BAIA 2YPIA 4N02A 1J0KA 3RGTA 3TIMA 2IPFA 4GYPC 2YCLB 4LBUA 4HMDA 3B04A 1M7XA 1Y5VA 5HK4A 4FF7A 3AIVA 2VVSA 2WVUA 4H00A 5G4WA 2ZDRA 1GONA 5SWUA 1YTEA 4PYSA 4LF1A 3PPCA 1GHSA 4FAMA 1Q2SA 2YB1A 3KCOA 5A95A 4O1AA 1KB3A 4JL2A 4JIPA 2WXDM 3ARQA 4IQJA 2WHKA 3WMCA 4PSRA 3HA1A 3UZ5A 1XLKA 2PWDA 4E5TA 1HNYA 3HF3A 1OFQA 5JVLA 2VDHA 5I06A 4J7RA 4K6AA 1MFUA 4NNBA 2YXGA 1JRBA 5L6UA 1YQ2A 4PODA 5I02A 4UTHA 3QSTA 2GUYA 3WEZA 1J0YA 1DTNA 4AZBA 1TPH1 2WMHA 2X7VA 2PC4A 2YL5A 1DJNA 1CECA 3EX2A 2Y5EA 2Z26A 3UJEA 4AIEA 2QMJA 1OJXA 3MP5A 4LALA 5CZSA 4AZ5A 4XK2A 1ZBWA 2A4AA 1HGWA 2ZX8A 4QR6A 4HQVA 1ZAIA 3ZLHA 3R2GA 3EMCA 3BCJA 3NPVA 1N8FA 2W62A 4MF4A 1JL8A 1NWRA 4MLJA 3L2IA 3FVDA 2A3HA 2YFNA 2PS2A 1YNYA 1Z41A 5A5WA 3WQFA 4DWSD 3TFXA 1VEPA 2EPKX 3UQNA 3EDFA 1JULA 1QI3A 2QCNA 3L23A 1XC4A 2R94A 4DO7A 3V16A 3GR8A 5AKQA 3JZEA 4O53A 3VKDA 2FJKA 1QT1A 4XUGA 3PF3A 1B31A 1GOMA 5LHEA 2NXHA 4F79A 3EXSA 1IR1A 3RMEA 4HA1A 2X1IA 3OJGA 4MWAA 4MTVA 1T5AA 3E5PA 1VAHA 5BMXA 1TCDA 3PP7A 4DRSA 1U83A 1XIFA 1UKPA 3R0UA 1S2TA 3RNDA 1EO5A 3W26A 1OX5A 5BXPA 2QUTA 1K03A 3RCMA 4UQ9A 1JD9A 3IJ8A 4UNKA 2AL2B 4E4FA 5AVNA 2UY5A 1W8SA 4YTUA 3B8TA 4O13A 4P2VA 4XD4A 2AQVA 4GX9A 1EX1A 5CBJA 5FF0A 4Q8TA 3HPZA 1OVDA 3CTTA 3IJ6A 1B90A 2HVMA 3GXTA 3KX6A 3ZMRA 4DUOA 2QV4A 2YCIX 1JDAA 3WQ5A 2Z2UA 4GISA 1O60A 4UWMA 3MWCA 1WXJA 1LG2A 4DXXA 1CLXA 3KBVA 4ICMA 1L2QA 1NWTA 3PZGA 4PMNA 4AD5A 5JQ9A 3AU2A 1E1CA 3EDKA 3UWZA 3NEVA 1R3WA 5HMEA 1OD8A 1U2YA 4AXKA 1UH3A 2VFEA 3WQPA 3M0VA 3ARZA 4C6QA 4JN8A 3OZPA 1ZTVA 1MFVA 5D37A 3IANA 3P3BA 4RE3A 2CHRA 2OEJA 2WM0A 2OO6A 3VFCA 1K7XA 3UPBA 4NXKA 1AL7A 4LS1A 3VGBA 3G22A 1IT0A 2YZRA 3BSHA 5E0FA 1N7KA 2HE5A 1E3XA 1NELA 2X1RA 3LTPA 5C5YA 1L6FA 3KHDA 2YYTA 3AYVA 4ZR8A 4TVCA 3DGRA 4ERAA 3DUGA 4QJ3B 1EC9A 3AMKA 4U3AA 1V51A 2WLYA 3PPHA 2XTKA 5G1TA 4W85A 4F0LA 3WDRA 3BZGA 1FA2A 4IGHA 4N4QA 2NSOA 2DZUA 1JUBA 3W71A 4ZQOA 2IS7A 1UR8A 8RUCA 4HOZA 3G1VA 1X6UA 4GNKB 4TQTA 1LRTA 4O4WA 4NIRA 1MW0A 3OA3A 4Z1BA 2WMIB 1M7PA 3GSMA 4LUJA 1W5PA 3GYEA 4PEEA 2NLIA 3HTWA 4K36A 4BFAA 2ABAA 4E6MA 2CZFA 1ELSA 4NILA 1F2JA 3S3GA 4HJFA 2Y2WA 1OWQA 1A3HA 2BXZA 4ZQNA 1EA9C 1NARA 2IQDA 3M43A 1K9FA 1W2VA 4YVPA 4QAWA 3VILA 4DO4A 3U7BA 3AXHA 1UKSA 3MS8A 5CGQA 4K38A 5CZJA 4H8NA 2EPLX 3H24A 3LDVA 5I24A 1B0IA 4TX9A 2H9AB 2VEMA 3W53A 1M03A 5ABEA 2ZADA 2Y8VA 1EB3A 1F61A 2PLCA 2AQOA 2XSBA 5C70A 4HNNA 1XW8A 2I5QA 1A50A 2F7FA 4KT2A 1SZEA 1AQHA 3DECA 1D3HA 3BQ5A 4I7UA 4EIVA 3KM8A 1EL3A 4QDPA 1AH4A 3BW2A 3DHDA 3LRMA 5AC5A 4IQDA 5H8PA 1W17A 2ADAA 2IQTA 2Q01A 1OY0A 4PFHA 3GNRA 2WC4A 2JKEA 3BW4A 2BLEA 1XIIA 4PMVA 4H6KA 2I57A 3WLJA 2VCCA 6TIMA 5HBFA 4LNCA 3ZFHA 1GJPA 1WDRA 3W25A 1VFUA 1A53A 1LWIA 5HNRA 5TAOA 4LF2A 3NQGA 1PJ9A 4UC5A 1UYQA 2NQLA 1T96A 5LXEA 4W84A 5I3DA 1R3VA 3JUGA 3AIEA 3IIZA 5CPQA 3QOKA 2Y8UA 1F6YA 3W73A 1NM9A 3TYAA 3TOPA 2CC0A 3BJFA 1UR4A 1V08A 4ES4A 4UTIA 3LNMA 3QGKC 2BS9A 2DORA 1DKWA 1XRTA 4Q7NA 2HROA 3NQCA 1DV7A 5LYRA 1D8WA 1PV8A 2W61A 2YW3A 4Q4PA 1BWLA 2IXVA 3WJWA 1C3FA 5I79A 3GX9A 4GI6A 2WMJA 2E4TA 1TV2A 1VBUA 3B9DA 3MSYA 3F4DA 5G5IA 4HMCA 1X6NA 4MUPA 4Q4KA 4JIRA 4YTRA 2PDQA 1GW9A 5D32A 3JRKA 2D22A 4C6MA 3R79A 4CNUA 1J11A 2VJXA 4XAFA 4LVGA 4ADSA 3B03A 3GH7A 5FAGA 3ZT7A 3L9CA 3FEQA 3SCQA 3ZJKA 1UQZA 1FX6A 4UNIA 1L0PA 4LYRA 3QPZA 4LCSA 4CQCA 1V5XA 4H6RA 2W27A 4DJFD 2C18A 1LUCA 3NZPA 4XZLX 3V18A 5KZDA 4Z2JA 4BQ2A 5PTDA 1VZWA 3U57A 1K8YA 4A35A 4AX6A 2VX6A 4NKCA 3S8HA 3WK3A 1HJVA 3CUGA 4HKPA 4LAZA 3BMXA 3VOFA 3FHAA 3WENA 4DIAA 1IXPA 4XG1A 2H6RA 3A22A 4Q8WA 5H6HA 3HMJG 1WKEA 1R38A 1JF5A 2GK1A 4DLMA 1Q6CA 4CQDA 3PS7A 1BKHA 3QBUA 4XQ6A 1HP4A 3VC6A 4F3HA 1EPVA 3PZNA 4LAOA 3SJ3A 2Y85A 3VNMA 2XG9A 3CGTA 3MANA 4FOKA 4GQQA 1J2WA 3GKAA 4F0HA 1YDVA 1AG1O 2QDDA 4PCPA 1M5WA 4MZ1A 1CZ1A 3TV8A 3H23A 2Z2BA 3GZ3A 3PTQA 1EWEA 3ZM8A 1VBGA 4MOZA 3TFCA 5FJPA 3C3UA 2XJ7A 4LYKA 2BGNE 3OZMA 3EX1A 3LV5A 5I23A 2V67A 1KR0A 1TX0A 4YCPA 3BAWA 1MVYA 2PE4A 4X60A 2QJMA 3WNOA 3B0PA 1R2TA 4AF0A 3U3HA 1T41A 2A7PA 3L7RA 3WD0A 3GNOA 3YPIA 4WKFA 3SB0A 5EPDA 2KX9A 1FWTA 3O16A 3R4IA 3DHPA 1W1PA 3WNMA 3CUZA 2QF7A 2ACRA 4W89A 5EY5A 3IGXA 2F84A 1V6WA 1TPWA 2WV8A 2OFJA 1V6VA 5XINA 1XBYA 1ISZA 4EACA 3LSBA 4H6QA 1R46A 5E1QA 1Q6RA 3MMTA 3BLPX 4B3KA 2BGSA 4W86A 4IIGA 1RD6A 5HJYA 2CHNA 2VTFA 4DHGA 4LFYA 3OW1A 4PUMA 3M64A 4LU0A 5LIUX 2AQWA 3RN6A 2ZE0A 3I6EA 1WE5A 4ZXLA 4V1YA 2HK0A 4R33A 4GBDA 5D05A 4DJED 3ZJ7A 3DFHA 4LOCA 1WAWA 1O6IA 4P8WA 4Q22A 4BF7A 3TMQA 3MKCA 2ZTKA 2OSWA 2RDTA 2OYKA 1SQ7A 3MTWA 1WO2A 2NXGA 3VUPA 4IFOA 1W0MA 5GJNA 4LB4A 3RRXA 3W7LA 3C0LA 2DUZA 3MI2A 1LM1A 2A6LA 2VX4A 5AC8A 1TV3A 5F4SA 1SJBA 3TN6A 3TSDA 1OCQA 1SGJA 3TWBA 3RPMA 4HK5A 2XGIA 4GXPA 2J9ZA 3WDIA 2O0TA 4JTDA 4NJGA 4UQEA 3QSRA 2J75A 3POCA 5HQMA 1MWOA 1EZ2A 4FALA 2CLIA 3GHUA 2BY3A 3SCUA 4DZAA 1IZCA 2V3EA 2PTDA 3TZNA 3MO4A 2QCGA 1TPFA 4M8UA 4MNKA 5C8BB 1I0BA 4MYXA 4ZB0A 3GXIA 4D6FA 3P80A 1ENUA 2OZ0A 1RCXB 2PFHA 4ZVJA 3GUWA 1CWYA 1EQCA 4GCAA 3H6OA 1XV8A 3CB8A 5DRCA 1C90A 3RLVA 4GG9A 3K13A 3TAOA 1JIBA 1H41A 3GHTA 4E3VA 1KLYA 1SZFA 3M5VA 5HJXA 5MKGB 2J13A 1XH2A 3FGCB 3UWEA 1LOSA 3UG5A 3HO8A 4IMGA 3IRSA 1OCBA 5CPNA 1OF6A 2ISVA 4CN1A 7CGTA 1PKNA 4Q4OA 4ILSA 1YE6A 2FHBA 2C16A 2Y1HA 3NO1A 3U0HA 1Q7QA 4MKNA 1XCWA 3OZYA 1E1FA 1OFEA 3R10A 3M9YA 4Q32A 1JCLA 2GVGA 1NDWA 3GIQA 4U2ZA 3PVFA 3O2LA 4ZGYA 1EIXA 5CPTA 4US5A 2OZ8A 3NSNA 3LPOA 5GNZA 3W87A 3ARWA 1TX2A 2OZTA 1G6CA 1JPIA 2V5KA 3ZVIA 2NW0A 3NQAA 3IJDA 4QJ4B 1QBAA 1SW0A 1E9ZB 1Y7VA 2PGFA 3HGOA 2BOFX 2ODOA 2BVYA 4BF9A 3CNYA 3MYPA 1CXIA 3NGFA 6ENLA 4HNTA 3TSBA 3ZOAA 2IUZA 3CO4A 4IMEA 3DCPA 4C6PA 1SJAA 1FCVA 3MUAA 1CB7B 4Q8NA 4KKXA 2EHHA 4M1RA 3R11A 1XYZA 2FPTA 2DIEA 1YDOA 5CLTA 2R1KA 1I2OA 3R89A 3FKRA 2Z27A 4MHBA 3TQPA 5AY7A 1JXJA 4H2HA 2P76A 3RITA 4CN6A 5H1WA 1AQFA 2FZDA 4JKKA 3SI9A 3UR7A 4ACZA 4D1JA 2XGBA 4FXSA 3N17A 3WBWA 1BG4A 3V4BA 3BAYA 3FXYA 3OZOA 3OHMB 3AS3A 4Q7IA 4C6BA 3AWOA 3AO0A 3L5MA 2PWFA 4TO8A 4AXNA 3M0IA 5CG0A 2QDGA 4ZO9A 4H6EA 3NQMA 4AVOA 1A5KC 3OODA 3S2CA 4PBEA 1XIDA 2GJRA 4IG2B 2HNHA 1D7KA 4F0SA 2Y0FA 4IUOA 4MM1A 1TV8A 4FZIA 1NWSA 2HWGA 1ME9A 3SRKA 3GC5A 1ZAHA 2WVVA 1R7AA 2R24A 2QEZA 3C0JA 3PTDA 3NXLA 4CNSA 4GYJA 2P1FA 2DFAA 4J2MA 2WLZA 1TMHA 3UCCA 4EPKA 4PSPA 3VMOA 4IIEA 5U7SA 4TU1A 3ZT6A 1KTCA 4FXJA 3K5XA 2OEMA 1QPKA 1CEOA 2E40A 3EMZA 3QGVA 2V3GA 3H8AA 3MZNA 3ZLGA 1R2SA 1GVSA 5FL1A 1H3GA 3VGEA 1G67A 3DFNA 1VS1A 3R94A 2WO5A 5CH9A 1ONRA 3O6CA 4LRTA 1F76A 5D2WA 1PEZA 2QZRA 1MQPA 4D1IA 5BOOA 4C6IA 1DWAM 4PCFA 5FEXA 3TP4A 1VD6A 3WL1A 3BG9A 3W0KA 3KRZA 3CEUA 1ESWA 4UR7A 3T2PA 1OYBA 1WZLA 3N11A 4C65A 4KESA 3E74A 2D2OA 2VDGA 1SMAA 1OZMA 1T99A 3W1PA 4JGDA 2EJAA 4IP4A 4HHHA 1LT8A 3N6QA 4DF1A 2ANUA 2WPBA 4HCHA 3BANA 3JZUA 1TV5A 3IK2A 4E8DA 1NP0A 1TA3A 3RU6A 1WBJA 3WFLA 3ARTA 4GYKA 1O5RA 3OG2A 1UQYA 5CSUA 2V5DA 4LX4A 3VI2A 2KAUC 4HZ7A 1SM9A 4HU4A 3W6MA 3W23A 2ZWZA 4ALDA 5BRQA 3CPGA 3AHXA 3FLUA 1Q66A 4KWUA 4UUIA 3OIHA 3M47A 3IWPA 5T26A 5ABFA 3REQA 3WL0A 1HGYA 2HXUA 2O7SA 1R0MA 4RR4A 4ORIA 3SADA 5FA5A 1P0DA 3UZJA 3GE7A 4QAIA 4TMBA 4PC8A 2AOSA 1YTKA 4MJ4A 4URIA 3WLKX 4C6OA 2GVLA 2VD9A 3N3TA 2Z29A 4NNCA 3C8NA 3PFMA 1IWAA 4AWSA 3NOEA 5HNUA 1R3SA 2VVNA 1PDYA 1RLDA 3E1F1 2VOMA 3LSCA 1W9BM 4AY1A 2QIWA 4X2RA 1Q45A 2PSNA 1TMQA 4UZUA 4LVFA 2FDSA 4NI8A 3SZ8A 2XIMA 3ZJ8A 2ZE3A 3AMLA 4CD8A 5MHBA 2F6KA 3G1HA 2H90A 3GXMA 2Y5JA 4XTDA 5AYYA 1VFSA 5HA7A 3VD7A 3ARVA 5LGXA 4GIAA 1TZ7A 1QTWA 3O6YX 1T7LA 3O1NA 3W2KA 3LQGA 1G4TA 1TJRA 4M80A 2DSWA 1R2RA 2D73A 2HMCA 3MHUA 1OSEA 3G0XA 1TMLA 3TWAA 3OQ8A 1H60A 3W74A 1KM2A 3K30A 1V3MA 1AQMA 4H3DA 3W7MA 4ZFMA 5D2TA 1UC4A 4JR5A 1AW5A 3LPPA 1GVFA 2D2GA 1GJUA 3ZLFA 4WHBA 5GQBA 3SCVA 2G3IA 3HBLA 4GZEA 3S1WA 3SFKA 3TLLA 1VGAA 4B92A 2OVLA 4MWAB 1LCOA 5MF5A 2REQB 4NZ5A 3SCWA 3NFUA 1BGAA 3NUKA 3STEA 4IGNA 3EWBX 3G1YA 1F8IA 4E8CA 1ECQA 1RV8A 3N2BA 3KCLA 3VKKA 4O8RA 3B8UA 5DBUA 5M3WA 3L4WA 5DY3A 2NVCA 1U1JA 4OUEA 3DI1A 4O0ZA 3SJNA 2ZUUA 1I1WA 1TG7A 3OA5A 3C4UA 4ZENA 3T2OA 1JQXA 3C0SA 2CIPA 2OSXA 1JYVA 2PI6A 3KWXA 4Z0SA 1G5AA 4M5PA 3QMSA 2QJIA 1XR2A 1XLDA 1A4LA 3UXLA 4H04A 3VOIA 1YXYA 1F73A 4D6HA 3AAMA 3QY7A 1T40A 4QQUA 1XLIA 3CAVA 5FAJA 4R7JA 3EOLA 3A3WA 4ZODA 2IKJA 1LG1A 4M7SA 3DU0A 5ABHA 3MDUA 2GQ3A 4DM2A 2OEKA 3AC0A 4XV0A 3RX4A 5FEWA 3URNA 4WOQA 3HQOA 1O95A 1W6TA 4GVFA 3IV8A 4X0NA 1F4AA 1ODUA 1H63A 3COTA 1E6SM 3NURA 1I4NA 4KEUA 1A80A 1CXFA 4LQ1A 2MANA 1LLOA 4GVHA 1G4PA 4JDYA 3PY2A 1E0TA 1UD8A 3FYOA 2R1MA 3ARSA 2V69A 3T44A 1HJXA 3SSJA 3LLDA 4Y7EA 2GYIA 1HKVA 1XS2A 1X6LA 4LUTA 1NFPA 2XUCA 4HNLA 3KOYA 5D30A 2TODA 3KEHA 3ALGA 3NCOA 1UASA 3G18A 3WFAA 4AU0A 2QJNA 4RE0A 3VNKA 3ZR4A 4E4PA 5C9UA 3ORWA 4DZIA 1EC7A 4CQBA 2J6XA 2EG8A 4ML9A 4WDTA 4RK8A 1L9WA 1NTHA 4N4PA 2FLIA 4QTGA 4JTHA 3MWAA 2SFPA 4HB7A 4AIUA 2WSQA 3WJYA 3WDQA 5AHNA 3M41A 3Q37A 4O28A 1HQTA 4FR1A 2PDNA 1GYNA 1RQBA 3QQ0A 2GUBA 3WD1A 2CKSA 1K7EA 2DJXA 3B8DA 3VKJA 2EG7A 5CC3A 3C3NA 1XINA 3GW3A 3GNDA 4YVXA 1JPKA 1KFEA 2HK1A 4LEFA 5K9CA 5EGRA 3B0VC 3KL3A 2O4MA 4JFVA 3NNTA 4Z1AA 1W3KA 5FJJA 4A3RA 3NO3A 3E2SA 4AYGA 2FZNA 3NR0A 3VOHA 3R1ZA 2VR5A 1HL2A 4R27A 1I9CB 3AWNA 1XJBA 2Y4SA 2EQDA 4YMZA 1GQIA 4TX8A 4AD1A 1RJPA 4OOZA 2IKIA 5HMDA 1Q6LA 1XUUA 2NT1A 3UG4A 4UFJA 5CJNA 2XH0A 3VZYA 3DN5A 2PAJA 3A9IA 2A3CA 1J12A 2E5BA 4PMJA 5CJMA 3BVJA 3VX1A 4HYVA 4YNGA 1NVMA 3CEPA 1WOBA 4RE2A 3O6AA 4OBSA 5DY2A 3CZJA 2ZOXA 2GJXB 4XD6A 3F2DA 4PMXA 2INEA 1A5OC 4QXIA 2XDFA 1TJ2A 4GE8A 2OPJA 4KS0A 1AJ2A 1NH6A 1G7VA 4HU8A 4O1CA 3MKVA 4H2CA 1MYRA 4DWSA 5LA0A 3KVJA 1FY6A 1YLVA 4KWWA 3GIPA 4FNTA 1IWBA 2ESCA 3M0YA 4C6EA 3CYVA 4P7OA 3QQWA 4IJRA 1SUXA 2F6UA 1U1UA 4OE7A 1U5HA 4GFIA 4DBWA 4NF7A 3TYEA 1QW7A 4B90A 1BSLA 3DX5A 1W31A 3PZMA 5C2XA 2QQ6A 5H8MA 3QR1A 1LLZA 1KFWA 1ZJAA 3MCOA 4DI9A 4PTNA 3TROA 1UZ4A 3LS9A 4FOUA 3B8WA 5K4XA 4NY2A 3BE7A 4LS0A 1WNOA 4O12A 3DI0A 3QKZA 1HVXA 3AIUA 3PG9A 1RXOB 3CH0A 1US2A 4TMCA 1DP0A 5BRPA 4O17A 3U8GA 4AZCB 3C61A 2OODA 4JPGA 4RJEA 2P3ZA 2OKTA 3VM5A 2VGFA 4QS5A 5A3HA 2GUUA 3RR4A 1JDCA 4H83A 1FWJC 4GY0A 1EX5A 1N8IA 3H2FA 2PU0A 3QKEA 1XSJA 3D6NA 2V63A 3IJQA 5AZ1A 1RSCA 2OSYA 2PODA 2ONEA 5E93A 4TVDA 1ITUA 3NG3A 3LB0A 4ERGA 3W7RA 1VENA 4KCUA 4UTMA 3R7MA 2I14A 1D9EA 2VYOA 3BAKA 3CM4A 4CCDA 5AHFA 4HSOA 2Z00A 3F5LA 1TWDA 3QLDA 3TW6A 2NWRA 1E9LA 1LUCB 4CD5A 3IIVA 4GUIA 5DMNA 3L4TA 4DEFA 5LNUA 3VE7A 3C8FA 2DVTA 4YIWA 1GCYA 3KL5A 4JAWA 1E6XM 4Z2GA 4E2VA 3BOXA 4WF7A 2QUVA 2XINA 1OFAA 3VIPA 5C55A 3A12A 4LV4A 1WX0A 1U1HA 1UWRA 4HGXA 2ACQA 3TNBA 1DJWA 2G95A 1XM3A 4I8DA 5AHEA 3QTGA 1BAGA 1QPOA 3TA6A 3AYSA 4AD3A 3RJXA 3T78A 2GK1B 2OG9A 3ERPA 2A6NA 4ZBCA 2INZA 3UG3A 4NP7A 1THFD 4ZQCA 3GY1A 2PWHA 1OGGA 3URBA 3T9PA 3K4DA 4XZBA 4DBEA 4K2SA 3UJFA 3IPWA 3OVQA 4IZGA 3TTYA 9XIMA 5EFDA 3D3AA 1MNZA 3R13A 3KBNA 1I75A 1L6WA 3H4GA 1YXDA 5I07A 3PBWA 3M6YA 4HA0A 5JH1A 2OQYA 1GVRA 2HJPA 2ZA1A 2YW4A 3ZVHA 4ROQA 4RLIA 4L5ZA 1PX8A 3VOJA 5BWAA 4M82A 1W1YA 3FFSA 4L6DA 4AFYA 1NDVA 4HPHA 2G3MA 3WN6A 3W2UA 1OG6A 1TVLA 1ZHAA 1XIHA 1PTAA 1DQUA 3AUJA 3K1GA 4RE4A 1ADDA 4AF0B 1TKKA 3GXFA 4MWAC 1KBJA 1Z32X 3USZA 3KAOA 3GFZA 3P81A 2Y5SA 4UMCA 4PMDA 1QVBA 4ICNA 1XD0A 1CNVA 1GPWA 2G3JA 4QLLA 4L65A 2A3EA 4MSSA 4B4FA 3C2OA 1E6NA 4AIOA 2BXYA 1HO4A 1IEWA 3M0HA 1BVZA 1DQXA 3DFTA 2E9MA 4GVGA 1LBMA 2ACUA 3AZTA 4EPBC 4TXEA 3W76A 1ZB5A 4O1FA 2PMQA 4RCXA 5HUOA 2E3ZA 3B4YA 2EPMX 4FXFA 2V38A 5XIMA 3C56A 4TR9A 4YPJA 1OFPA 3VIHA 1EFZA 4KPLA 5D8WA 4WSKA 5CZKA 2W0UA 1E4IA 3TC7A 3B9NA 2VWSA 2XPKA 3GVWA 5D09A 2Z7GA 1ZL1A 3A5VA 4RPQA 2FH6A 3VIIA 4BI6A 5C7VA 3EOEA 2OZ3A 2GL5A 2E1DA 4C6NA 4E8GA 3O0KA 2VZUA 2QPXA 4AX7A 4MZ8A 3KOWA 3UVIA 4GIYA 2J9YA 2ZA2A 4NXSA 1OBAA 4A8RA 3LBCA 5T8GA 3LXAA 2W67A 3SY8A 5F7UA 1FRBA 4QG8A 3QYQA 5I5RA 1GVYA 4MFDA 3LA4A 2DPEA 4ZZ9A 3CV6A 3EA2A 3VIKA 1E71M 4N0RA 4QROA 3OBEA 3WQGA 1H0GA 1EO7A 3KBWA 4K1WA 1ITCA 2V82A 1U33A 1PUDA 5CG7A 4WRHA 1SZNA 2A0NA 1UR1A 2D23A 5HWJA 9XIAA 3S1VA 2JALA 4XZWA 1RBOB 1R3RA 1VH7A 4CLMA 4FNRA 3BW3A 4C1NB 3SGZA 4YLWA 1C93A 2V6AA 3CV1A 4IT1A 1JCYA 2W5FA 3N13A 4LUYA 3DH7A 4QIUA 4REQA 5A6SA 4LH8A 3PFRA 1XFBA 3GM8A 5DN1A 3RYSA 1K4HA 3EKLA 8A3HA 2WMGA 5H2ZA 2XFYA 4JCLA 3GZAA 4UOJA 5HR6A 5REQA 1J96A 1EJVC 1Q13A 1TPVA 4NJHA 4P61A 5U4NA 3EA1A 3UNDA 2QW5A 4P7RA 1HKMA 4L4MA 3CUJA 1SR0A 3ECQA 3ITTA 1Q6EA 4W8AA 4DJFA 3DKJA 3VK5A 4PMOA 4M3PA 4AWTA 3AZSA 4LVAA 4NI3A 2P53A 2BASA 2QT3A 1IT7A 1MNSA 4IJCA 4R34A 5BROA 1F3EA 1GTEA 4F2TA 1JZ7A 4YTQA 3QOMA 3A23A 4MADA 1TUXA 5ECUA 4AHQA 1DHPA 4PCNA 3WLRA 4M6UA 4H8VA 5E0CA 5FKYA 4ASTA 2PURA 2PDJA 3W84A 3O6DA 4QSHA 3KOZA 5CJ5A 3RJYA 1XIMA 1UUMA 1W1B1 3AIBA 3L0NA 5LKYA 5AN7A 2HDJA 1UW9A 5HWNA 3B0XA 3WJXA 1VIWA 4UOQA 3H4WA 3EB3A 4ZEPA 3A9BA 1CXKA 4HYWA 1QDSA 1CPUA 2BBFA 3E2RA 2WQPA 4WD0A 3R0KA 3SEPA 2E6DA 4Y90A 4WDWA 1OFBA 3U2CA 3EX3A 4GMEA 2A2IA 4IXHA 1V6UA 1KM0A 4U5KA 4HTBA 3CQ0A 3QZEA 5EL1A 3CAKA 2WKLA 4S3JA 3FEMA 4JYEA 3SRFA 3SN1A 4ZB5A 1PE1A 3BMVA 1JAKA 2PD5A 3BC9A 2WVVB 3WD4A 3LPFA 3O7UA 2BG5A 5K4ZA 1RA0A 2DZBA 4HD5A 3U48A 1XLMA 3BOFA 2NQ5A 2DSKA 3F4VA 4N9EA 2VGIA 4RNFA 4JXCA 3AZRA 4NJKA 5G2WA 4JQ3A 4C7DA 1OCJA 1QNPA 3GKFA 3BXWA 3UR5A 1BRLA 3AIWA 4I6KA 3V0UA 1HP5A 1VF8A 4DUWA 1QJWA 1O7AA 3DHFA 2BV9A 1KM3A 1S2WA 3WBXA 2PF0A 4DF2A 1R87A 1K7FA 4LB3A 3UYCA 2QPUA 3WSUA 4F0RA 2YFOA 5I03A 1JPDX 1SVDA 3E3HA 3UFYA 3F03K 4LS2A 4DJEA 1JDFA 3SCRA 1W9DM 1K77A 4YTSA 3NVDA 3TYZA 1TZ9A 4GY1A 4RDVA 1TIMA 2DZPA 4ZE4A 4WY0F 5BXSA 3QN3A 1P6WA 2CXEA 3CO8A 1FHLA 5AC6A 3ABXA 4GINA 1JG9A 1LF1A 2QS8A 4MNLA 4LC8A 3ZQ9A 3T55A 3AQUA 5C0QA 5D02A 4EK7A 4B5XA 1B2YA 4WGHA 1P0EA 3RILA 4A8LA 3CIWA 3WNPA 4GQ0A 3WZ0E 2ZVIA 3LI1A 3W7IA 2Q02A 2GGJA 3FJNA 5M17A 3EWYA 4DZHA 3GTFA 3V5FA 1XFCA 5TD4A 4KCWA 1P48A 4MAVA 4U33A 2QV5A 4HZ6A 3P82A 3C2RA 3AIRA 3W2JA 3WQ8A 4O10A 2VUYA 3QF0A 4AMAA 3OGSA 3REQB 1DE5A 1M9HA 5CPOA 4X22A 2OU4A 1BFNA 1KGXA 4CNOA 1B3XA 3H2OA 3MI3A 3TTEA 2O4QA 4IISA 4TV6A 1E1EA 1JZ2A 2A1YA 4O18A 3R25A 4JN7A 1RVGA 1A5UA 3LM7A 3E38A 3K8MA 1G7UA 1SMDA 4JIHA 1UPMB 2GFTA 4PRWA 4U4MA 3LXBA 3EWUA 2XVPA 1CB2A 3G5EA 2WHLA 1ZBVA 3MVIA 4K1GA 3LMZA 5IDZA 2VCBA 3LI0A 3U9IA 4W87A 1VRDA 1J6PA 2D69A 4N2YA 4ADUA 3ZS4A 4GZJA 4M51A 3KTXA 4EF9A 3KP1A 5DX7A 1FWEC 3SDOA 2ZX9A 4L9YA 2CHOA 1B9BA 1V79A 3WX7A 2A3BA 3G0SA 5LNSA 3S1GA 3WDHA 1RJQA 1IGSA 4IX2A 1EQPA 1W5OA 4PMUA 4JTEA 3GNNA 4LEQA 2HISA 4J3WA 4GRSA 3UJ2A 1XH1A 3URQA 4DYKA 4IP5A 1K6WA 1JZ3A 2D1ZA 5A6BD 1Z7AA 3NVTA 1BHGA 3MYOA 1F07A 6REQA 3BG3A 1QXLA 1KM1A 2J47A 2ATMA 4WSHA 3AU6A 3E96A 1BTCA 4GC3A 3F4WA 1X38A 2WVTA 3AYTA 3U5YA 5CPMA 3GVRA 4IICA 1BSIA 3GVGA 1P0BA 1W9UA 4PMRA 4U28A 1FWRA 2YCJA 3PBMA 2RHGA 3S6OA 1XYFA 2Y88A 1MXDA 4GXWA 4Q4SA 1QCWA 3WD2A 1W5QA 2J74A 3M07A 3F2BA 2UY2A 4U31A 1ALDA 1UIOA 3LENA 3OGVA 4WKAA 2VHLA 5KITA 1BF6A 3RAOA 1I8JA 5BXTA 3QV6A 3EBVA 3DXIA 4D8ZA 4P7QA 1AD4A 1MQQA 1EJ7L 4PR4A 3SIZA 4FEZA 1KCXA 3CHEA 3S9ZA 3RX2A 2I5GA 1KKOA 2E6AA 4DM1A 3CK5A 1UJPA 7REQA 3XIMA 3CUHA 2OCZA 4PCSA 1UUOA 1Y0EA 4QJ1A 1KRMA 3WK1A 4PTWA 2GGGA 4WUIA 2C91A 4UQAA 4O1DA 2WJFA 1GZJA 3I3EA 3GG1A 4V1XA 1TYGA 3BLEA 4KH2A 3VGHA 5D9MA 4OHQA 4ZTXA 2CZ5A 1H7NA 1U5JA 3L21A 3FAXA 3QH2A 1XYLA 3VABA 1Q7ZA 1QNSA 2OQLA 3FY1A 1DWGM 2EPHA 1PAMA 1TR1A 1MI3A 4Q6JA 3N2TA 2WCAA 1J4EA 4IFRA 3EOOA 3QC3A 1J9YA 3DFQA 5AHIA 5FJOA 4Z17A 1QATA 3IJLA 1Y8BA 4LUTB 5TF0A 3W24A 3VD9A 2Z6JA 2ZXAA 1Z69A 1MRQA 5EMYA 4G2DA 4H19A 4EE9A 1B4EA 2PDGA 5A8NA 3LD5A 4CVUA 4C1LA 3IGHX 1LL4A 2Z1XA 5E9AA 4EOUA 4JTRA 5DEZA 2CU0A 1KBIA 1J01A 1GVQA 1TIWA 4WLCA 1S2CA 3KBSA 1RK6A 1D3CA 2WNNA 3L4VA 2E9LA 1ME7A 4AUBA 5A2CA 3M4HA 3CH9A 4HIBA 2VC9A 3WF4A 3DZ1A 1Q8JA 3WD3A 4PMQA 3B06A 4QDMA 1YNPA 2OELA 3GS6A 2WMKA 4PBFA 1EJSC 1JCMP 1XRSA 3LK6A 4HPXA 4MPKA 1UHVA 4H41A 2VENA 4G8TA 1LRNA 1XPYA 4NRSA 4JTQA 2VURA 4PCTA 2C3ZA 2WSKA 3MCMA 4EWND 3S1UA 2VC7A 4QP0A 3UA3A 3GU1A 1FHDA 1IEIA 1MUCA 4UTLA 1DXEA 3EOUA 1KC7A 4HHPA 5FJIA 1E0WA 1PL9A 1W1A1 3PZ9A 4GYFA 3MT1A 4WXZA 1J0HA 3QMTA 1CGVA 1NWUA 3MO7A 4UFLA 4HPNA 3VNLA 2J7GA 1J5TA 3MW7A 3TX9A 1K02A 1G4SA 5DCEA 2DH2A 2QYGA 1TE1A 2VZVA 4OWGA 3NJ3A 4J3UA 1VC4A 3MA8A 1IIHA 2E8YA 4U5IA 1OGBA 3VD3A 1WXZA 1MW2A 3W72A 2YX0A 3PR2A 2Y70A 5E9XA 4UB9A 4DI8A 1W9XA 1DJHA 2ZZ6A 3AFBA 4AYSA 2DUAA 2VEIA 4GQBA 1Q4WA 1KGUA 4I7WA 5A6MA 1ITXA 3GO2A 4KEZA 5F2GA 4KFOA 1LBLA 1YYAA 5E70A 3LBMA 1CENA 4OUIA 5HDRA 3I7RA 1BXCA 1I2NA 4HYRA 1E43A 3GTHA 3LG3A 2Y61A 3ARPA 1K70A 1PZ2A 2E6YA 3NM1A 2V5BA 1ZENA 9CGTA 3N2CA 3BLLA 3F1QA 5J5RA 4AEFA 3TR9A 4AG0A 5M2FX 1TO3A 3KRSA 2Z25A 3W00A 2V8ZA 2D0HA 3TYDA 1E6ZA 2J8GA 4GI4A 1XQLA 3KDNA 3UXIA 4ZB2A 4HPJA 1EXPA 4G5DA 1E4MM 3LLFA 1JDDA 4FB7A 4WEVX 4LY8A 3AXMA 4UTWA 1HN1A 1JNEA 4IH3A 2PBOA 4BS0A 5FF3A 2VRJA 5AC7A 3ARYA 2G37A 2NT0A 3N19B 4JQ2A 4V27A 3OYZA 3WG6A 5EKYA 4XAYA 1TPB1 3T0TA 3ITVA 3WK2A 4UZSA 2V2HA 3V1HA 2QCEA 1XX1A 2D20A 4I8YA 2V0TA 4JL1A 3ES7A 4UTTA 4MY1A 2I5IA 3SUTA 4IGSA 3RLHA 3N9KA 5CPLA 1W1TA 3BICA 4HNUA 6A3HA 4F2BA 3OPSA 1GKRA 1BGGA 3MDWA 3WLLA 5HOSA 5AZ0A 5B7ZA 3ZSSA 3BL3A 4ECLA 4XZ9A 1CBGA 3TA9A 1QI4A 4D6IA 1QHZA 2WZTA 2Q8XA 1W1IE 2NWSA 1LWHA 3IJ9A 3H70A 3NO5A 2C8NA 3B0YA 2TMDA 3TK7A 5AYXA 4MUZA 4KIEA 3AICA 2ABBA 2MNRA 2F9RA 4AAJA 1FQ0A 3CL6A 1BKSA 1I60A 3NYZA 5E6YA 3L65A 4JQ4A 5ECVA 2INFA 2YXXA 2FPVA 4XVDA 4ZQPA 3HM7A 1S5NA 2WMFA 3CB3A 4E4UA 3KLKA 2J7BA 3VTRA 1B30A 5G1YA 4Z1CA 3WQVA 1EGZA 1LLWA 1V03A 4LNYA 2AAMA 3P5YA 1C7SA 3HJEA 1OD0A 3WIJA 3NQ6A 3LV6A 4EVZA 2OMAA 4Z1DA 3C86A 4MG4A 4D6CA 4TX6A 1GEHA 1V3LA 1A3XA 4PUDA 4JBRA 3OBAA 3PZVA 4XAPA 4LCQA 1PIGA 4B5SA 1EA0A 4XZHA 1XD1A 1J6OA 4L4OA 5CC7A 4FX7A 4IFKB 3ZVHB 4KWOA 4F66A 4F4RA 3GBDA 4RZ4A 2DJLA 1WZAA 1WZMA 4X9YA 2BZNA 4FNQA 3ONCA 1IEXA 1CTNA 4R7WA 2OX4A 3NSXA 3M5YA 2JFEX 1CIUA 4XWUA 1IEVA 5CC6A 2ZICA 1EF3A 3TQ0A 2X05A 1KO0A 1UD5A 2R9RA 1ZCOA 4KIRA 4KFPA 4XSLA 3B8SA 1G69A 2RDUA 3PJXA 2WOQA 4FIQA 4UBPC 3UZYA 1CLVA 2E9BA 5I0DA 4D6GA 4Z2LA 3TOYA 3GDLA 2ON3A 2ZKMX 1GQLA 1JNDA 1XIJA 3I6TA 1WDPA 5HPCA 1VCGA 4JHZA 3M1ZA 3A13A 2VP8A 2Q8ZA 3NZ1A 2VFHA 1EH9A 2V81A 4NSBA 3TR2A 1AUSL 3CZGA 4GWEA 1SU5A 4S39A 4O4VA 2NUYA 1SO6A 3VX0A 2W66A 3N6JA 3K1DA 2Y6ZA 3N4EA 4S3EA 1KV5A 3WLQA 4GY7A 4MIMA 3AXKA 2XH4A 2WZHA 4JTUA 4UR8A 3A24A 3L66A 1W3JA 2PGRA 1YDNA 1SSDA 3APGA 4JQAA 2D2HA 4EF8A 3W75A 4AHOA 2ASHA 4B15A 4P8XA 5HATA 4OBTA 4Q8PA 1NAL1 4B9ZA 3WLPA 5C9XA 4W88A 4JNZA 2X1UA 2JIEA 2BY2A 2XN1A 4D71A 4GH1A 4CCZA 1RP9A 2OT1A 1BLIA 1POKA 3IS4A 4PUNA 1AODA 1H7WA 4HU3A 4UTUA 3UZZA 1WDSA 1TR9A 1W3TA 3C52A 3TDFA 1TZZA 2VX5A 2Z1VA 4IL2A 1S38A 3PPGA 1ZQ5A 3W1NA 4IGMA 1W91A 3Q2DA 4BQ3A 1RBLA 4GKTA 3KW3A 2OWXA 3CZ8A 7ENLA 4OECA 3TVAA 4ATWA 1FP9A 1US3A 1UCWA 4A22A 1B5TA 2VL4A 1I45A 1CGYA 2OWWA 4C60A 2QCFA 4JKMA 1JZ5A 1FKXA 3CMGA 4DN1A 3OGRA 2D0GA 2C14A 4IHCA 3S0CA 3NQFA 3BSMA 3DDMA 4H7CA 3U2ZA 4W4QA 5IDIA 1GJWA 3W83A 3BAJA 4MAZA 3FV9A 4IIHA 4NASA 2OLHA 2VEFA 3DC0A 4GOAA 3NXFA 2XIJA 1UKOA 2YCEA 3TAKA 1WBHA 3TXZA 4MGGA 3S4TA 3NZRA 2FMOA 1PZ1A 4ONVA 3CAQA 2GGEA 1JD7A 1SJCA 3GXDA 1F8MA 2FPYA 4LUIA 4RW3A 4KRZA 4ZOEA 1UR3M 4HNVA 3QGAC 5CSSA 3VAVA 3WQ4A 1RUSA 5JU6A 2Z4GA 1W8GA 1QR7A 3S2JA 3MV01 5LNVA 3ZJ6A 6ALDA 4JNYA 2VRQA 3HQNA 4L4PA 4WIWA 4IMFA 2EXOA 1EGMA 3Q58A 1F9CA 2WCGA 1EP1A 3SRDA 3HURA 1PCWA 3VIMA 4QJ5B 3S5YA 3EWWA 1FCQA 1A0DA 1XF0A 1AZ1A 1H62A 4Z1YA 3IGSA 4LYQA 2DH3A 1IZKA 4YVVA 1KLZA 4QLJA 1C8YA 4JKLA 4DWSC 4OQVA 1E5NA 4PL2A 4WXYA 4F9DA 4QITA 2YLLA 3PWAA 1V0NA 2P8CA 3D0CA 4RNHA 1MUWA 3ARUA 2GOUA 3PBUA 3MJYA 3ZT5A 2CETA 1WV2A 2YL6A 4PTMA 1Z44A 3APTA 1FOBA 2Y62A 4D72A 1QHPA 3MJMA 4GD0A 1ICPA 4IXXA 2JE8A 1ISVA 2PWUA 1NOUA 4K8EA 2OYLA 3W1TA 3QM3A 4LVDA 1XSIA 4MYAA 3UCDA 3CHVA 4FLQA 3MV11 3G1DA 4XZNX 3NOYA 3RX3A 2FZ9A 1WA3A 4PUKA 1H61A 3QY8A 1FWHC 4QNEA 3HN3A 4E3TA 2YXOA 4X2PA 4DNMA 3RM4A 1K9DA 4JTJA 5FSDC 8TIMA 4WX2A 1J18A 4RNJA 2E28A 4K39A 2Q09A 5ENLA 3ZR5A 3BGAA 3FJLA 1LWJA 1S5MA 2XIBA 1S2UA 2XH7A 2PU1A 1R3YA 4IQEA 3R6IA 1QI0A 1EHNA 2QCCA 1WKFA 3G8RA 3R5EA 3L2LA 5D9OA 1K6AA 4XD5A 3EB4A 4M24A 3DEQA 4DO5A 2CLPA 3LQLA 3TJ4A 3MP4A 4Y8FA 4CD7A 5BCAA 2PB1A 3GC2A 1VQTA 1BPLB 1L6GA 1TWZA 2FDMA 3GVVA 3HG3A 3VO0A 2QF8A 1WZKA 4CQ9A 3QC0A 1JZ8A 1GOXA 3U4FA 4RL3A 3S2MA 3AS0A 3HFYA 3E0VA 1PO9A 2PZNA 3TW9A 1CLKA 2W6RA 4DJDD 3SUUA 1D8CA 4X0VA 2OB3A 1XKJA 1QK2A 4XZMX 5DO8A 3LGEA 4RX0A 3U5UA 4MJZA 4EPEC 2V30A 1IXOA 2H3BA 1IF2A 1JPHA 3P84A 4GUHA 4XISA 3W7PA 2FHFA 1ISWA 2V5JA 4F40A 2P50A 3WYZA 3VD4A 4XIAA 4Q4RA 2XVKA 1UD6A 1XUZA 4YYFA 3G1AA 3VKCA 3VPLA 3ELFA 3KZSA 2VZOA 1UKTA 3NM3A 1K9TA 7TAAA 2YL9A 4NZCA 3MVTA 4JX5A 4ML4A 2HZGA 1H7RA 4DJDC 4LY4A 2QJHA 2QULA 3AHVA 4QHRA 1DEDA 2E8ZA 1RZMA 1ZLPA 2ISDA 4G9PA 2FMNA 3SW6A 3LRLA 3CQIA 3TN3A 1CGWA 1VR6A 2RFGA 2WJZA 2QCHA 1ME8A 2DW6A 1HZYA 4BKNA 1BQGA 4DF0A 3GDBA 1XIGA 4UNLA 1DJZA 4CU8A 1NEYA 4JDBA 4XUYA 1BD0A 3PNZA 2WQDA 4RW5A 1QASA 5DXYA 5FSEC 3W1MA 2ZZ5A 1F6PA 4HOWA 1R9ZA 1QOXA 1I2RA 1UMLA 5C6MA 1ZJIA 2IXUA 2WBGA 4L6OA 1UJQA 1M53A 3FJ6A 3QPYA 3U6WA 5L9FA 1M01A 1JCXA 2CYGA 3W37A 1XDJA 4LWWA 3PBGA 3M46A 3N4AA 4C5YA 3T4CA 1WPCA 2DY3A 1SZRA 3CMJA 3N2XA 7TIMA 3SUVA 5J5DA 3LM3A 1I6NA 4M0XA 5D03A 1HKKA 3FOKA 1V02E 2PGWA 3H55A 1DVJA 2X0YA 1P0KA 3APYA 6REQB 4IIBA 4PFMA 2Q71A 3O07A 2TAAA 3TXVA 5BRBA 2QVHA 1QI5A 3R8GA 4MKSA 4L1XA 3FHQA 3RM9A 4M6QA 1DWHM 1JCNA 2HNEA 1E6QM 1EJUC 3FK4A 3EOSA 4NZ1A 1YDYA 4D8LA 3ITCA 1EGVA 4KBXA 5AYIA 4CEXC 1NP2A 4CCEA 1GHRA 1V93A 5CPSA 1J8VA 4K7YA 1TQXA 2P5NA 1I0DA 2YDSA 4E2OA 3ID7A 1S2VA 4KERA 3T2QA 1VB9A 4YS1A 2VFDA 4UMBA 3W7GA 4MVAA 5DBTA 1YXCA 5I09A 1UP3A 4HJWA 4LSBA 2VWTA 3LEPA 2A21A 3G77A 1U30A 3TTQA 2CERA 1C8XA 3IVSA 2DT0A 3N6HA 3HMCA 1VPQA 1FDZA 5FF4A 3IEBA 2XZ7A 4Q8MA 3JW7A 3BLFA 7REQB 4BHYA 4TUFA 1XLGA 2XWDA 5E6ZA 3VGFA 1J2BA 4IL0A 4FK9A 2PTYA 4HNOA 9RUBA 3DYMA 1MMFA 4NHVA 3J7HA 4Y9NA 1RHCA 3UZWA 4W8LA 3EKZA 3V5CA 2ZWYA 1A5NC 1M65A 1SFJA 3BOLA 3G0UA 4JTCA 3OYXA 3DKLA 1VKFA 1JVNA 4QNWA 1GVOA 3NDYA 3SCPA 1EZWA 2ZA3A 2DT2A 3OOQA 1N55A 3BCFA 1DIKA 2D2JA 2VEKA 2GQAA 3MZ2A 3A5FA 3HPAA 4RXGA 4IOTA 2J79A 4H9XA 1JUKA 1N2VA 3UGRA 2GJPA 1BYDA 1KXQA 4HN4A 3VNIA 4DJFC 1GOOA 1BVWA 3SR7A 2ZZ3A 4ADTA 2QIIA 4MDOA 2VNCA 4FHAA 1XLBA 4LTSA 4LRSA 1UR0A 1EIBA 3M0LA 4JS3A 4JTAA 3UCQA 3CHCA 1RCOB 3UJRA 2CLHA 3I6RA 2WCSA 2DZAA 2Y7GA 2X2YA 5TNVA 1O1ZA 3TSMA 3CIXA 4OJYA 1WAUA 4DLFA 1FWBC 4FNSA 2GSEA 4Q33A 3UPMA 2YBTA 1EYEA 1YIXA 3VDGA 4AQLA 3SN4A 4PRRA 1HKIA 3T7VA 3HJZA 1XCXA 1CXHA 1YTDA 1Z8AA 1KNWA 3PG8A 2WPGA 4E38A 4Q4QA 4GPNA 2WKJA 5I3HA 1HKJA 2FZ8A 3EB2A 2QXWA 4AIBA 2Z1KA 4W7VA 3WEMA 3BTNA 3N34A 1FKWA 3SRHA 1PPIA 5A8QA 3SUWA 1OT1A 4DVOA 4PULA 2YSWA 1RPKA 2TYSA 1VFFA 4J5NA 1W3HA 3M0JA 1DIOA 4D9PA 3L12A 1IGWA 1FDJA 4NYYA 4Q7BA 2WVSA 2BHZA 1VHCA 1SJDA 1G94A 4JTFA 3O15A 1H7XA 3PN8A 4OV4A 2QCDB 1S1PA 3BZJA 5AC4A 1B3VA 2B7PA 3B97A 1VHNA 3HPSA 1X7FA 2ZXQA 2CZDA 3QTPA 4WY0B 1A5MC 4EP8C 3UXKA 3W70A 3TTSA 4GX8A 4PMZA 5DFAA 1PS9A 2ZUNA 5I3FA 4RXFA 3UP8A 4C6KA 3VIGA 3CZEA 2FFCA 2A3LA 2JF7A 3FKKA 4BEUA 4C6LA 4LCRA 2F38A 1H4PA 3LX9A 3FA4A 4MY8A 5A6BA 1PWLA 4V33A 3GNXA 1GWJA 2UY4A 4MY9A 1TSIA 3BH4A 2GPTA 4XBSA 3WELA 3GTXA 1E6RA 3ANVA 4DJEC 2YB4A 1GQKA 4N9DA 1FDYA 3O06A 3NL6A 3AROA 2ZQ0A 1D2KA 1DJYA 2FB2A 3E02A 4PTXA 2GGIA 1WDDA 4F48A 4NNAA 4W9TA 4RDZA 5BYWA 3FSTA 3TZFA 3FW6A 3UY8A 1WB0A 1DPMA 4PUJA 4PGLA 4OFCA 3W4RA 3CUIA 3W02A 1JPMA 3IUDA 2AL1A 1XLHA 3A4XA 3CHDA 2Y8KA 1VLIA 2EBNA 5EBUA 4MKVA 3WY1A 2J7CA 4A8IA 3P2VA 4FR6A 3GIYA 3VD5A 1FUYA 2F61A 5HAOA 1RBAA 4LBSA 2P10A 2UZ9A 1WUEA 2OT0A 4FX8A 1TQJA 2FH8A 3C2EA 4BQ4A 1UWQA 3SQLA 1XH0A 1OIFA 3SY5A 3UY7A 5I3GA 1CW2A 3QR0A 2PTZA 2MUCA 4BI7A 2BHYA 1TTQA 2QGYA 3FDGA 3HV8A 4NVTA 1TWWA 3USBA 3T1GA 4BK9A 2VGBA 2UBPC 4Y9AA 4AD0A 3A3XA 1F3XA 2NUXA 3OLEA 3W82A 4CD6A 2DIKA 1C9DA 1UZHA 1KD0A 5A94A 3LZ3A 2PRLA 1JFXA 4QEEA 2B7NA 3TW7A 3DGBA 4J3ZA 1LOLA 3EXTA 7A3HA 2P0OA 3LCXA 1E3ZA 3VUSA 2GQ9A 2G3NA 2QUMA 3TYCA 5EMUA 3N9SA 3WLHA 1UROA 4O1BA 4WSJA 5MKGA 1I2PA 1LJYA 3WLOA 1QRQA 3FGCA 3ANUA 4I5XA 2A3AA 4FF5A 3WH8A 1XWYA 3I3DA 1TPEA 3I3BA 1YKWA 5I78A 1UKQA 4DBUA 4BQ5A 2Q6ZA 1RH9A 4BJHA 5FI8A 1FFRA 3O0FA 1HW6A 4L80A 1R6WA 5CCZA 1R9YA 1W54A 1Q7MA 1FCBA 2VXNA 3GYCA 5HUPA 1F74A 4Z08A 1UBSA 3GH5A 4AY8A 5DT5A 4I9TA 3CZLA 2W3ZA 4HBKA 3OO2A 3QV9A 2QLYA 5CKSA 1UBPC 2DSZA 1YPFA 2DT3A 3SCTA 1GG1A 5BNKA 3WUEA 3VOGA 1EHAA 4DBDA 1RCQA 1NFGA 1UWSA 3MQTA 4U10A 3A4JA 4K7VA 3VGDA 3O3RA 2YKKA 1W37A 1KRBC 1XICA 4GO8A 4XKYB 2NX3A 4EPDC 1DJIA 3UGVA 3P74A 1M41A 2CPUA 3FX4A 5AYZA 1UUQA 5D04C 3HQ1A 1D7FA 1PSCA 1AH0A 2QMKA 1PYMA 1BYCA 1GOIA 1EWDA 3W22A 1CXLA 1GVEA 2RDWA 2VUNA 5JUVA 3VDCA 3RCNA 4JD4A 1MQRA 4MFEA 3MHFA 1EYWA 3KXQA 1C91A 2AKZA 1QOQA 3NEHA 3UZXA 2C1HA 4G7EB 2ZVRA 4JQ1A 3KCJA 2XIOA 2VM8A 3KE0A 3DFOA 4LAMA 3KZPA 3JU2A 1TTIA 4C1KA 2XVLA 3Q65A 4X63A 2GVEA 4JN6A 3FXGA 4AY7A 3IIOA 1ZBCA 2CZEA 4ZOBA 3CV7A 3TONA 2RH9A 4YU1A 5GVJA 4XD3A 3H2MA 3RUBL 2VZTA 2ISFA 5A8GA 3FJ4A 3L0KA 3N2OA 2BMBA 5XIAA 1VLWA 5FEPA 1GKQA 3P93A 1RK5A 3RO6A 3WF2A 3STFA 3TN5A 4B5WA 1FWWA 2QUUA 3WLIA 1OIMA 4P7LA 1E0VA 3S47A 1NSJA 1QPRA 3SGGA 3CTLA 1HF6A 2EJ1A 1FWIC 3FDKA 3G1XA 3GR4A 2RGLA 1JDEA 3Q4DA 3B8IA 3BLIA 2CBVA 4JX6A 2EPNA 3T6CA 4O52A 1W3IA 4C7GA 2ZIDA 2R8WA 3BK0A 3GDRA 3PBYA 2HXTA 4IIDA 3EWXA 1TFVA 3H53A 3ITYA 1UOZA 4P8UA 1CI1A 4R3UA 2O56A 3IV3A 1QWKA 3U2OA 4CNNA 1E4NA 2J62A 3W01A 1XHGA 1ZFJA 1GYLA 1OF8A 2BSLA 4Q3MA 3ZWSA 1R8LA 4PB4A 3ZR6A 2HEJA 1JFHA 2YGYA 1KQYA 3GG0A 1TWSA 4FNUA 3PB2A 2YA0A 1TVNA 2JQXA 2QAFA 4IPPA 2AMGA 3WJZA 2GVJA 1F4HA 4HMEA 3SCOA 2ZRUA 2IPGA 4JY9A 3QFEA 5HNNA 2B81A 3SN0A 1QNOA 1NU5A 1HT6A 1XI3A 4ICCX 4HT3A 4MMWA 4ENLA 1LQAA 5J8LA 3IAPA 4H1ZA 3BAXA 4YHGA 3IVTA 1XG4A 4DX3A 5CLWA 4S38A 1UR9A 3OLDA 3KP0A 1P7TA 3TNOA 3ENLA 2FFIA 2PC8A 1KCLA 5HMFA 4FNPA 2WNWA 4CU6A 2WANA 4N7QA 3RDKA 1QW8A 1R5YA 1V7YA 1KBBA 3NTYA 4OZOA 5C71A 1J0JA 4G56A 4L9ZA 5E0KA 2BTMA 3UWUA 3GLCA 1VCVA 2XFRA 3NWRA 2QDEA 5A8MA 4WQ6A 4GBUA 1GGOA 3W86A 1PIIA 4GO9A 3KBMA 3UXDA 4RV8A 4B5VA 1LYXA 4A2SA 4GIRA 1DL3A 1PX3A 4HTYA 3KRBA 2QGHA 1WCGA 2VQUA 1T6MA 1Z89A 4ZTYA 2IKHA 4LUSA 1NF7A 1UPPA 2DZSA 3CWOX 2ATSA 2BFGA 1UH4A 4B5TA 2FB3A 2VELA 3LTSA 2E5CA 3HGSA 3BLKA 3DFYA 2YOCA 1H5VA 2CITA 3WLTA 3BV4A 1DIEA 1HVQA 1R86A 3K8KA 1JI2A 1H7PA 1WKDA 1OK6A 4E0CA 4B3LA 4IPIA 3HFTA 1MRAA 5LZLA 1HO1A 2BP1A 1A47A 1EPXA 4NT0A 4O19A 1DBTA 3E2VA 4NX5A 1LOQA 3LBOA 1E73M 3I10A 3SM0A 4XAGA 1WP6A 2X1TA 3RLGA 3BMWA 5DQPA 5CSYA 2VI0A 3ICJA 5DF0A 1OADA 4IM4A 1TTJA 1GUVA 1A49A 3PZOA 1O5XA 1VYSX 1F6KA 4XTIA 4X61A 4XX6A 5BXRA 3K8LA 1CGUA 1MEIA 4H8HA 3W7CA 1YE4A 4Z0JA 1UD3A 4UTKA 1JGMA 2V68A 3EDJA 2REQA 4OBRA 3UEQA 2C0HA 3T4WA 1E1CB 3VNYA 3CAWA 3PBVA 1S2AA 1BWKA 4JFWA 1TJ1A 3EX6A 3BQ6A 3OP2A 3KLLA 4WZHA 3WQEA 3EDDA 2IMRA 4XKMA 1X1NA 4UTWC 5K7JA 3BWWA 3QHMA 2CLKA 1N8WA 3KOFA 2AGKA 5C54A 1RY8A 3D46A 5T91A 1N82A 2EAWA 4UOZA 2F2KA 3FA3A 3S5NA 5C2GA 5CC5A 1HXJA 2C79A 3HPXA 3WQOA 3PAOA 4Y96A 4D6JA 1MW1A 4UTTC 3M44A 2ZRWA 3CJPA 1S1RA 3W27A 4CQ8A 5LIYX 4KF1A 6TAAA 2F6XA 4LT9A 2R14A 4AVNA 3V1PA 3H7UA 4GVIA 2VQTA 3U2EA 3ES8A 1XBZA 1GT8A 4FXRA 4AISA 2PTXA 2H8XA 3S83A 3A64A 4L56A 2VDIA 2NZLA 3U4AA 3P0XA 3WBEA 1V0MA 1MEHA 3SAZA 3NPXA 2F2HA 4TTGA 5FIPA 2RGMA 1CGXA 5FOOA 3TLQA 4N42A 2ZXDA 3GDTA 5D9PA 3TU9A 3QV8A 3S5ZA 3M6DA 1H0IA 2V3DA 5FESA 1NOWA 1V3HA 2I1OA 3PJTA 3KVLA 2XVNA 4WDXA 2XYLA 4M19A 1E56A 4S23A 3RIKA 4JTGA 1FHVA 3I4EA 3TUUA 4UMAA 1E5JA 2J24A 1Q63A 4J3TA 3V0TA 2V5LA 3MUY1 3PJUA 2FZMA 2OOFA 3H54A 1A5CA 1FHUA 3VNJA 3CLWA 4POCA 1EEPA 4OGZA 3MHGA 5KSWA 3LPGA 3V0SA 1Q6GA 2JIWA 4ERIA 1TPDA 4A3QA 3P8IA 1DHKA 2C1IA 3LHWA 3LU2A 3P7YA 2R1PA 5HNTA 1QMLA 4FX6M 1DORA 4MPQA 5IBXA 2PWGA 2PWEA 4PL1A 3NQ8A 1TELA 1S5TA 2RJGA 3QW4B 4D6EA 3GK0A 2ZRYA 3BGJA 4F9JA 3UXAA 4ORMA 2HBVA 2ZC8A 5IM51 5F4WA 1XYCA 1V0KA 3QEZA 2OGYA 3H22A 1VJSA 5A8OA 5CBBA 1QNRA 5KEZA 1VPYA 2WC7A 2WBKA 2FGBA 4NJIA 2VR2A 4KWVA 4PUWA 2DSVA 2BVDA 1ONXA 4CKQA 4B91A 4MJMA 4KWSA 3W07A 3E49A 1C29A 3NQBA 1M68A 5D8ZA 3NQVA 1S46A 5FD0A 4BA0A 4N9BA 3B40A 1UWAA 4IP7A 2Z7KA 4O8AA 1JYWA 5LGZA 2ZUSA 2GJXA 4QEHA 4HK7A 2GJNA 3B9OA 2PPGA 2B7QA 1HJSA 3RM8A 1MZHA 4ZMGA 1RP8A 3WDPP 3H2AA 4KCTA 4ZQRA 2OR2A 3HIJA 4Y2WA 5BU9A 4GIEA 2JF6A 2WB5A 2YR1A 8XIMA 1PKLA 4CEUC 1F05A 3CPRA 3GH4A 3RLUA 4DPQA 1JZ4A 3W7EA 3KS5A 2QVNA 1FXPA 4CVWA 1XRVA 1ONEA 4N9CA 2W4XA 1O4UA 3O9NA 4HHMA 4S3GA 2Q3RA 5LA1A 2X42A 2D3LA 3WH7A 4R5EA 1W5MA 1KXTA 3IUIA 3STPA 4JZ5A 2WJEA 2WJDA 3W1RA 3R58A 3PWIA 5F2MA 1W3NA 1XGZA 3PAJA 1KTBA 4GNVA 3SFWA 2PDFA 2ZX5A 1SO5A 1VPXA 2PDKA 1XL9A 4B9YA 2Y7EA 3DG3A 2R1LA 4AZCA 4XO6A 4R7OA 3DFPA 4W93A 2X0SA 5C7HA 3UWQA 1W3LA 4GQRA 5JMUA 1VYPX 2Z0IA 4CQAA 4GCXA 5ABTA 3WH9A 4YYCA 4S3DA 5CBIA 4F0KA 1FTXA 2Y89A 3NZGA 2CWXA 4JIIX 1A5LC 3TEVA 1K3UA 2BX7A 3URAA 4WK9A 4DELA 1QOPA 3AXXA 3C5QA 5T9CE 4US6A 2ZUWA 1GQJA 4MB1A 2Q8LA 4I9AA 1PZ3A 1UB3A 3SIMA 4C6JA 2BOEX 1QO5A 3CL7A 4I3GA 3NYDA 1NIUA 5HJLA 3PWGA 3V75A 2VFGA 3EDEA 4DJDA 5HANA 3C2FA 4O0QA 4L9XA 1JYNA 5C9RA 2E5DA 4BI5A 5BW6A 2G50A 1OK4A 2PBGA 3MUCA 2NX1A 1XPGA 1A5BA 4LW7A 3N9RA 1HG3A 3B9EA 4JTIA 4LVBA 2XISA 4M1BA 3VYLA 2EKGA 1PB0A 4ZO7A 1A5AA 3UWWA 3NDOA 2L5HA 1IT8A 3RMJA 3E5BA 1Q3NA 2YDRA 2C15A 2NQZA 3LY0A 4P8VA 1P4CA 1E51A 3LUTA 3CC1A 4LBRA 1TPC1 1OFDA 1P43A 1QO2A 4H9YA 2W91A 1JRCA 3THDA 4CNTA 3CLMA 4DY1A 1GVIA 1SZGA 1SW7A 4D2JA 2DU2A 2XVGA 2P8BA 2DSUA 3UR2A 4PTDA 3K4WA 3FVMA 4ACYA 4KMQA 3HQPA 1XGEA 3M7SA 5DCDA 4JNMA 3P62A 2O9PA 4UFHA 3G8EA 3L67A 3PTMA 1YW1A 4GI8A 4UR9A 4IPLA 3B8VA 2V3FA 3M0ZA 3WUBA 4DZ5A 4MJ2A 3TCSA 5GJPA 1H1YA 3AJ7A 3LCHA 3LERA 4M81A 3TN4A 1GORA 2ZZ4A 3PZUA 3QY6A 3VKAA 1D3GA 4PRTA 1AFSA 5CGTA 4RKAA 1OGSA 1YX1A 1JJKA 1DJQA 4L6HA 3LOTA 2OYMA 3WNLA 1W5NA 4ZA0A 1PXGA 1EBHA 1NOFA 4D8AA 2QJJA 4ZQMA 5I3JA 3PTKA 1V02A 2WHJA 5GJMA 3N14A 2R6OA 1X1ZA 1LDCA 3WLSA 1J10A 3ISIX 3AIQA 2OKOA 3P60A 4MB5A 4JHOA 1LRQA 2BDQA 4I90A 1EDGA 1XYAA 1F3TA 3PUEA 1V8EA 4RPPA 5D2YA 2NV1A 5LNRA 3H26A 2CWNA 1E9YB 3GC4A 1GEQA 3MMWA 5G2HA 3M0XA 4Z2KA 4EAMA 3PUOA 1DJXA 2FGLA 1GYMA 1XP3A 2CLMA 1OEPA 2H3DA 3ZSTA 4ZFCA 4S3AA 2CNCA 5FJRA 1K1DA 3PZQA 2VFIA 1Q6OA 2QDHA 2Z6IA 3KOXA 4S3BA 1ZRQA 4K68A 2DZXA 2X30A 3K2GA 3L2MA 1UP0A 3SQMA 4HVXA 4ZE5A 2E0PA 4YCOA 4JOMA 2HS8A 4NAEA 3W2LA 2ZC1A 1EDTA 2HVOA 2BY0A 4PBGA 4CCCA 3FCPA 1BG9A 4AZHA 2DZTA 4CUCA 1KXVA 2HRWA 4HP5A 5LIKX 3UW6A 2G4FA 4GJJA 1B3WA 4A21A 1P5BA 1MXGA 1XLEA 4DNHA 2FQIA 3MB9A 1E72M 3GHSA 2EF9A 1FH7A 3RFAA 5A69A 3WQ6A 4C1NA 1LORA 1J0ZA 5KINA 3DC8A 3DESA 3CQJA 1IIGA 2NVDA 2WNZA 4B4HA 3ABSA 4Q4MA 1LTDA 3B9AA 3DBNA 1AQ0A 2XU2A 3LHZA 2ZCGA 4C6FA 1RJRA 1MDRA 2X2GA 3SY1A 3G3DA 1Q6DA 4O15A 1KA9F 4GA8A 1FH9A 3IRDA 4HZMA 5HINA 5LA2A 4YTTA 4FS9A 3PPFA 1C8VA 3IUHA 2VC5A 3LHTA 2Z1WA 3TKFA 1E70M 4OIFA 1SR9A 1Q6QA 1X96A 4FMVA 1ZP4A 3OG3A 3FS2A 4EXBA 4HU0A 1AL8A 4MNMA 1XIEA 1KGWA 4OT7A 4ACZB 2FKPA 1UP2A 1JEZA 4LYPA 1W56A 3CASA 5HQEA 3QFWA 1TV4A 1J79A 2W92A 3EXRA 4TV5A 3S46A 2XWEA 3W9ZA 4HSNA 2WYSA 1K9EA 4RV3A 3DOPA 3VMNA 1OFOA 4H9MA 4H9ZA 4GZ7A 4XO7A 5AYBA 4DB7A 1FWCC 1Q2RA 2O9RA 3W7JA 1M04A 5D2XA 1R3TA 3AHZA 4ZSTA 1SO4A 3S6DA 3V7PA 2Q3OA 3OVPA 5I7GA 1SSGA 1O66A 4JY8A 1BWVA 3VU2A 3CZKA 1H1ZA 3QQ1A 4JIEA 4Y9OA 3IVUA 4GZIA 4NAFA 2PCEA 1UMYA 1LL7A 1P0NA 2GQ8A 3P67A 3FNDA 4R9OA 5TQLA 2OQHA 2OX1A 3FIGA 2XH2A 4MLRA 5HQLA 1HTIA 2GOKA 1AW1A 1HJQA 1FWAC 1Z3NA 3B3DA 1OCNA 1Q65A 1VFMA 1E4LA 1QNQA 4RDYA 5EA9A 1LZOA 3ALFA 2J7EA 1CT5A 3EPNA 4R88A 5JBDA 2A85A 4IIFA 4AC1X 1AJZA 1GOQA 3G1RA 1FCUA 1XDMA 3SGUA 2UY3A 3M16A 1HUVA 1KR1A 1OC5A 5DRIA 2Y24A 3BLOA 1KCZA 1Z9AA 3F7JA 4PMYA 4RZBA 1JCJA 1TA3B 3MKKA 1G1YA 2BB0A 3PANA 4TIMA 3FN9A 4UQBA 1OINA 1G0CA 1WOAA 3W3OA 2PRHA 2ZXBA 4W5UA 2TSYA 2XM1A 3HZ3A 5BU6A 2Z2AA 4YL2A 2JEQA 3CHFA 3PM6A 1R3QA 2YDQA 3JVAA 4J35A 4ROPA 2DQWA 5A6LA 1OHLA 1TRIA 3NQDA 3HG4A 5ABFB 7PTDA 3SBFA 1VFHA 2XIQA 3GBEA 1MSSA 3RPTA 1QPNA 2XFFA 3A21A 1X39A 1TVPA 3WO8A 5DMLA 3QZ6A 4NUWA 2J7HA 3WLNA 3T05A 3UWVA 1V0LA 2CBUA 3QYSA 3W85A 1RQEA 1NDZA 2DEPA 4J3XA 2NQ9A 1W1VA 3DENA 3LCGA 1H09A 3N18A 3ITLA 4UTJA 2KZHA 2PA6A 4I5UA 3GU9A 3C2YA 1XBVA 4L64A 5H91A 4L7ZA 4AEOA 1PIFA 1GOKA 3D3FA 3QRHA 1QU4A 2NQHA 3P0WA 4MNJA 3T0CA 4H7ZA 3ABOA 1FWSA 3UETA 3UD6A 1KFKA 4XAZA 1P7TB 3TCEA 1VFTA 4C6CA 5EB8A 3G6LA 4L61A 5CGMA