1V9AA

Crystal structure of uroporphyrin-iii c-methyl transferase from thermus thermophilus complexed with s-adenyl homocysteine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
225
structure length
219
Chain Sequence
b'GRVYLVGAGPGDPELLTLKAYRLLKEAPVVLYDRLVDERVLALAPGEKVYVGKKQEEIHRLLLRHARAHPFVVRLKGGDPMVFGRGGEEVLFLLRHGVPVEVVPGVTSLLASGLPLTHRGLAHGFAAVSGVLEGGGYPDLRPFARVPTLVVLMGVGRRVWIAKELLRLGRDPREPTLFVERASTPKERRVHARLEEVAEGKVEVRPPALWILGEVVRVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uroporphyrin-III C-methyltransferase
publication title Structure of a closed-form uroporphyrinogen-III C-methyltransferase from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 60
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1v9aA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1v9aA01
2P6IA 3HH1A 2YBQA 3FQ6A 2EGBA 5HW4A 2DV5A 2DSIA 2E07A 2EH2A 1PJSA 1WYZA 2ED3A 2P6DA 3NUTA 1V9AA 2DV7A 2E8RA 2EEQA 1CBFA 2YBOA 2EK3A 2EH4A 2EGSA 1VCEA 2EKAA 2E0NA 2ELEA 2BB3A 2PCIA 3KWPA 2EHCA 2DEKA 1VA0A 2E4RA 2OWGA 2DV4A 2EH5A 1WNGA 2EL3A 2EMUA 2ENIA 2P5CA 2PB5A 2E0KA 2E4NA 2E8HA 3NEIA 2OWVA 2PCMA 2EGLA 2PCKA 2E7RA 2PB4A 2EK4A 2DXWA 2E16A 2E8QA 2HUXA 2ZVCA 2EL1A 2EL2A 1VHVA 2DXVA 3I4TA 2HUQA 2PCGA 2PB6A 2EJKA 2EK2A 4E16A 2Z6RA 2HUVA 2QBUA 3NDCA 2DXXA 2NPNA 2PCAA 2P9DA 1S4DA 2P6LA 2OWUA 2ELDA 2EN5A 2OWKA 2PCHA 2E8SA 1WDEA 2DSGA 2EMRA 2CBFA 2DV3A 1PJQA 1PJTA 1VE2A 2E17A 2P5FA 2EJZA 2HR8A 2EJJA 2EL0A 3FFYA 2ED5A 2EK7A 2P6KA 2OWFA 2EHLA 3ND1A 2DSHA 2HUTA 2E15A 2P2XA 2ZVBA 2E08A
chains in the Genus database with same CATH superfamily
2P6IA 3HH1A 2YBQA 3FQ6A 2EGBA 5HW4A 2DV5A 2DSIA 2E07A 2EH2A 1PJSA 1WYZA 2ED3A 2P6DA 3F7TA 3NUTA 1V9AA 2DV7A 2E8RA 2EEQA 1CBFA 3SZLA 2YBOA 2EK3A 2EH4A 2EGSA 3TIXB 1VCEA 2EKAA 3KE9A 2E0NA 2ELEA 2BB3A 2PCIA 3KWPA 2EHCA 3KEMA 2DEKA 1VA0A 2E4RA 2OWGA 3T0GA 2DV4A 3KEFA 2EH5A 3SZOA 3UWMA 3LMMA 3UV7A 1WNGA 2EL3A 2EMUA 4H4EA 3T0FA 2ENIA 2P5CA 2PB5A 2E0KA 2E4NA 2E8HA 4H4DA 3NEIA 2OWVA 2PCMA 2EGLA 2PCKA 2E7RA 4EB3A 2PB4A 2EK4A 2DXWA 2E16A 4MV0A 3UTCA 2E8QA 4MUYA 3UV3A 3URKA 2HUXA 2ZVCA 2EL1A 2EL2A 1VHVA 4H4CA 2DXVA 3I4TA 2HUQA 2PCGA 4MUXA 2PB6A 2EJKA 2EK2A 4E16A 2Z6RA 2HUVA 2QBUA 3NDCA 2DXXA 2NPNA 2PCAA 2P9DA 3SZUA 2KYYA 1S4DA 2P6LA 3ZGLA 3ZGNA 2OWUA 2ELDA 2EN5A 4N7BA 3KELA 2OWKA 2PCHA 2E8SA 1WDEA 2DSGA 2EMRA 2CBFA 2DV3A 1PJQA 1PJTA 1VE2A 2E17A 2P5FA 2EJZA 2HR8A 2EJJA 2EL0A 3UV6A 3KE8A 4MV5A 3UTDA 3FFYA 2ED5A 2EK7A 2P6KA 2OWFA 2EHLA 3DNFA 3ND1A 2DSHA 2HUTA 2E15A 2P2XA 2ZVBA 2E08A
chains in the Genus database with same CATH topology
2P6IA 3HH1A 2YBQA 3FQ6A 2EGBA 5HW4A 2DV5A 2DSIA 2E07A 2EH2A 1PJSA 1WYZA 2ED3A 2P6DA 3F7TA 3NUTA 1V9AA 2DV7A 2E8RA 2EEQA 1CBFA 3SZLA 2YBOA 2EK3A 2EH4A 2EGSA 3TIXB 1VCEA 2EKAA 3KE9A 2E0NA 2ELEA 2BB3A 2PCIA 3KWPA 2EHCA 3KEMA 2DEKA 1VA0A 2E4RA 2OWGA 3T0GA 2DV4A 3KEFA 2EH5A 3SZOA 3UWMA 3LMMA 3UV7A 1WNGA 2EL3A 2EMUA 4H4EA 3T0FA 2ENIA 2P5CA 2PB5A 2E0KA 2E4NA 2E8HA 4H4DA 3NEIA 2OWVA 2PCMA 2EGLA 2PCKA 2E7RA 4EB3A 2PB4A 2EK4A 2DXWA 2E16A 4MV0A 3UTCA 2E8QA 4MUYA 3UV3A 3URKA 2HUXA 2ZVCA 2EL1A 2EL2A 1VHVA 4H4CA 2DXVA 3I4TA 2HUQA 2PCGA 4MUXA 2PB6A 2EJKA 2EK2A 4E16A 2Z6RA 2HUVA 2QBUA 3NDCA 2DXXA 2NPNA 2PCAA 2P9DA 3SZUA 2KYYA 1S4DA 2P6LA 3ZGLA 3ZGNA 2OWUA 2ELDA 2EN5A 4N7BA 3KELA 2OWKA 2PCHA 2E8SA 1WDEA 2DSGA 2EMRA 2CBFA 2DV3A 1PJQA 1PJTA 1VE2A 2E17A 2P5FA 2EJZA 2HR8A 2EJJA 2EL0A 3UV6A 3KE8A 4MV5A 3UTDA 3FFYA 2ED5A 2EK7A 2P6KA 2OWFA 2EHLA 3DNFA 3ND1A 2DSHA 2HUTA 2E15A 2P2XA 2ZVBA 2E08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6I A;  3HH1 A;  2YBQ A;  3FQ6 A;  2EGB A;  5HW4 A;  2DV5 A;  2DSI A;  2E07 A;  2EH2 A;  1PJS A;  1WYZ A;  2ED3 A;  2P6D A;  3NUT A;  1V9A A;  2DV7 A;  2E8R A;  2EEQ A;  1CBF A;  2YBO A;  2EK3 A;  2EH4 A;  2EGS A;  1VCE A;  2EKA A;  2E0N A;  2ELE A;  2BB3 A;  2PCI A;  3KWP A;  2EHC A;  2DEK A;  1VA0 A;  2E4R A;  2OWG A;  2DV4 A;  2EH5 A;  1WNG A;  2EL3 A;  2EMU A;  2ENI A;  2P5C A;  2PB5 A;  2E0K A;  2E4N A;  2E8H A;  3NEI A;  2OWV A;  2PCM A;  2EGL A;  2PCK A;  2E7R A;  2PB4 A;  2EK4 A;  2DXW A;  2E16 A;  2E8Q A;  2HUX A;  2ZVC A;  2EL1 A;  2EL2 A;  1VHV A;  2DXV A;  3I4T A;  2HUQ A;  2PCG A;  2PB6 A;  2EJK A;  2EK2 A;  4E16 A;  2Z6R A;  2HUV A;  2QBU A;  3NDC A;  2DXX A;  2NPN A;  2PCA A;  2P9D A;  1S4D A;  2P6L A;  2OWU A;  2ELD A;  2EN5 A;  2OWK A;  2PCH A;  2E8S A;  1WDE A;  2DSG A;  2EMR A;  2CBF A;  2DV3 A;  1PJQ A;  1PJT A;  1VE2 A;  2E17 A;  2P5F A;  2EJZ A;  2HR8 A;  2EJJ A;  2EL0 A;  3FFY A;  2ED5 A;  2EK7 A;  2P6K A;  2OWF A;  2EHL A;  3ND1 A;  2DSH A;  2HUT A;  2E15 A;  2P2X A;  2ZVB A;  2E08 A; 
#chains in the Genus database with same CATH topology
 2P6I A;  3HH1 A;  2YBQ A;  3FQ6 A;  2EGB A;  5HW4 A;  2DV5 A;  2DSI A;  2E07 A;  2EH2 A;  1PJS A;  1WYZ A;  2ED3 A;  2P6D A;  3F7T A;  3NUT A;  1V9A A;  2DV7 A;  2E8R A;  2EEQ A;  1CBF A;  3SZL A;  2YBO A;  2EK3 A;  2EH4 A;  2EGS A;  3TIX B;  1VCE A;  2EKA A;  3KE9 A;  2E0N A;  2ELE A;  2BB3 A;  2PCI A;  3KWP A;  2EHC A;  3KEM A;  2DEK A;  1VA0 A;  2E4R A;  2OWG A;  3T0G A;  2DV4 A;  3KEF A;  2EH5 A;  3SZO A;  3UWM A;  3LMM A;  3UV7 A;  1WNG A;  2EL3 A;  2EMU A;  4H4E A;  3T0F A;  2ENI A;  2P5C A;  2PB5 A;  2E0K A;  2E4N A;  2E8H A;  4H4D A;  3NEI A;  2OWV A;  2PCM A;  2EGL A;  2PCK A;  2E7R A;  4EB3 A;  2PB4 A;  2EK4 A;  2DXW A;  2E16 A;  4MV0 A;  3UTC A;  2E8Q A;  4MUY A;  3UV3 A;  3URK A;  2HUX A;  2ZVC A;  2EL1 A;  2EL2 A;  1VHV A;  4H4C A;  2DXV A;  3I4T A;  2HUQ A;  2PCG A;  4MUX A;  2PB6 A;  2EJK A;  2EK2 A;  4E16 A;  2Z6R A;  2HUV A;  2QBU A;  3NDC A;  2DXX A;  2NPN A;  2PCA A;  2P9D A;  3SZU A;  2KYY A;  1S4D A;  2P6L A;  3ZGL A;  3ZGN A;  2OWU A;  2ELD A;  2EN5 A;  4N7B A;  3KEL A;  2OWK A;  2PCH A;  2E8S A;  1WDE A;  2DSG A;  2EMR A;  2CBF A;  2DV3 A;  1PJQ A;  1PJT A;  1VE2 A;  2E17 A;  2P5F A;  2EJZ A;  2HR8 A;  2EJJ A;  2EL0 A;  3UV6 A;  3KE8 A;  4MV5 A;  3UTD A;  3FFY A;  2ED5 A;  2EK7 A;  2P6K A;  2OWF A;  2EHL A;  3DNF A;  3ND1 A;  2DSH A;  2HUT A;  2E15 A;  2P2X A;  2ZVB A;  2E08 A; 
#chains in the Genus database with same CATH homology
 2P6I A;  3HH1 A;  2YBQ A;  3FQ6 A;  2EGB A;  5HW4 A;  2DV5 A;  2DSI A;  2E07 A;  2EH2 A;  1PJS A;  1WYZ A;  2ED3 A;  2P6D A;  3F7T A;  3NUT A;  1V9A A;  2DV7 A;  2E8R A;  2EEQ A;  1CBF A;  3SZL A;  2YBO A;  2EK3 A;  2EH4 A;  2EGS A;  3TIX B;  1VCE A;  2EKA A;  3KE9 A;  2E0N A;  2ELE A;  2BB3 A;  2PCI A;  3KWP A;  2EHC A;  3KEM A;  2DEK A;  1VA0 A;  2E4R A;  2OWG A;  3T0G A;  2DV4 A;  3KEF A;  2EH5 A;  3SZO A;  3UWM A;  3LMM A;  3UV7 A;  1WNG A;  2EL3 A;  2EMU A;  4H4E A;  3T0F A;  2ENI A;  2P5C A;  2PB5 A;  2E0K A;  2E4N A;  2E8H A;  4H4D A;  3NEI A;  2OWV A;  2PCM A;  2EGL A;  2PCK A;  2E7R A;  4EB3 A;  2PB4 A;  2EK4 A;  2DXW A;  2E16 A;  4MV0 A;  3UTC A;  2E8Q A;  4MUY A;  3UV3 A;  3URK A;  2HUX A;  2ZVC A;  2EL1 A;  2EL2 A;  1VHV A;  4H4C A;  2DXV A;  3I4T A;  2HUQ A;  2PCG A;  4MUX A;  2PB6 A;  2EJK A;  2EK2 A;  4E16 A;  2Z6R A;  2HUV A;  2QBU A;  3NDC A;  2DXX A;  2NPN A;  2PCA A;  2P9D A;  3SZU A;  2KYY A;  1S4D A;  2P6L A;  3ZGL A;  3ZGN A;  2OWU A;  2ELD A;  2EN5 A;  4N7B A;  3KEL A;  2OWK A;  2PCH A;  2E8S A;  1WDE A;  2DSG A;  2EMR A;  2CBF A;  2DV3 A;  1PJQ A;  1PJT A;  1VE2 A;  2E17 A;  2P5F A;  2EJZ A;  2HR8 A;  2EJJ A;  2EL0 A;  3UV6 A;  3KE8 A;  4MV5 A;  3UTD A;  3FFY A;  2ED5 A;  2EK7 A;  2P6K A;  2OWF A;  2EHL A;  3DNF A;  3ND1 A;  2DSH A;  2HUT A;  2E15 A;  2P2X A;  2ZVB A;  2E08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...