1V9JA

Solution structure of a bola-like protein from mus musculus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
113
Chain Sequence
MKGSSHHHHHHSSGASLVPRGSEGAATMELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFEQKTLTPEQWTRQRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA-like protein RIKEN cDNA 1110025L05
publication title Solution structure of a BolA-like protein from Mus musculus
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 18
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v9jA00
3QK0A 4FA6A 1XD3B 5DPSA 2WX0A 4I6PA 3CMMB 1NBFC 1WI0A 4JQWC 2NBVB 2FCMA 4WJPA 4DDID 3ZW3A 3I3TB 4G11A 1YX5B 2KQSA 3A4RA 3VQIA 2PE6B 2KNBA 2CR5A 3HIZA 2KK8A 2KLCA 3KYCD 3UF8A 1WMHB 3QA8A 1WGGA 4FLHA 2IY0B 2O2VB 2LRWA 2KTFA 3DVNV 2LXAA 3KW5B 2MBBB 4MGKE 1E8XA 2ZNVC 3L17A 1WGDA 5KHOA 3U8ZA 1RLFA 2MWSB 4CO7A 5JZEB 1Z2MA 2K8CA 3CF6E 3GZNI 3ML9A 2BF8B 5G55A 1L2NA 1EUVB 3PV1A 3RD2A 2R2QA 4K81A 5L95C 3JVZX 3HK0A 1LM8B 2MBOA 1EF1A 3VH3B 4P7IA 2AL3A 3Q3FA 3VHTC 2LD9A 4II2B 4DHZE 3KH0A 3QIJA 4XZ4A 3ECIA 2DAJA 3JSVB 2KANA 2Z0EB 1H8CA 1RAXA 2RPQA 2KHWB 2J0KA 2RD0A 2MBHA 4KDLB 4GU2A 2HJ8A 2L76A 2ZNVB 2K6DB 3QC8B 4XC2A 4PS3A 3PRZA 3PT2B 2ZVNA 3NZSA 4XX5A 3L08A 2DHZA 2MRPA 1OEYJ 3UIPB 2XEWA 1FXTB 1RFAA 2M1MA 4JL9A 1IPGA 2XBBC 2BKRB 4GOCA 4MSQB 4KIKA 2DZMA 3H1UA 1LFDA 3H9DA 2M4NA 3JW0X 4GDLA 2WDTB 4K1RB 4OVVA 3WIMA 4DHZB 4AUQC 2D3GA 2KKCA 4E74A 4JGHB 1YD8U 2RGFA 1HE8A 4NQLB 2IYDB 3R7RA 2ZJDA 3VVWB 3ZVVA 1VD2A 2LVPA 4A3OA 2GMIC 2LGXA 1UBQA 2LASA 2G45B 2KDEB 2AL6A 3DOWA 3SHQA 3VFKA 2K39A 5C1ZA 3SDLC 3NHEB 1X1MA 2LXCA 2VRRB 3RT3B 1V86A 2KX3A 5E6OA 5C23A 2N7DA 2CS4A 2UYZB 3DBLI 4I6NB 4G0NB 1WZ3A 1WJ6A 2AYOB 3L54A 3PSEB 2MP2B 2BYFA 2DYBA 4NAWA 2LRUA 3MTNB 5AZGA 2FAZA 4WJNA 5D2MB 3H7PB 5D94A 4ZRJA 2MLBA 4HDQA 1TZ1A 2FIDA 2RSUA 1V6EA 2WWZA 4W9FA 3T8MA 2ZPYA 4MJSA 2DX5B 4FHKA 3QHTA 4LJOB 2MCNB 1J0GA 4AJYB 3KUCB 1I35A 3NS8A 3PHXB 4KDIC 2OOBB 4KVGB 1K8RB 4MELA 4MGYE 2KXJA 4FULA 4FBJB 1C3TA 2QHOA 3R7QA 3M3JA 3EFUA 2FUHB 2IY1B 4MH0E 1WF9A 4WWNA 3V62A 4URKA 2JF5A 1WX7A 2LUEA 2N1WA 3ZDTA 2IO2B 4RM8A 4HLEA 4IG7B 3DPDA 1WYWB 5LXIB 2LI5A 2RR9A 3QWZB 4JIOU 4IW0A 1TBEA 3T9LA 3HM3A 2NPTA 2NBUA 2V3SA 3VTVA 3A9KB 4TKNA 3OJ4B 4X57B 3DDCB 1ZW7A 1Q0WB 4MM3A 4IWPA 4FJYA 1C1YB 1P98A 2KTRA 3DQVA 4TQ0A 5DPWA 1WR6E 4CYEA 2BPSA 4WQOB 4B9KA 5AZHA 1UH6A 3ENEA 1KM7A 5BO4B 2MA9B 3A1QB 1V49A 3JYUA 4W9DA 2I1KA 4NJ6A 1E7VA 4JLCA 3U7DA 2LJ5A 3DCGA 4FJZA 3VUWA 4EFOA 3BY4B 3X0WA 5E6PA 3ZNGC 2PPHA 1WE6A 3PREA 2DYMA 1P0RA 2G3QB 4W9EA 3PVLA 4G50A 3H7SA 4GDKB 3Q3JA 2J7QB 1Z5SB 3QAQA 3TMPB 2MX2A 4EZJA 4GMVA 2KC2A 2B3AA 4HJKA 4NQKE 4PYUA 2L0FA 3WA0A 3KUZA 3RZFA 3OLMD 5DCNA 4F1SA 3V6CB 2IO0B 3V60A 3APCA 5CX3A 4F7ZA 2BWFA 2JT4B 2J0MA 4W9GA 2FCQA 4GB9A 2N9PC 2C7NB 2D2QA 3AI5A 2O6VD 4DXAB 3UINB 4AP4C 1ISNA 2K8HA 1WXMA 2O2VA 3B1LX 4ICUA 1IP9A 1WZ0A 2MBEA 1WRDB 1RRBA 1OEYA 2O6VA 2G4SA 4KV2A 1YJ1A 3VTUA 2DZIA 3PHWB 3DVGY 1J8CA 3KUDB 2HTHA 3ZUNA 1R4MI 3QX1A 1E7UA 1OTRB 3K9OB 1V80A 1Y8RC 2NCNA 4ICVA 3ZLZA 5JH5C 3ZTCA 2DZJA 1E8YA 4NNJB 4W9JA 4E3CA 3IG3A 2KC1A 4FADA 2N1VA 2JXXA 3A33B 3VH4B 4EOYA 2KWVB 3PLVA 3GOEA 2KFKA 1QZEA 2KJHB 3V61A 2NR2A 2KQ7A 3ZIMA 4WWOA 5G2NA 3JSVA 2ZPNA 4ANVA 4ANXA 1WJUA 3TIXA 1ZKHA 3L10B 4BFRA 1WX9A 2JUOA 1A5RA 4K7UA 3AU4A 5DPTA 2YVCA 3PZDA 1UELA 4ANUA 4M8MA 1GNUA 1R4NI 2NVUI 3PRPB 4HK2A 4LJPB 4GSWA 3VDZA 1WX8A 3QARA 3DVGX 2BGFA 2XK5B 1JRUA 2L0TA 4DBGA 1WFYA 1IYFA 4KSLC 1WM2A 2N9EB 1V9JA 3NZUA 4GIVA 3X23A 2JPHA 2MSED 2Z0DB 2C60A 2J0JA 2M0XA 1J19A 1UZXB 4RM9A 4MGIE 2IBIB 5CHVC 5TR5A 3W1SC 5L83A 1WXAA 2KLGA 1H4RA 4IM0A 1GJZA 4EZKA 1ZGUB 4WJOA 2KDFB 2L3ZA 4W9HA 4WJQA 3O65B 3SU8X 3VAWA 4ZRKA 5JHBA 4F8CB 2MBQA 3ALBA 2IO3B 4WAAA 2CHWA 4TV3A 1CMXB 2V4LA 3QJZA 4EEWA 3WAOA 4MGZE 4OVUA 4A20A 1WXVA 4ZYNA 4MDKE 4HCNB 3APFA 1EF5A 1WIAA 5LXHA 2ASQA 3ZRCA 2KWUB 2LVQA 1GUAB 4HDOA 3ZNID 4HPMB 1MG8A 3AULA 4FN2A 2CKHB 1WGHA 3TBLD 1V5TA 3B0AA 4MSMB 2KN5A 1L7YA 4DHJD 2KVRA 2JZZA 2K1FA 3RUIB 2DYOA 1P3QU 3A9JA 2MP2A 2N7EA 1WGYA 5AZFA 4WWPA 4KSKC 1P1AA 2NBWB 4I6LB 1SIFA 1V5OA 2ZVOA 3H7PA 4GN1A 4ANWA 2FCNA 3CSTA 2IZVB 2L00B 2K6QA 1WGRA 3R66C 4AWJA 2PJHA 3SD5A 3NOBA 4KZCA 4BVUC 2M8SA 3DBSA 4NJ7A 1WE7A 3TJPA 3WAMA 1UD7A 2KFJA 1E8WA 4ASWC 4M8NA 2Y5BB 4W9IA 5J18A 4B6WA 5J17A 3VUXA 2CHXA 1KOTA 3ML8A 1OGWA 2JRIB 3ZNZB 1NDDA 4IWOA 5KHQA 1D3ZA 3U30A 3V6EB 5JHAA 1KJTA 2ZCCA 3PRMB 4W9KA 4FHJA 3N30A 3VUYA 3VXWA 2N9XA 4LDTD 2KOXA 2K25A 2DAFA 1I42A 3A9KA 1LQBA 1V2YA 1YX6B 4DWFA 1M94A 3EECA 1Q5WB 2BWES 4HCPB 3IFWB 4NPNA 3L16A 4BKSD 3TCAA 3ZDMC 3IBEA 2GBJA 1V81A 3KYDD 2GBRA 2BYVE 1WY8A 4BKSA 3P2BA 3A1QA 2OJRA 2FNJB 1VCBA 2PE9A 2WX1A 1Q1OA 1WR1A 3CSFA 1SGHA 4AJWA 1WMHA 4W9CA 4BOZB 2NS5A 4M0WB 4PYZA 2KJRA 1T0YA 1TGZB 2O6VB 4AOFA 3H6NA 2KDBA 2FCSA 3N3KB 2N4FA 4GDKA 1XT9B 3UGBB 4EUTA 1YIWA 5CTRC 2KMAA 2LZ6A 3EHVA 4CHKA 3NY5A 1U4AA 1WM3A 3A4SC 3L0WB 2JZ3B 1TTNA 2WYQA 2C9WB 1WH3A 2KO3A 4KIKB 2HE7A 2KFKB 4W9LA 4GDLB 4TQ1A 2AWTA 2Z59B 4J6IA 3TL5A 1AARA 3M95A 4IC7B 4BKGA 2EMTA 1F9JA 2PEAA 3QQ8B 3MHSD 2GBNA 3KVFB 2IO1B 4A3PA 3ZTDA 1E8ZA 4GXBA 3EC8A 2DENB 4BKTA 2JY6A 3HM6X 3PS6A 4DK5A 3L13A 1S3SG 3AU5A 4PS7A 4HPLB 4EKUA 3DVNU 3BINA 5J2RA 2CHZA 3ZKJC 3WALA 3VTWA 2I1JA 3ZRFA 5GMVA 2HD5B 1P9DU 1UBIA 2BKFA 4IM3A 2D07B 2KX0A 1EO6A 1PQSA 2LGDA 4DDGD 2FIFA 2C7HA 4NAWB 5CHFA 2R2OA 5D7GA 4EZLA 2L8JA 3M63B 1WJNA 1G6JA 2KJ6A 1GC7A 4ZDVA 1WXSA 2EKEC 5CHWA 4IWQA 4MEMA 3S2AA 1BT0A 4MJSB 3PGEA 2XK5A 4IM2A 2G4DB 3RZWC 3W1YA 2D11A 2CU1A 2AEHA 5IAAC 1E5WA 5LLIA 4RMAA 1LXDA 3IHPC 1GG3A 3HHMA 3PLUA 3UQAA 4HXDA 2A5UA 2EMSA 4FJVB 4HWIB 3UIOB 5IA7A 5AEKB 1E90A 3A9JB 3ZNHB 2JWZA 2LGYA 2V1YA 3LDZE 2KDIA 2L7RA 2ZEQA 2BYEA 5E6NA 4BBNF 4DHJB 3LJ3A 2W9NA 4ZRIA 2JRHA 3IVFA 3ONSA 2DZKA 2D10A 3DBRI 4K7WA 3WAPA 2NPTB 3C0RB 3B08A 4TUUA 1XQQA 3ZO5B 5HKHA 2MQJA 2K8BA 2GBMA 1KLVA 2ZZPB 1OQYA 4KZ0A 4N9F4 3WANA 3OAWA 2KTRB 2C7MB 3R3MA 5FR6A 4GGQA 2MW5A 3AXCA 2ZCBA 2C5LC 3APDA 4IUMB 4PS8A 1UGMA 4K7SA 2M17A 2REXA 4YL8A 2KMCA 4NY0A 3RYTA 4LCDE 5DPRA 2GOWA 3UQBA 4E71A 2A4ZA 2KZRA 3RULA 3W1SA 3OJ3A 1YQBA 3N32A 2KWCA 1GC6A 5EDSA 4G3XB 1WJ4A 4II3B 3PTFC 3K9PB 1S1QB 3PPAA 1NI2A 3M62B 3QCAA 3D32A 5D6JB 4BOSC 4HVBA 4BBNC 2JVCA 3RCZA 2GBKA 2LVOA 2L05A 2LWPA 2UWQA 3MJWA 2KD0A 4LDTB 2YLMA 1SE9A 3DBHI 4B95A
chains in the Genus database with same CATH superfamily
3QK0A 5DPSA 3C19A 3GP7A 4WJPA 1HTOA 4G11A 2KQSA 3VQIA 4LNFA 3KYCD 3HIZA 5TSSA 2JWUA 3DVNV 1FNUA 3KW5B 2RPVA 3U8ZA 5KHOA 5JZEB 2PW9A 2K8CA 5G55A 3RNCC 3PV1A 5L95C 2LGSA 3HK0A 2MBOA 4P7IA 3VHTC 4ZHPA 4NAMA 1K50A 1DOXA 2B76B 2RPQA 2J0KA 1I4PA 3AEBB 2L76A 3PRZA 1BXTA 1CJEA 3NZSA 1ESFA 1EM7A 4YT0B 1SE2A 5BMIA 1PFDA 5G5GA 1T3QA 3H1UA 1LFDA 4GDLA 2M4NA 2WDTB 1TS5A 2KKCA 4E74A 1XLQA 1YD8U 2RGFA 3P1MA 1HE8A 2MEKA 3W5UB 2ZJDA 3BK2A 1ZOYB 2M19A 2W55A 1VD2A 4LTUA 4A8XC 1R7SA 2AQ2B 2AL6A 3SHQA 5C1ZA 3VFKA 3ETRA 1RFKA 1E7PB 1X1MA 4KKIA 4HKQA 4RF1A 2UYZB 1ENFA 3L54A 2KWDA 1V8CA 4NAWA 2LRUA 3AE3B 5D94A 4ZRJA 3BWUD 4W9FA 3T8MA 4XE0A 2ZPYA 1V1PA 4LJOB 1J0GA 4AJYB 3NS8A 4KDIC 1I42A 4MGYE 4FULA 1C3TA 1QOFA 4JWSC 1WF9A 2JF5A 3RNEC 2PVGC 4IG7B 3DPDA 4UDUC 2WS3B 4JIOU 3T9LA 2WLBA 2NPTA 2MJDA 5E6JA 2NBUA 2V3SA 3RPFC 3RNBC 2L1AA 4JE3B 3RNFC 4RGTA 4FJYA 3DQVA 1ZXIA 4KX6B 4YXDB 2BPSA 4YTNB 4WQOB 1KM7A 2MA9B 4N6EB 4NJ6A 4ZRPA 1XCTL 3DCGA 4B0MA 1XXGA 5E6PA 4OZAA 3AE1B 2M0AA 1ACCA 3AECB 4MACA 1Z5SB 2YEPB 1F2RC 2B3AA 4NQKE 3IXSA 1VRAB 4PYUA 3KUZA 1L6VA 2N0SB 3RZFA 4F1SA 3APCA 1UUPA 1NYQA 3AI5A 1MVKA 1ISNA 5FK9C 3B1LX 1I4XA 4C4VA 1JWAD 1K52A 1WRDB 5FR3A 1RRBA 1OEYA 3NVVA 3VR9B 1J8CA 5C2TB 3KUDB 4C7YA 5FKAC 3E56A 1GOZA 4WIPA 4NNJB 4W9JA 3AE2B 4FADA 2IDYA 1D5XC 3V61A 3ZIMA 4P1BC 4WWOA 1VLBA 3R2IA 1WJUA 3L10B 1WX9A 1TIFA 5DPTA 3PZDA 2KYWA 1J7CA 2NVUI 4LJPB 1WX8A 3AEDB 1WFYA 1IYFA 3P63A 3X23A 1V9JA 4WAFA 1PYWD 2Q5WD 2MSED 2J0JA 1J19A 2QMTA 5L83A 2IBIB 2KLGA 1H4RA 1D4BA 1ZGUB 3DWMA 2IO3B 1SE3A 2CHWA 1CMXB 1I7HA 1GPXA 4A20A 4HCNB 2BB6A 1WIAA 2ASQA 3ZRCA 1HZ5A 3ZNID 1YNTE 3AULA 2CKHB 1V5TA 2ON8A 3LB8C 2JZZA 3HVDA 2DYOA 2ACZB 3A9JA 4N58A 5AZFA 3MFGA 4H2AA 2NBWB 1V5OA 1OFFA 3H7PA 1GB1A 2K6QA 3I57A 1FD6A 1WGRA 3R66C 4AWJA 2GI9A 2PJHA 4KZCA 1I4RA 2M8SA 3DBSA 1N63A 3WAMA 1E6EB 2Y5BB 4B6WA 4WQMA 4IWOA 1ET6A 1D3ZA 3U30A 3V6EB 1DOYA 1Y56A 2ZCCA 3HVZA 2N9XA 3TUOA 3A9KA 3Q2AC 4LLGM 1YX6B 2L83A 4FXCA 4REZA 3L16A 4BAXA 4BKSD 4LK0M 2GBRA 3MHZA 4BKSA 3P2BA 3A1QA 3ZJTA 2N7JA 1WR1A 3CSFA 4BOZB 4W9CA 4M0WB 1ZUD2 4AOFA 1N5XA 1MFWA 2KAJA 3N3KB 3U52E 1C76A 3IAM1 3UGBB 2KMAA 2W3RA 1U4AA 3Q14C 2JZ3B 1SEBD 1TTNA 2WXLA 4RFBA 4KIKB 4AS1A 4W9LA 4HKZE 4J6IA 1D5ZC 2GLSA 4IC7B 2EMTA 1F9JA 2PEAA 3DBLB 3KVFB 1K53A 4NZLB 3PS6A 3L13A 4B0EA 3DVNU 3BINA 3ZKJC 2I1JA 5GMVA 2VZKD 2BKFA 2KX0A 4QAYA 4DDGD 1F2RI 2R2OA 2L8JA 2DWQA 4KGRA 1WJNA 2RDGA 2EKEC 1XO3A 2JXTA 3W1YA 5IAAC 1LXDA 3PLUA 1VZ6A 3UIOB 3I5JC 5IA7A 5AEKB 2JWZA 2V1YA 2LHDA 2K5PA 2ZW1A 2D10A 5JXVA 2V9HA 4K7WA 5HKHA 1XQQA 1SSNA 1KTKA 3DHIC 1AN8A 2KTRB 3U4EG 3R3MA 4M02A 4GGQA 2LHEA 1C79A 2M17A 2REXA 2KMCA 1JW9D 4E71A 2KZRA 2KWCA 2CU3A 1TKEA 2BBCA 1D5MC 4II3B 3M62B 3AB5A 2LWPA 2YLMA 1KLGD 4I6PA 5HI1A 2FCMA 1C4PA 1R4MB 3ZW3A 2JU6X 2KACA 1YX5B 3A4RA 2V0GA 2KNBA 2KK8A 1N5WA 4TMAB 4FLHA 2O2VB 2LJIA 2MBBB 4MGKE 1RLFA 1Z2MA 3CF6E 3GZNI 2MJEA 2LGIA 5H8YE 2K9XA 3RN9C 2WXOA 4XZ4A 2DAJA 3JSVB 2Z0EB 3ABVB 2W54A 3SFEB 2ZNVB 2K6DB 3QC8B 1KH0A 1VR9A 2ZVNA 1IGCA 1SIJA 3Q3MC 4A9AA 1TKYA 1OEYJ 2QILA 3UIPB 2XEWA 1UWMA 1SF0A 4JL9A 3RNGC 1IPGA 1HEZE 2DBYA 4GOCA 3JW0X 4OVVA 3WIMA 2LUMA 1JQ4A 4AUQC 2ICIA 4JGHB 3VVWB 2W3SA 1TS2A 1UBQA 2KDEB 2K39A 1SBBB 3SDLC 1N62A 3TEYA 2WQYB 3AMZA 2LXCA 3BVMA 1V86A 4N59A 2CS4A 3U2SC 2N9LA 1WJ6A 4ZYSA 3ZXRA 1YJJA 2MP2B 2DYBA 3MTNB 4WJNA 1L0XB 2AQ3B 4HDQA 4PT5A 2RSUA 2PVOD 4MJSA 5G5HA 3KUCB 1I35A 3URYA 3PO0A 1WGKA 4MELA 3P4RB 2GRIA 2IY1B 3V62A 4URKA 2IO2B 2LI5A 2L32A 4IW0A 1YQ3B 4TKNA 1Q0WB 1JCKB 4MM3A 3O13A 1YQ4B 4P16A 1E0ZA 2KDMA 5AZHA 3ENEA 2IGGA 1IBXB 3BZDB 4RGNA 4JLCA 2K3UA 4FJZA 2WXMA 3VUWA 1F0ZA 3BY4B 2DYMA 2G3QB 2J53A 3PVLA 1B1ZA 3Q3JA 4EZJA 1HXYD 1ZP0B 4HJKA 3WA0A 2CJNA 2QIEB 1YJIA 3ZJUA 5CX3A 4P6VF 2FCQA 3NVZA 2C7NB 2D2QA 1TS4A 3PZ7A 1WXMA 1IP9A 4AQ7A 2MHJA 3AEFB 3MP9A 3VTUA 2DZIA 3PHWB 3ZUNA 1E7UA 5JH5C 1Y8RC 3ZLZA 3ZTCA 5D3DA 1YN3A 1E8YA 2N1VA 4EOYA 3RI7C 2KJHB 2JSVX 3ZQ4A 1YOVB 4ANVA 1I4HA 3TIXA 1V97A 2JX5A 4NJCA 4BFRA 1VZ7A 1A5RA 1GNUA 3PRPB 2WXKA 2WXFA 3QARA 2XK5B 1JRUA 3P42A 3DBRB 4LNOA 2N9EB 4GIVA 1GAQB 1UZXB 4RM9A 1IUEA 1C4CA 5TR5A 1GJZA 4IM0A 4EZKA 4WJOA 2L3ZA 4W9HA 2SEBD 4XDCA 2I38A 4ZRKA 3R8BA 1JMLA 4F8CB 1ZDVA 4EEWA 3WAOA 4OVUA 4WH4A 4MDKE 2OJWA 1WRIA 4Q2JA 1CQVA 1FRRA 4CQNA 1ZE3D 3AE9B 1GUAB 4HPMB 4FN2A 4S0RA 1WGHA 3OG5A 4MSMB 2KVRA 3DBHB 2N7EA 4WWPA 1P1AA 1C4AA 1SIFA 1WXQA 4ARIA 1TT5B 1QOAA 4NJ7A 3TJPA 2INPE 4D2KA 2KFJA 2KMMA 1FEHA 4W9IA 3VUXA 2CHXA 2LEKA 2JRIB 1NDDA 3N1XC 5JHAA 1L5PA 4FHJA 4BZAA 1N6ZA 4IKGA 1PGXA 2BWES 4HCPB 4ITKA 4NPNA 1FPYA 3ZYYX 5IN7A 2BS3B 3MJ5A 1TKGA 3MC8A 1WMHA 3N1YC 4O1NA 2KDBA 1FCCC 2N4FA 1TYGB 5CTRC 3V3XA 3RNAC 3A4SC 2H89B 2WNMA 5C3JB 2V3PA 3Q6BA 4BKGA 1FFVA 2MJ3A 2GBNA 4A3PA 4YTPB 3ZTDA 1YN5A 5MPOA 4GXBA 3EC8A 5H92C 4DK5A 2RDHA 4A55A 4PS7A 4LNKA 5IP4D 2EKIA 3WALA 5BYQA 3VTWA 4US8A 1QKZA 1P9DU 1UBIA 2FIFA 5D7GA 2QCZA 3B2FA 1HTQA 3Q3OC 5AUKA 2D3BA 1L6UA 2K22A 4ZHOA 3BYTB 3PGEA 2HJ1A 2D11A 2CU1A 2AEHA 1T6BX 5LLIA 3UQAA 2Y5CA 1QOGA 3VRBB 2EMSA 3A9JB 2I2YA 2KDIA 4OW0A 3B9JA 2VH2A 2DZKA 4TUUA 3C0RB 3ZO5B 1FXAA 2GBMA 2QC8A 2INCC 4LNNA 4N9F4 3WANA 3OAWA 1P7EA 2MW5A 1QOBA 3AXCA 2ZCBA 1M4VA 5BMHA 1UGMA 4YL8A 4NY0A 3UQBA 2GOWA 3N1ZC 2A4ZA 3GS2A 2QSDA 1WJ4A 4M01A 1RYJA 5LNK1 3K9PB 3HRDD 4BOSC 4BBNC 2JVCA 2IJ0A 4HRSA 2KD0A 4MH8A 1SE9A 1YN4A 4B95A 4JWUC 2NTSA 4FA6A 1XD3B 1QILA 4YSYB 3CMMB 1A70A 1WI0A 4JQWC 2NBVB 4DDID 1SB3C 2PKOA 1FNVA 3IAS1 2CR5A 3NZ3A 3UF8A 3NUHB 3Q3NC 3NG0A 3QA8A 1WGGA 4C7ZA 2LRWA 4OZCA 2LXAA 1JWBD 2ZNVC 2OEDA 1EUVB 2WU2B 3VRAB 3RD2A 2R2QA 2RDBC 4OZBA 1EF1A 1MJDA 1QF6A 1R4NB 3Q3FA 2WHIA 2LD9A 2JYEA 3QIJA 4M0WA 2BW2A 2KANA 3FAHA 1L0YB 2KHWB 3U7ZA 2FBWB 4RGOS 2MBHA 4KDLB 4GU2A 2HJ8A 2H88B 1CK1A 4XC2A 4PS3A 3PT2B 2V3NA 3L08A 2DHZA 2DNFA 2MRPA 4HEA1 4ARCA 1FXTB 1JWSD 1XCQL 2BKRB 2XBBC 4KIKA 3DHHC 2DZMA 4K1RB 3R2TA 1L0VB 2D3GA 2VZKB 1MHXA 1KRHA 2IYDB 1T0QC 1T5XD 3ZVVA 2LVPA 4A3OA 2XN9C 2LGXA 2D3CA 2LASA 3DOWA 3TSSA 3ZXVA 3H8HA 3RT3B 1I4QA 3DBLI 4I6NB 1OQRA 3BVZA 1WZ3A 1N61A 2AYOB 2HTME 3EA6A 1SXTA 2BYFA 2FAZA 4HJGE 2FUG1 2L52A 1CZPA 2MLBA 3FILB 2WWZA 2FIDA 1V6EA 1E9MA 1AYFA 4LNIA 3V05A 3QHTA 2MCNB 4OVZA 4YTMB 2KXJA 1XEEA 2QHOA 3TEXA 3EFUA 4MH0E 4WWNA 1GB4A 2LUEA 2N1WA 4HLEA 1WYWB 1SJED 2RR9A 1AWDA 1TBEA 3HM3A 1YMHE 1T0RC 4X57B 1ZW7A 3N20C 1ZPSA 4IWPA 1J7AA 2KTRA 1P98A 4TQ0A 3DWGC 1WR6E 1EU3A 1UH6A 3EGRA 5BO4B 4W9DA 2I1KA 3U7DA 2BYTA 4EFOA 3X0WA 1JWMD 3PREA 1P0RA 1EWYC 4GDKB 1PGAA 2J7QB 3TEWA 4GMVA 2KC2A 3W5VB 4M00A 3V6CB 3V60A 4F7ZA 4W9GA 2J0MA 2O6VD 1RWSA 4AP4C 2O2VA 3L4PA 4K3CA 2O6VA 2G4SA 1YJ1A 2G1EA 3DVGY 1R4MI 3QX1A 1OTRB 4ICVA 3WCQA 1FFUA 4E3CA 1DOIA 2KC1A 2KT7A 2MH7A 3A33B 4HPPA 3GOEA 2KFKA 1QZEA 2KQ7A 3JSVA 2ZPNA 4ANXA 4C00A 1ZKHA 1NEKB 4K7UA 2E6XA 3AU4A 4M8MA 5EE9A 1Q10A 3BYYB 2BGFA 2L0TA 4KSLC 3P4PB 1WM2A 1PGBA 4J3OD 2BB5A 2M0XA 3MC0B 3W1SC 3IT4B 2KDFB 2XNAC 1F52A 4WJQA 3VAWA 5JHBA 1XLPA 3EFCA 2MBQA 3ALBA 4TV3A 2V4LA 3QJZA 4MGZE 1KLUD 1WXVA 4ZYNA 2WXPA 1KFYB 3NJTA 3AE6B 2KWUB 2JYTA 4XWWA 4HDOA 2IPKD 3B0AA 2KN5A 4DHJD 1E10A 1P3QU 2MP2A 4RCOA 2ZVOA 3B2GA 2INDC 2IZVB 2L00B 2JZPA 1FCLA 3T3NA 3AE4B 3SD5A 4BVUC 2INNE 1UD7A 2AQ1B 4ASWC 4M8NA 1MI0A 1B9RA 3J9CA 5J17A 4P1CC 3BIID 1KOTA 2BT6A 3ZNZB 3VUYA 3PRMB 3N30A 4LDTD 2KOXA 2DAFA 3W2DA 4DWFA 3EECA 1Q5WB 1RM6C 3LYYA 1TZOA 3Q8FA 1KF6B 3IBEA 1V81A 1WY8A 4YSZB 1IBXA 2NMQA 2OJRA 2PTLA 2FNJB 1VCBA 2PE9A 2WX1A 3RMKC 4L1BA 2GB1A 1ROEA 4AJWA 2BTEA 2NS5A 1T0YA 2Z8LA 3H6NA 3NRZA 3E9SA 3OWEB 3I63C 4EUTA 1YIWA 3EHVA 2WP9B 3GE8C 4CHKA 2BVCA 2WYQA 2C9WB 1WH3A 1JWUD 1NI3A 2D3AA 4GDLB 4TQ1A 3FC4A 1XLNA 2AWTA 2Z59B 1AARA 2M56B 3M95A 5BYSA 2TSSA 3QQ8B 3MHSD 2IO1B 2R61A 1HZ6A 2DENB 1UGJA 4WWMA 2D5GA 1S3SG 3GB1A 5J2RA 3SR6A 1SJHD 4ACFA 2J42A 2QEJC 3AN1A 1SE4A 1EO6A 2LGDA 2QJLA 2C7HA 3PZ8A 4NAWB 4EZLA 4ZOHC 1P7FA 2WDRB 1G6JA 4IWQA 3S2AA 1V1PB 2XK5A 4IM2A 4A90A 2G4DB 3RZWC 4YSXB 1AW7A 1FIQA 1E5WA 3P4SB 1GG3A 3NS1A 4HXDA 5HFYA 2A5UA 4FJVB 4HWIB 1E90A 2LGYA 3LDZE 4JX1C 5IKCM 2L7RA 4BBNF 2BYEA 1BMLC 2W9NA 3AEEB 3ONSA 4DQOC 3DBRI 3WAPA 2NPTB 3B08A 2MQJA 1KLVA 2WXGA 2IGHA 5FR6A 1HQRD 3APDA 2C5LC 4IUMB 4K7SA 5HHDG 5DPRA 3RULA 3W1SA 3OJ3A 3N32A 1JROA 1GC6A 5EDSA 1FMAD 3PPAA 5AUIA 1NI2A 3QCAA 3D32A 2UWQA 1STEA 2W82A 3DBHI 3NVWA 1I4GA 1WSPA 2K0PA 4OHJA 2WX0A 1JALA 1NBFC 4A6QA 2KVZA 1HA5A 3I3TB 3Q8AA 2V4IB 2PE6B 1BUIC 2G9HD 2KLCA 1WMHB 2IY0B 4C4VB 1QT9A 2KTFA 3Q8BA 1E8XA 3L17A 1WGDA 4CO7A 2MWSB 3GE3C 3ML9A 3UI3A 1MHHE 2BF8B 1L2NA 2Y3AA 4K81A 3JVZX 1LM8B 4DXFA 4RF0A 3VH3B 2AL3A 1F1HA 4II2B 4DHZE 3KH0A 3ECIA 1ET9A 1H8CA 1RAXA 2RD0A 1UNSA 3LXFA 3HUIA 2NTTA 2OHFA 2VH1A 4XX5A 1RFAA 4RGMA 2M1MA 5I4DA 2N9KA 4MSQB 5IOIA 3H9DA 4DHZB 4RH6A 3KLSX 4NQLB 3R7RA 1TJEA 3AE5B 1D6EC 4L2YA 2GMIC 2G45B 3ZGZA 1TY0A 1FRDA 3NHEB 2VRRB 2KX3A 5E6OA 5C23A 1FXIA 2N7DA 3CWIA 2ZW0A 4G0NB 3DHGC 1FNWA 3PSEB 5AZGA 2J4XA 3CIRB 5EE1A 5D2MB 3H7PB 1EWCA 1TZ1A 3C8YA 5BMGA 2DX5B 4FHKA 2RMMA 2QDFA 1LGRA 3PHXB 4KVGB 2OOBB 1K8RB 4R3DA 4FBJB 3R7QA 3M3JA 1T0SC 2FUHB 1MG4A 1WX7A 3ZDTA 3KQ4A 4RM8A 3Q8CA 4IDIA 5LXIB 4EE2A 3QWZB 3FKYA 2BQQA 3VTVA 3A9KB 3OJ4B 3DDCB 1C1YB 5DPWA 4HROA 4CYEA 4B9KA 3TEZA 3A1QB 1V49A 3JYUA 1E7VA 5EE0A 2LJ5A 2WXIA 1N60A 3ZNGC 2PPHA 2Y5PA 1WE6A 4IOIE 4W9EA 1NVID 4G50A 3H7SA 3ZJVA 3QAQA 3TMPB 2MX2A 4ZRQA 2L0FA 5BYRA 3OLMD 5DCNA 1C78A 2IO0B 2WXJA 2BWFA 2JT4B 1JRPA 1L4ZB 1NENB 4GB9A 2N9PC 2KN4A 3AM9A 4DXAB 3UINB 2K8HA 4ICUA 1WZ0A 1WYGA 2MBEA 4GLSC 4KV2A 1ZXHA 2HTHA 2LMCA 3K9OB 1V80A 2NCNA 2DZJA 3IG3A 2BS4B 3MC9A 2JXXA 3VH4B 1QLBB 3AV8A 2KWVB 3PLVA 2WXQA 2NR2A 3IT6B 5G2NA 3P4QB 2JUOA 2YVCA 1UELA 4ANUA 3SEBA 5HG2A 1R4NI 1J7BA 4HK2A 4GSWA 3VDZA 3N9YC 3DVGX 3AE8B 1L4DB 4DBGA 1C9FA 3KWLA 3NZUA 2JPHA 3AH7A 2Z0DB 2C60A 1IGDA 2ONQA 4RNAA 4MGIE 5CHVC 1V1OA 4L23A 1WXAA 4PK1A 1K51A 1LO5D 3O65B 4KGSA 3SU8X 3W9CB 2YEPF 2WXHA 4WAAA 3RFZB 2WXRA 3I9V1 3APFA 1EF5A 2DLBA 2E3TA 5LXHA 2LVQA 1UWXA 1MG8A 4C56C 3TBLD 1L7YA 3RUIB 1VJKA 2K1FA 1WGYA 4KSKC 4S17A 2PIAA 2SAKA 4I6LB 2AX5A 4GN1A 4ANWA 3SFDB 4DXGA 3FILA 2FCNA 3CSTA 5D3IB 1QQRA 1OQQA 3NOBA 2WDVB 1WE7A 1E8WA 3GZNB 5GXGB 5J18A 4C80A 3ML8A 1OGWA 5KHQA 1KJTA 4W9KA 2WXNA 3VXWA 2PLPA 2K25A 1LQBA 1V2YA 4JPSA 1M94A 2CJOA 3IFWB 3TCAA 1C77A 3ZDMC 2GBJA 2WDQB 3KYDD 1DGJA 2BYVE 4XDDA 1F77A 4K3BA 1DYQA 1PDXA 1Q1OA 2WGSA 1XF5L 1SGHA 5IO9A 5T8IA 1VDVA 4PYZA 4WURA 2KJRA 4MT5A 1TGZB 2O6VB 2FCSA 4KKJA 4GDKA 1XT9B 3EUB2 2LZ6A 3NY5A 1WM3A 3L0WB 1PUTA 2KO3A 2KQ4X 2HE7A 2KFKB 2HDEA 3AEAB 3TL5A 3KWVA 4XYCA 2IGDA 2BS2B 2EELA 4USAA 1E8ZA 3BVGA 4BKTA 2JY6A 3HM6X 3AU5A 4HPLB 4EKUA 2LFIA 3BK1A 2CHZA 1ZDXA 3ZRFA 2HD5B 4IM3A 2D07B 1PQSA 4XGAB 1VZ8A 1FM0D 1MPEA 1WWTA 5CHFA 3M63B 2KJ6A 1GC7A 4ZDVA 1WXSA 2J52A 5CHWA 4MEMA 1BT0A 1XLOA 2FE8A 4MJSB 1EU4A 4RMAA 3IHPC 3HHMA 3Q69A 2X8XX 3AEGB 3ZNHB 4YWGG 4US9A 2ZEQA 5E6NA 4DHJB 3T3OA 3LJ3A 4ZRIA 2JRHA 3IVFA 2X38A 2WU5B 1NYRA 1TS3A 1UF0A 2K8BA 4TSSA 2ZZPB 4MM3B 1OQYA 4KZ0A 2C7MB 4PS8A 3RYTA 4LCDE 4KGTA 5EE3A 1YQBA 2JQRB 1TY2A 1FO4A 3AE7B 4G3XB 4XWTA 3PTFC 1S1QB 5D6JB 4HVBA 3RCZA 2GBKA 2LVOA 2L05A 2UU7A 4LDTB 3MJWA 3Q8EA 3VR8B 2PMVA 3NVYA
chains in the Genus database with same CATH topology
3QK0A 4FA6A 1XD3B 5DPSA 2WX0A 4I6PA 3CMMB 1NBFC 1WI0A 4JQWC 2NBVB 2FCMA 4WJPA 4DDID 3ZW3A 3I3TB 4G11A 1YX5B 2KQSA 3A4RA 3VQIA 2PE6B 2KNBA 2CR5A 3HIZA 2KK8A 2KLCA 3KYCD 3UF8A 1WMHB 3QA8A 1WGGA 4FLHA 2IY0B 2O2VB 2LRWA 2KTFA 3DVNV 2LXAA 3KW5B 2MBBB 4MGKE 1E8XA 2ZNVC 3L17A 1WGDA 5KHOA 3U8ZA 1RLFA 2MWSB 4CO7A 5JZEB 1Z2MA 2K8CA 3CF6E 3GZNI 3ML9A 2BF8B 5G55A 1L2NA 1EUVB 3PV1A 3RD2A 2R2QA 4K81A 5L95C 3JVZX 3HK0A 1LM8B 2MBOA 1EF1A 3VH3B 4P7IA 2AL3A 3Q3FA 3VHTC 2LD9A 4II2B 4DHZE 3KH0A 3QIJA 4XZ4A 3ECIA 2DAJA 3JSVB 2KANA 2Z0EB 1H8CA 1RAXA 2RPQA 2KHWB 2J0KA 2RD0A 2MBHA 4KDLB 4GU2A 2HJ8A 2L76A 2ZNVB 2K6DB 3QC8B 4XC2A 4PS3A 3PRZA 3PT2B 2ZVNA 3NZSA 4XX5A 3L08A 2DHZA 2MRPA 1OEYJ 3UIPB 2XEWA 1FXTB 1RFAA 2M1MA 4JL9A 1IPGA 2XBBC 2BKRB 4GOCA 4MSQB 4KIKA 2DZMA 3H1UA 1LFDA 3H9DA 2M4NA 3JW0X 4GDLA 2WDTB 4K1RB 4OVVA 3WIMA 4DHZB 4AUQC 2D3GA 2KKCA 4E74A 4JGHB 1YD8U 2RGFA 1HE8A 4NQLB 2IYDB 3R7RA 2ZJDA 3VVWB 3ZVVA 1VD2A 2LVPA 4A3OA 2GMIC 2LGXA 1UBQA 2LASA 2G45B 2KDEB 2AL6A 3DOWA 3SHQA 3VFKA 2K39A 5C1ZA 3SDLC 3NHEB 1X1MA 2LXCA 2VRRB 3RT3B 1V86A 2KX3A 5E6OA 5C23A 2N7DA 2CS4A 2UYZB 3DBLI 4I6NB 4G0NB 1WZ3A 1WJ6A 2AYOB 3L54A 3PSEB 2MP2B 2BYFA 2DYBA 4NAWA 2LRUA 3MTNB 5AZGA 2FAZA 4WJNA 5D2MB 3H7PB 5D94A 4ZRJA 2MLBA 4HDQA 1TZ1A 2FIDA 2RSUA 1V6EA 2WWZA 4W9FA 3T8MA 2ZPYA 4MJSA 2DX5B 4FHKA 3QHTA 4LJOB 2MCNB 1J0GA 4AJYB 3KUCB 1I35A 3NS8A 3PHXB 4KDIC 2OOBB 4KVGB 1K8RB 4MELA 4MGYE 2KXJA 4FULA 4FBJB 1C3TA 2QHOA 3R7QA 3M3JA 3EFUA 2FUHB 2IY1B 4MH0E 1WF9A 4WWNA 3V62A 4URKA 2JF5A 1WX7A 2LUEA 2N1WA 3ZDTA 2IO2B 4RM8A 4HLEA 4IG7B 3DPDA 1WYWB 5LXIB 2LI5A 2RR9A 3QWZB 4JIOU 4IW0A 1TBEA 3T9LA 3HM3A 2NPTA 2NBUA 2V3SA 3VTVA 3A9KB 4TKNA 3OJ4B 4X57B 3DDCB 1ZW7A 1Q0WB 4MM3A 4IWPA 4FJYA 1C1YB 1P98A 2KTRA 3DQVA 4TQ0A 5DPWA 1WR6E 4CYEA 2BPSA 4WQOB 4B9KA 5AZHA 1UH6A 3ENEA 1KM7A 5BO4B 2MA9B 3A1QB 1V49A 3JYUA 4W9DA 2I1KA 4NJ6A 1E7VA 4JLCA 3U7DA 2LJ5A 3DCGA 4FJZA 3VUWA 4EFOA 3BY4B 3X0WA 5E6PA 3ZNGC 2PPHA 1WE6A 3PREA 2DYMA 1P0RA 2G3QB 4W9EA 3PVLA 4G50A 3H7SA 4GDKB 3Q3JA 2J7QB 1Z5SB 3QAQA 3TMPB 2MX2A 4EZJA 4GMVA 2KC2A 2B3AA 4HJKA 4NQKE 4PYUA 2L0FA 3WA0A 3KUZA 3RZFA 3OLMD 5DCNA 4F1SA 3V6CB 2IO0B 3V60A 3APCA 5CX3A 4F7ZA 2BWFA 2JT4B 2J0MA 4W9GA 2FCQA 4GB9A 2N9PC 2C7NB 2D2QA 3AI5A 2O6VD 4DXAB 3UINB 4AP4C 1ISNA 2K8HA 1WXMA 2O2VA 3B1LX 4ICUA 1IP9A 1WZ0A 2MBEA 1WRDB 1RRBA 1OEYA 2O6VA 2G4SA 4KV2A 1YJ1A 3VTUA 2DZIA 3PHWB 3DVGY 1J8CA 3KUDB 2HTHA 3ZUNA 1R4MI 3QX1A 1E7UA 1OTRB 3K9OB 1V80A 1Y8RC 2NCNA 4ICVA 3ZLZA 5JH5C 3ZTCA 2DZJA 1E8YA 4NNJB 4W9JA 4E3CA 3IG3A 2KC1A 4FADA 2N1VA 2JXXA 3A33B 3VH4B 4EOYA 2KWVB 3PLVA 3GOEA 2KFKA 1QZEA 2KJHB 3V61A 2NR2A 2KQ7A 3ZIMA 4WWOA 5G2NA 3JSVA 2ZPNA 4ANVA 4ANXA 1WJUA 3TIXA 1ZKHA 3L10B 4BFRA 1WX9A 2JUOA 1A5RA 4K7UA 3AU4A 5DPTA 2YVCA 3PZDA 1UELA 4ANUA 4M8MA 1GNUA 1R4NI 2NVUI 3PRPB 4HK2A 4LJPB 4GSWA 3VDZA 1WX8A 3QARA 3DVGX 2BGFA 2XK5B 1JRUA 2L0TA 4DBGA 1WFYA 1IYFA 4KSLC 1WM2A 2N9EB 1V9JA 3NZUA 4GIVA 3X23A 2JPHA 2MSED 2Z0DB 2C60A 2J0JA 2M0XA 1J19A 1UZXB 4RM9A 4MGIE 2IBIB 5CHVC 5TR5A 3W1SC 5L83A 1WXAA 2KLGA 1H4RA 4IM0A 1GJZA 4EZKA 1ZGUB 4WJOA 2KDFB 2L3ZA 4W9HA 4WJQA 3O65B 3SU8X 3VAWA 4ZRKA 5JHBA 4F8CB 2MBQA 3ALBA 2IO3B 4WAAA 2CHWA 4TV3A 1CMXB 2V4LA 3QJZA 4EEWA 3WAOA 4MGZE 4OVUA 4A20A 1WXVA 4ZYNA 4MDKE 4HCNB 3APFA 1EF5A 1WIAA 5LXHA 2ASQA 3ZRCA 2KWUB 2LVQA 1GUAB 4HDOA 3ZNID 4HPMB 1MG8A 3AULA 4FN2A 2CKHB 1WGHA 3TBLD 1V5TA 3B0AA 4MSMB 2KN5A 1L7YA 4DHJD 2KVRA 2JZZA 2K1FA 3RUIB 2DYOA 1P3QU 3A9JA 2MP2A 2N7EA 1WGYA 5AZFA 4WWPA 4KSKC 1P1AA 2NBWB 4I6LB 1SIFA 1V5OA 2ZVOA 3H7PA 4GN1A 4ANWA 2FCNA 3CSTA 2IZVB 2L00B 2K6QA 1WGRA 3R66C 4AWJA 2PJHA 3SD5A 3NOBA 4KZCA 4BVUC 2M8SA 3DBSA 4NJ7A 1WE7A 3TJPA 3WAMA 1UD7A 2KFJA 1E8WA 4ASWC 4M8NA 2Y5BB 4W9IA 5J18A 4B6WA 5J17A 3VUXA 2CHXA 1KOTA 3ML8A 1OGWA 2JRIB 3ZNZB 1NDDA 4IWOA 5KHQA 1D3ZA 3U30A 3V6EB 5JHAA 1KJTA 2ZCCA 3PRMB 4W9KA 4FHJA 3N30A 3VUYA 3VXWA 2N9XA 4LDTD 2KOXA 2K25A 2DAFA 1I42A 3A9KA 1LQBA 1V2YA 1YX6B 4DWFA 1M94A 3EECA 1Q5WB 2BWES 4HCPB 3IFWB 4NPNA 3L16A 4BKSD 3TCAA 3ZDMC 3IBEA 2GBJA 1V81A 3KYDD 2GBRA 2BYVE 1WY8A 4BKSA 3P2BA 3A1QA 2OJRA 2FNJB 1VCBA 2PE9A 2WX1A 1Q1OA 1WR1A 3CSFA 1SGHA 4AJWA 1WMHA 4W9CA 4BOZB 2NS5A 4M0WB 4PYZA 2KJRA 1T0YA 1TGZB 2O6VB 4AOFA 3H6NA 2KDBA 2FCSA 3N3KB 2N4FA 4GDKA 1XT9B 3UGBB 4EUTA 1YIWA 5CTRC 2KMAA 2LZ6A 3EHVA 4CHKA 3NY5A 1U4AA 1WM3A 3A4SC 3L0WB 2JZ3B 1TTNA 2WYQA 2C9WB 1WH3A 2KO3A 4KIKB 2HE7A 2KFKB 4W9LA 4GDLB 4TQ1A 2AWTA 2Z59B 4J6IA 3TL5A 1AARA 3M95A 4IC7B 4BKGA 2EMTA 1F9JA 2PEAA 3QQ8B 3MHSD 2GBNA 3KVFB 2IO1B 4A3PA 3ZTDA 1E8ZA 4GXBA 3EC8A 2DENB 4BKTA 2JY6A 3HM6X 3PS6A 4DK5A 3L13A 1S3SG 3AU5A 4PS7A 4HPLB 4EKUA 3DVNU 3BINA 5J2RA 2CHZA 3ZKJC 3WALA 3VTWA 2I1JA 3ZRFA 5GMVA 2HD5B 1P9DU 1UBIA 2BKFA 4IM3A 2D07B 2KX0A 1EO6A 1PQSA 2LGDA 4DDGD 2FIFA 2C7HA 4NAWB 5CHFA 2R2OA 5D7GA 4EZLA 2L8JA 3M63B 1WJNA 1G6JA 2KJ6A 1GC7A 4ZDVA 1WXSA 2EKEC 5CHWA 4IWQA 4MEMA 3S2AA 1BT0A 4MJSB 3PGEA 2XK5A 4IM2A 2G4DB 3RZWC 3W1YA 2D11A 2CU1A 2AEHA 5IAAC 1E5WA 5LLIA 4RMAA 1LXDA 3IHPC 1GG3A 3HHMA 3PLUA 3UQAA 4HXDA 2A5UA 2EMSA 4FJVB 4HWIB 3UIOB 5IA7A 5AEKB 1E90A 3A9JB 3ZNHB 2JWZA 2LGYA 2V1YA 3LDZE 2KDIA 2L7RA 2ZEQA 2BYEA 5E6NA 4BBNF 4DHJB 3LJ3A 2W9NA 4ZRIA 2JRHA 3IVFA 3ONSA 2DZKA 2D10A 3DBRI 4K7WA 3WAPA 2NPTB 3C0RB 3B08A 4TUUA 1XQQA 3ZO5B 5HKHA 2MQJA 2K8BA 2GBMA 1KLVA 2ZZPB 1OQYA 4KZ0A 4N9F4 3WANA 3OAWA 2KTRB 2C7MB 3R3MA 5FR6A 4GGQA 2MW5A 3AXCA 2ZCBA 2C5LC 3APDA 4IUMB 4PS8A 1UGMA 4K7SA 2M17A 2REXA 4YL8A 2KMCA 4NY0A 3RYTA 4LCDE 5DPRA 2GOWA 3UQBA 4E71A 2A4ZA 2KZRA 3RULA 3W1SA 3OJ3A 1YQBA 3N32A 2KWCA 1GC6A 5EDSA 4G3XB 1WJ4A 4II3B 3PTFC 3K9PB 1S1QB 3PPAA 1NI2A 3M62B 3QCAA 3D32A 5D6JB 4BOSC 4HVBA 4BBNC 2JVCA 3RCZA 2GBKA 2LVOA 2L05A 2LWPA 2UWQA 3MJWA 2KD0A 4LDTB 2YLMA 1SE9A 3DBHI 4B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK0 A;  4FA6 A;  1XD3 B;  5DPS A;  2WX0 A;  4I6P A;  3CMM B;  1NBF C;  1WI0 A;  4JQW C;  2NBV B;  2FCM A;  4WJP A;  4DDI D;  3ZW3 A;  3I3T B;  4G11 A;  1YX5 B;  2KQS A;  3A4R A;  3VQI A;  2PE6 B;  2KNB A;  2CR5 A;  3HIZ A;  2KK8 A;  2KLC A;  3KYC D;  3UF8 A;  1WMH B;  3QA8 A;  1WGG A;  4FLH A;  2IY0 B;  2O2V B;  2LRW A;  2KTF A;  3DVN V;  2LXA A;  3KW5 B;  2MBB B;  4MGK E;  1E8X A;  2ZNV C;  3L17 A;  1WGD A;  5KHO A;  3U8Z A;  1RLF A;  2MWS B;  4CO7 A;  5JZE B;  1Z2M A;  2K8C A;  3CF6 E;  3GZN I;  3ML9 A;  2BF8 B;  5G55 A;  1L2N A;  1EUV B;  3PV1 A;  3RD2 A;  2R2Q A;  4K81 A;  5L95 C;  3JVZ X;  3HK0 A;  1LM8 B;  2MBO A;  1EF1 A;  3VH3 B;  4P7I A;  2AL3 A;  3Q3F A;  3VHT C;  2LD9 A;  4II2 B;  4DHZ E;  3KH0 A;  3QIJ A;  4XZ4 A;  3ECI A;  2DAJ A;  3JSV B;  2KAN A;  2Z0E B;  1H8C A;  1RAX A;  2RPQ A;  2KHW B;  2J0K A;  2RD0 A;  2MBH A;  4KDL B;  4GU2 A;  2HJ8 A;  2L76 A;  2ZNV B;  2K6D B;  3QC8 B;  4XC2 A;  4PS3 A;  3PRZ A;  3PT2 B;  2ZVN A;  3NZS A;  4XX5 A;  3L08 A;  2DHZ A;  2MRP A;  1OEY J;  3UIP B;  2XEW A;  1FXT B;  1RFA A;  2M1M A;  4JL9 A;  1IPG A;  2XBB C;  2BKR B;  4GOC A;  4MSQ B;  4KIK A;  2DZM A;  3H1U A;  1LFD A;  3H9D A;  2M4N A;  3JW0 X;  4GDL A;  2WDT B;  4K1R B;  4OVV A;  3WIM A;  4DHZ B;  4AUQ C;  2D3G A;  2KKC A;  4E74 A;  4JGH B;  1YD8 U;  2RGF A;  1HE8 A;  4NQL B;  2IYD B;  3R7R A;  2ZJD A;  3VVW B;  3ZVV A;  1VD2 A;  2LVP A;  4A3O A;  2GMI C;  2LGX A;  1UBQ A;  2LAS A;  2G45 B;  2KDE B;  2AL6 A;  3DOW A;  3SHQ A;  3VFK A;  2K39 A;  5C1Z A;  3SDL C;  3NHE B;  1X1M A;  2LXC A;  2VRR B;  3RT3 B;  1V86 A;  2KX3 A;  5E6O A;  5C23 A;  2N7D A;  2CS4 A;  2UYZ B;  3DBL I;  4I6N B;  4G0N B;  1WZ3 A;  1WJ6 A;  2AYO B;  3L54 A;  3PSE B;  2MP2 B;  2BYF A;  2DYB A;  4NAW A;  2LRU A;  3MTN B;  5AZG A;  2FAZ A;  4WJN A;  5D2M B;  3H7P B;  5D94 A;  4ZRJ A;  2MLB A;  4HDQ A;  1TZ1 A;  2FID A;  2RSU A;  1V6E A;  2WWZ A;  4W9F A;  3T8M A;  2ZPY A;  4MJS A;  2DX5 B;  4FHK A;  3QHT A;  4LJO B;  2MCN B;  1J0G A;  4AJY B;  3KUC B;  1I35 A;  3NS8 A;  3PHX B;  4KDI C;  2OOB B;  4KVG B;  1K8R B;  4MEL A;  4MGY E;  2KXJ A;  4FUL A;  4FBJ B;  1C3T A;  2QHO A;  3R7Q A;  3M3J A;  3EFU A;  2FUH B;  2IY1 B;  4MH0 E;  1WF9 A;  4WWN A;  3V62 A;  4URK A;  2JF5 A;  1WX7 A;  2LUE A;  2N1W A;  3ZDT A;  2IO2 B;  4RM8 A;  4HLE A;  4IG7 B;  3DPD A;  1WYW B;  5LXI B;  2LI5 A;  2RR9 A;  3QWZ B;  4JIO U;  4IW0 A;  1TBE A;  3T9L A;  3HM3 A;  2NPT A;  2NBU A;  2V3S A;  3VTV A;  3A9K B;  4TKN A;  3OJ4 B;  4X57 B;  3DDC B;  1ZW7 A;  1Q0W B;  4MM3 A;  4IWP A;  4FJY A;  1C1Y B;  1P98 A;  2KTR A;  3DQV A;  4TQ0 A;  5DPW A;  1WR6 E;  4CYE A;  2BPS A;  4WQO B;  4B9K A;  5AZH A;  1UH6 A;  3ENE A;  1KM7 A;  5BO4 B;  2MA9 B;  3A1Q B;  1V49 A;  3JYU A;  4W9D A;  2I1K A;  4NJ6 A;  1E7V A;  4JLC A;  3U7D A;  2LJ5 A;  3DCG A;  4FJZ A;  3VUW A;  4EFO A;  3BY4 B;  3X0W A;  5E6P A;  3ZNG C;  2PPH A;  1WE6 A;  3PRE A;  2DYM A;  1P0R A;  2G3Q B;  4W9E A;  3PVL A;  4G50 A;  3H7S A;  4GDK B;  3Q3J A;  2J7Q B;  1Z5S B;  3QAQ A;  3TMP B;  2MX2 A;  4EZJ A;  4GMV A;  2KC2 A;  2B3A A;  4HJK A;  4NQK E;  4PYU A;  2L0F A;  3WA0 A;  3KUZ A;  3RZF A;  3OLM D;  5DCN A;  4F1S A;  3V6C B;  2IO0 B;  3V60 A;  3APC A;  5CX3 A;  4F7Z A;  2BWF A;  2JT4 B;  2J0M A;  4W9G A;  2FCQ A;  4GB9 A;  2N9P C;  2C7N B;  2D2Q A;  3AI5 A;  2O6V D;  4DXA B;  3UIN B;  4AP4 C;  1ISN A;  2K8H A;  1WXM A;  2O2V A;  3B1L X;  4ICU A;  1IP9 A;  1WZ0 A;  2MBE A;  1WRD B;  1RRB A;  1OEY A;  2O6V A;  2G4S A;  4KV2 A;  1YJ1 A;  3VTU A;  2DZI A;  3PHW B;  3DVG Y;  1J8C A;  3KUD B;  2HTH A;  3ZUN A;  1R4M I;  3QX1 A;  1E7U A;  1OTR B;  3K9O B;  1V80 A;  1Y8R C;  2NCN A;  4ICV A;  3ZLZ A;  5JH5 C;  3ZTC A;  2DZJ A;  1E8Y A;  4NNJ B;  4W9J A;  4E3C A;  3IG3 A;  2KC1 A;  4FAD A;  2N1V A;  2JXX A;  3A33 B;  3VH4 B;  4EOY A;  2KWV B;  3PLV A;  3GOE A;  2KFK A;  1QZE A;  2KJH B;  3V61 A;  2NR2 A;  2KQ7 A;  3ZIM A;  4WWO A;  5G2N A;  3JSV A;  2ZPN A;  4ANV A;  4ANX A;  1WJU A;  3TIX A;  1ZKH A;  3L10 B;  4BFR A;  1WX9 A;  2JUO A;  1A5R A;  4K7U A;  3AU4 A;  5DPT A;  2YVC A;  3PZD A;  1UEL A;  4ANU A;  4M8M A;  1GNU A;  1R4N I;  2NVU I;  3PRP B;  4HK2 A;  4LJP B;  4GSW A;  3VDZ A;  1WX8 A;  3QAR A;  3DVG X;  2BGF A;  2XK5 B;  1JRU A;  2L0T A;  4DBG A;  1WFY A;  1IYF A;  4KSL C;  1WM2 A;  2N9E B;  1V9J A;  3NZU A;  4GIV A;  3X23 A;  2JPH A;  2MSE D;  2Z0D B;  2C60 A;  2J0J A;  2M0X A;  1J19 A;  1UZX B;  4RM9 A;  4MGI E;  2IBI B;  5CHV C;  5TR5 A;  3W1S C;  5L83 A;  1WXA A;  2KLG A;  1H4R A;  4IM0 A;  1GJZ A;  4EZK A;  1ZGU B;  4WJO A;  2KDF B;  2L3Z A;  4W9H A;  4WJQ A;  3O65 B;  3SU8 X;  3VAW A;  4ZRK A;  5JHB A;  4F8C B;  2MBQ A;  3ALB A;  2IO3 B;  4WAA A;  2CHW A;  4TV3 A;  1CMX B;  2V4L A;  3QJZ A;  4EEW A;  3WAO A;  4MGZ E;  4OVU A;  4A20 A;  1WXV A;  4ZYN A;  4MDK E;  4HCN B;  3APF A;  1EF5 A;  1WIA A;  5LXH A;  2ASQ A;  3ZRC A;  2KWU B;  2LVQ A;  1GUA B;  4HDO A;  3ZNI D;  4HPM B;  1MG8 A;  3AUL A;  4FN2 A;  2CKH B;  1WGH A;  3TBL D;  1V5T A;  3B0A A;  4MSM B;  2KN5 A;  1L7Y A;  4DHJ D;  2KVR A;  2JZZ A;  2K1F A;  3RUI B;  2DYO A;  1P3Q U;  3A9J A;  2MP2 A;  2N7E A;  1WGY A;  5AZF A;  4WWP A;  4KSK C;  1P1A A;  2NBW B;  4I6L B;  1SIF A;  1V5O A;  2ZVO A;  3H7P A;  4GN1 A;  4ANW A;  2FCN A;  3CST A;  2IZV B;  2L00 B;  2K6Q A;  1WGR A;  3R66 C;  4AWJ A;  2PJH A;  3SD5 A;  3NOB A;  4KZC A;  4BVU C;  2M8S A;  3DBS A;  4NJ7 A;  1WE7 A;  3TJP A;  3WAM A;  1UD7 A;  2KFJ A;  1E8W A;  4ASW C;  4M8N A;  2Y5B B;  4W9I A;  5J18 A;  4B6W A;  5J17 A;  3VUX A;  2CHX A;  1KOT A;  3ML8 A;  1OGW A;  2JRI B;  3ZNZ B;  1NDD A;  4IWO A;  5KHQ A;  1D3Z A;  3U30 A;  3V6E B;  5JHA A;  1KJT A;  2ZCC A;  3PRM B;  4W9K A;  4FHJ A;  3N30 A;  3VUY A;  3VXW A;  2N9X A;  4LDT D;  2KOX A;  2K25 A;  2DAF A;  1I42 A;  3A9K A;  1LQB A;  1V2Y A;  1YX6 B;  4DWF A;  1M94 A;  3EEC A;  1Q5W B;  2BWE S;  4HCP B;  3IFW B;  4NPN A;  3L16 A;  4BKS D;  3TCA A;  3ZDM C;  3IBE A;  2GBJ A;  1V81 A;  3KYD D;  2GBR A;  2BYV E;  1WY8 A;  4BKS A;  3P2B A;  3A1Q A;  2OJR A;  2FNJ B;  1VCB A;  2PE9 A;  2WX1 A;  1Q1O A;  1WR1 A;  3CSF A;  1SGH A;  4AJW A;  1WMH A;  4W9C A;  4BOZ B;  2NS5 A;  4M0W B;  4PYZ A;  2KJR A;  1T0Y A;  1TGZ B;  2O6V B;  4AOF A;  3H6N A;  2KDB A;  2FCS A;  3N3K B;  2N4F A;  4GDK A;  1XT9 B;  3UGB B;  4EUT A;  1YIW A;  5CTR C;  2KMA A;  2LZ6 A;  3EHV A;  4CHK A;  3NY5 A;  1U4A A;  1WM3 A;  3A4S C;  3L0W B;  2JZ3 B;  1TTN A;  2WYQ A;  2C9W B;  1WH3 A;  2KO3 A;  4KIK B;  2HE7 A;  2KFK B;  4W9L A;  4GDL B;  4TQ1 A;  2AWT A;  2Z59 B;  4J6I A;  3TL5 A;  1AAR A;  3M95 A;  4IC7 B;  4BKG A;  2EMT A;  1F9J A;  2PEA A;  3QQ8 B;  3MHS D;  2GBN A;  3KVF B;  2IO1 B;  4A3P A;  3ZTD A;  1E8Z A;  4GXB A;  3EC8 A;  2DEN B;  4BKT A;  2JY6 A;  3HM6 X;  3PS6 A;  4DK5 A;  3L13 A;  1S3S G;  3AU5 A;  4PS7 A;  4HPL B;  4EKU A;  3DVN U;  3BIN A;  5J2R A;  2CHZ A;  3ZKJ C;  3WAL A;  3VTW A;  2I1J A;  3ZRF A;  5GMV A;  2HD5 B;  1P9D U;  1UBI A;  2BKF A;  4IM3 A;  2D07 B;  2KX0 A;  1EO6 A;  1PQS A;  2LGD A;  4DDG D;  2FIF A;  2C7H A;  4NAW B;  5CHF A;  2R2O A;  5D7G A;  4EZL A;  2L8J A;  3M63 B;  1WJN A;  1G6J A;  2KJ6 A;  1GC7 A;  4ZDV A;  1WXS A;  2EKE C;  5CHW A;  4IWQ A;  4MEM A;  3S2A A;  1BT0 A;  4MJS B;  3PGE A;  2XK5 A;  4IM2 A;  2G4D B;  3RZW C;  3W1Y A;  2D11 A;  2CU1 A;  2AEH A;  5IAA C;  1E5W A;  5LLI A;  4RMA A;  1LXD A;  3IHP C;  1GG3 A;  3HHM A;  3PLU A;  3UQA A;  4HXD A;  2A5U A;  2EMS A;  4FJV B;  4HWI B;  3UIO B;  5IA7 A;  5AEK B;  1E90 A;  3A9J B;  3ZNH B;  2JWZ A;  2LGY A;  2V1Y A;  3LDZ E;  2KDI A;  2L7R A;  2ZEQ A;  2BYE A;  5E6N A;  4BBN F;  4DHJ B;  3LJ3 A;  2W9N A;  4ZRI A;  2JRH A;  3IVF A;  3ONS A;  2DZK A;  2D10 A;  3DBR I;  4K7W A;  3WAP A;  2NPT B;  3C0R B;  3B08 A;  4TUU A;  1XQQ A;  3ZO5 B;  5HKH A;  2MQJ A;  2K8B A;  2GBM A;  1KLV A;  2ZZP B;  1OQY A;  4KZ0 A;  4N9F 4;  3WAN A;  3OAW A;  2KTR B;  2C7M B;  3R3M A;  5FR6 A;  4GGQ A;  2MW5 A;  3AXC A;  2ZCB A;  2C5L C;  3APD A;  4IUM B;  4PS8 A;  1UGM A;  4K7S A;  2M17 A;  2REX A;  4YL8 A;  2KMC A;  4NY0 A;  3RYT A;  4LCD E;  5DPR A;  2GOW A;  3UQB A;  4E71 A;  2A4Z A;  2KZR A;  3RUL A;  3W1S A;  3OJ3 A;  1YQB A;  3N32 A;  2KWC A;  1GC6 A;  5EDS A;  4G3X B;  1WJ4 A;  4II3 B;  3PTF C;  3K9P B;  1S1Q B;  3PPA A;  1NI2 A;  3M62 B;  3QCA A;  3D32 A;  5D6J B;  4BOS C;  4HVB A;  4BBN C;  2JVC A;  3RCZ A;  2GBK A;  2LVO A;  2L05 A;  2LWP A;  2UWQ A;  3MJW A;  2KD0 A;  4LDT B;  2YLM A;  1SE9 A;  3DBH I;  4B95 A; 
#chains in the Genus database with same CATH topology
 3QK0 A;  5DPS A;  3C19 A;  3GP7 A;  4WJP A;  1HTO A;  4G11 A;  2KQS A;  3VQI A;  4LNF A;  3KYC D;  3HIZ A;  5TSS A;  2JWU A;  3DVN V;  1FNU A;  3KW5 B;  2RPV A;  3U8Z A;  5KHO A;  5JZE B;  2PW9 A;  2K8C A;  5G55 A;  3RNC C;  3PV1 A;  5L95 C;  2LGS A;  3HK0 A;  2MBO A;  4P7I A;  3VHT C;  4ZHP A;  4NAM A;  1K50 A;  1DOX A;  2B76 B;  2RPQ A;  2J0K A;  1I4P A;  3AEB B;  2L76 A;  3PRZ A;  1BXT A;  1CJE A;  3NZS A;  1ESF A;  1EM7 A;  4YT0 B;  1SE2 A;  5BMI A;  1PFD A;  5G5G A;  1T3Q A;  3H1U A;  1LFD A;  4GDL A;  2M4N A;  2WDT B;  1TS5 A;  2KKC A;  4E74 A;  1XLQ A;  1YD8 U;  2RGF A;  3P1M A;  1HE8 A;  2MEK A;  3W5U B;  2ZJD A;  3BK2 A;  1ZOY B;  2M19 A;  2W55 A;  1VD2 A;  4LTU A;  4A8X C;  1R7S A;  2AQ2 B;  2AL6 A;  3SHQ A;  5C1Z A;  3VFK A;  3ETR A;  1RFK A;  1E7P B;  1X1M A;  4KKI A;  4HKQ A;  4RF1 A;  2UYZ B;  1ENF A;  3L54 A;  2KWD A;  1V8C A;  4NAW A;  2LRU A;  3AE3 B;  5D94 A;  4ZRJ A;  3BWU D;  4W9F A;  3T8M A;  4XE0 A;  2ZPY A;  1V1P A;  4LJO B;  1J0G A;  4AJY B;  3NS8 A;  4KDI C;  1I42 A;  4MGY E;  4FUL A;  1C3T A;  1QOF A;  4JWS C;  1WF9 A;  2JF5 A;  3RNE C;  2PVG C;  4IG7 B;  3DPD A;  4UDU C;  2WS3 B;  4JIO U;  3T9L A;  2WLB A;  2NPT A;  2MJD A;  5E6J A;  2NBU A;  2V3S A;  3RPF C;  3RNB C;  2L1A A;  4JE3 B;  3RNF C;  4RGT A;  4FJY A;  3DQV A;  1ZXI A;  4KX6 B;  4YXD B;  2BPS A;  4YTN B;  4WQO B;  1KM7 A;  2MA9 B;  4N6E B;  4NJ6 A;  4ZRP A;  1XCT L;  3DCG A;  4B0M A;  1XXG A;  5E6P A;  4OZA A;  3AE1 B;  2M0A A;  1ACC A;  3AEC B;  4MAC A;  1Z5S B;  2YEP B;  1F2R C;  2B3A A;  4NQK E;  3IXS A;  1VRA B;  4PYU A;  3KUZ A;  1L6V A;  2N0S B;  3RZF A;  4F1S A;  3APC A;  1UUP A;  1NYQ A;  3AI5 A;  1MVK A;  1ISN A;  5FK9 C;  3B1L X;  1I4X A;  4C4V A;  1JWA D;  1K52 A;  1WRD B;  5FR3 A;  1RRB A;  1OEY A;  3NVV A;  3VR9 B;  1J8C A;  5C2T B;  3KUD B;  4C7Y A;  5FKA C;  3E56 A;  1GOZ A;  4WIP A;  4NNJ B;  4W9J A;  3AE2 B;  4FAD A;  2IDY A;  1D5X C;  3V61 A;  3ZIM A;  4P1B C;  4WWO A;  1VLB A;  3R2I A;  1WJU A;  3L10 B;  1WX9 A;  1TIF A;  5DPT A;  3PZD A;  2KYW A;  1J7C A;  2NVU I;  4LJP B;  1WX8 A;  3AED B;  1WFY A;  1IYF A;  3P63 A;  3X23 A;  1V9J A;  4WAF A;  1PYW D;  2Q5W D;  2MSE D;  2J0J A;  1J19 A;  2QMT A;  5L83 A;  2IBI B;  2KLG A;  1H4R A;  1D4B A;  1ZGU B;  3DWM A;  2IO3 B;  1SE3 A;  2CHW A;  1CMX B;  1I7H A;  1GPX A;  4A20 A;  4HCN B;  2BB6 A;  1WIA A;  2ASQ A;  3ZRC A;  1HZ5 A;  3ZNI D;  1YNT E;  3AUL A;  2CKH B;  1V5T A;  2ON8 A;  3LB8 C;  2JZZ A;  3HVD A;  2DYO A;  2ACZ B;  3A9J A;  4N58 A;  5AZF A;  3MFG A;  4H2A A;  2NBW B;  1V5O A;  1OFF A;  3H7P A;  1GB1 A;  2K6Q A;  3I57 A;  1FD6 A;  1WGR A;  3R66 C;  4AWJ A;  2GI9 A;  2PJH A;  4KZC A;  1I4R A;  2M8S A;  3DBS A;  1N63 A;  3WAM A;  1E6E B;  2Y5B B;  4B6W A;  4WQM A;  4IWO A;  1ET6 A;  1D3Z A;  3U30 A;  3V6E B;  1DOY A;  1Y56 A;  2ZCC A;  3HVZ A;  2N9X A;  3TUO A;  3A9K A;  3Q2A C;  4LLG M;  1YX6 B;  2L83 A;  4FXC A;  4REZ A;  3L16 A;  4BAX A;  4BKS D;  4LK0 M;  2GBR A;  3MHZ A;  4BKS A;  3P2B A;  3A1Q A;  3ZJT A;  2N7J A;  1WR1 A;  3CSF A;  4BOZ B;  4W9C A;  4M0W B;  1ZUD 2;  4AOF A;  1N5X A;  1MFW A;  2KAJ A;  3N3K B;  3U52 E;  1C76 A;  3IAM 1;  3UGB B;  2KMA A;  2W3R A;  1U4A A;  3Q14 C;  2JZ3 B;  1SEB D;  1TTN A;  2WXL A;  4RFB A;  4KIK B;  4AS1 A;  4W9L A;  4HKZ E;  4J6I A;  1D5Z C;  2GLS A;  4IC7 B;  2EMT A;  1F9J A;  2PEA A;  3DBL B;  3KVF B;  1K53 A;  4NZL B;  3PS6 A;  3L13 A;  4B0E A;  3DVN U;  3BIN A;  3ZKJ C;  2I1J A;  5GMV A;  2VZK D;  2BKF A;  2KX0 A;  4QAY A;  4DDG D;  1F2R I;  2R2O A;  2L8J A;  2DWQ A;  4KGR A;  1WJN A;  2RDG A;  2EKE C;  1XO3 A;  2JXT A;  3W1Y A;  5IAA C;  1LXD A;  3PLU A;  1VZ6 A;  3UIO B;  3I5J C;  5IA7 A;  5AEK B;  2JWZ A;  2V1Y A;  2LHD A;  2K5P A;  2ZW1 A;  2D10 A;  5JXV A;  2V9H A;  4K7W A;  5HKH A;  1XQQ A;  1SSN A;  1KTK A;  3DHI C;  1AN8 A;  2KTR B;  3U4E G;  3R3M A;  4M02 A;  4GGQ A;  2LHE A;  1C79 A;  2M17 A;  2REX A;  2KMC A;  1JW9 D;  4E71 A;  2KZR A;  2KWC A;  2CU3 A;  1TKE A;  2BBC A;  1D5M C;  4II3 B;  3M62 B;  3AB5 A;  2LWP A;  2YLM A;  1KLG D;  4I6P A;  5HI1 A;  2FCM A;  1C4P A;  1R4M B;  3ZW3 A;  2JU6 X;  2KAC A;  1YX5 B;  3A4R A;  2V0G A;  2KNB A;  2KK8 A;  1N5W A;  4TMA B;  4FLH A;  2O2V B;  2LJI A;  2MBB B;  4MGK E;  1RLF A;  1Z2M A;  3CF6 E;  3GZN I;  2MJE A;  2LGI A;  5H8Y E;  2K9X A;  3RN9 C;  2WXO A;  4XZ4 A;  2DAJ A;  3JSV B;  2Z0E B;  3ABV B;  2W54 A;  3SFE B;  2ZNV B;  2K6D B;  3QC8 B;  1KH0 A;  1VR9 A;  2ZVN A;  1IGC A;  1SIJ A;  3Q3M C;  4A9A A;  1TKY A;  1OEY J;  2QIL A;  3UIP B;  2XEW A;  1UWM A;  1SF0 A;  4JL9 A;  3RNG C;  1IPG A;  1HEZ E;  2DBY A;  4GOC A;  3JW0 X;  4OVV A;  3WIM A;  2LUM A;  1JQ4 A;  4AUQ C;  2ICI A;  4JGH B;  3VVW B;  2W3S A;  1TS2 A;  1UBQ A;  2KDE B;  2K39 A;  1SBB B;  3SDL C;  1N62 A;  3TEY A;  2WQY B;  3AMZ A;  2LXC A;  3BVM A;  1V86 A;  4N59 A;  2CS4 A;  3U2S C;  2N9L A;  1WJ6 A;  4ZYS A;  3ZXR A;  1YJJ A;  2MP2 B;  2DYB A;  3MTN B;  4WJN A;  1L0X B;  2AQ3 B;  4HDQ A;  4PT5 A;  2RSU A;  2PVO D;  4MJS A;  5G5H A;  3KUC B;  1I35 A;  3URY A;  3PO0 A;  1WGK A;  4MEL A;  3P4R B;  2GRI A;  2IY1 B;  3V62 A;  4URK A;  2IO2 B;  2LI5 A;  2L32 A;  4IW0 A;  1YQ3 B;  4TKN A;  1Q0W B;  1JCK B;  4MM3 A;  3O13 A;  1YQ4 B;  4P16 A;  1E0Z A;  2KDM A;  5AZH A;  3ENE A;  2IGG A;  1IBX B;  3BZD B;  4RGN A;  4JLC A;  2K3U A;  4FJZ A;  2WXM A;  3VUW A;  1F0Z A;  3BY4 B;  2DYM A;  2G3Q B;  2J53 A;  3PVL A;  1B1Z A;  3Q3J A;  4EZJ A;  1HXY D;  1ZP0 B;  4HJK A;  3WA0 A;  2CJN A;  2QIE B;  1YJI A;  3ZJU A;  5CX3 A;  4P6V F;  2FCQ A;  3NVZ A;  2C7N B;  2D2Q A;  1TS4 A;  3PZ7 A;  1WXM A;  1IP9 A;  4AQ7 A;  2MHJ A;  3AEF B;  3MP9 A;  3VTU A;  2DZI A;  3PHW B;  3ZUN A;  1E7U A;  5JH5 C;  1Y8R C;  3ZLZ A;  3ZTC A;  5D3D A;  1YN3 A;  1E8Y A;  2N1V A;  4EOY A;  3RI7 C;  2KJH B;  2JSV X;  3ZQ4 A;  1YOV B;  4ANV A;  1I4H A;  3TIX A;  1V97 A;  2JX5 A;  4NJC A;  4BFR A;  1VZ7 A;  1A5R A;  1GNU A;  3PRP B;  2WXK A;  2WXF A;  3QAR A;  2XK5 B;  1JRU A;  3P42 A;  3DBR B;  4LNO A;  2N9E B;  4GIV A;  1GAQ B;  1UZX B;  4RM9 A;  1IUE A;  1C4C A;  5TR5 A;  1GJZ A;  4IM0 A;  4EZK A;  4WJO A;  2L3Z A;  4W9H A;  2SEB D;  4XDC A;  2I38 A;  4ZRK A;  3R8B A;  1JML A;  4F8C B;  1ZDV A;  4EEW A;  3WAO A;  4OVU A;  4WH4 A;  4MDK E;  2OJW A;  1WRI A;  4Q2J A;  1CQV A;  1FRR A;  4CQN A;  1ZE3 D;  3AE9 B;  1GUA B;  4HPM B;  4FN2 A;  4S0R A;  1WGH A;  3OG5 A;  4MSM B;  2KVR A;  3DBH B;  2N7E A;  4WWP A;  1P1A A;  1C4A A;  1SIF A;  1WXQ A;  4ARI A;  1TT5 B;  1QOA A;  4NJ7 A;  3TJP A;  2INP E;  4D2K A;  2KFJ A;  2KMM A;  1FEH A;  4W9I A;  3VUX A;  2CHX A;  2LEK A;  2JRI B;  1NDD A;  3N1X C;  5JHA A;  1L5P A;  4FHJ A;  4BZA A;  1N6Z A;  4IKG A;  1PGX A;  2BWE S;  4HCP B;  4ITK A;  4NPN A;  1FPY A;  3ZYY X;  5IN7 A;  2BS3 B;  3MJ5 A;  1TKG A;  3MC8 A;  1WMH A;  3N1Y C;  4O1N A;  2KDB A;  1FCC C;  2N4F A;  1TYG B;  5CTR C;  3V3X A;  3RNA C;  3A4S C;  2H89 B;  2WNM A;  5C3J B;  2V3P A;  3Q6B A;  4BKG A;  1FFV A;  2MJ3 A;  2GBN A;  4A3P A;  4YTP B;  3ZTD A;  1YN5 A;  5MPO A;  4GXB A;  3EC8 A;  5H92 C;  4DK5 A;  2RDH A;  4A55 A;  4PS7 A;  4LNK A;  5IP4 D;  2EKI A;  3WAL A;  5BYQ A;  3VTW A;  4US8 A;  1QKZ A;  1P9D U;  1UBI A;  2FIF A;  5D7G A;  2QCZ A;  3B2F A;  1HTQ A;  3Q3O C;  5AUK A;  2D3B A;  1L6U A;  2K22 A;  4ZHO A;  3BYT B;  3PGE A;  2HJ1 A;  2D11 A;  2CU1 A;  2AEH A;  1T6B X;  5LLI A;  3UQA A;  2Y5C A;  1QOG A;  3VRB B;  2EMS A;  3A9J B;  2I2Y A;  2KDI A;  4OW0 A;  3B9J A;  2VH2 A;  2DZK A;  4TUU A;  3C0R B;  3ZO5 B;  1FXA A;  2GBM A;  2QC8 A;  2INC C;  4LNN A;  4N9F 4;  3WAN A;  3OAW A;  1P7E A;  2MW5 A;  1QOB A;  3AXC A;  2ZCB A;  1M4V A;  5BMH A;  1UGM A;  4YL8 A;  4NY0 A;  3UQB A;  2GOW A;  3N1Z C;  2A4Z A;  3GS2 A;  2QSD A;  1WJ4 A;  4M01 A;  1RYJ A;  5LNK 1;  3K9P B;  3HRD D;  4BOS C;  4BBN C;  2JVC A;  2IJ0 A;  4HRS A;  2KD0 A;  4MH8 A;  1SE9 A;  1YN4 A;  4B95 A;  4JWU C;  2NTS A;  4FA6 A;  1XD3 B;  1QIL A;  4YSY B;  3CMM B;  1A70 A;  1WI0 A;  4JQW C;  2NBV B;  4DDI D;  1SB3 C;  2PKO A;  1FNV A;  3IAS 1;  2CR5 A;  3NZ3 A;  3UF8 A;  3NUH B;  3Q3N C;  3NG0 A;  3QA8 A;  1WGG A;  4C7Z A;  2LRW A;  4OZC A;  2LXA A;  1JWB D;  2ZNV C;  2OED A;  1EUV B;  2WU2 B;  3VRA B;  3RD2 A;  2R2Q A;  2RDB C;  4OZB A;  1EF1 A;  1MJD A;  1QF6 A;  1R4N B;  3Q3F A;  2WHI A;  2LD9 A;  2JYE A;  3QIJ A;  4M0W A;  2BW2 A;  2KAN A;  3FAH A;  1L0Y B;  2KHW B;  3U7Z A;  2FBW B;  4RGO S;  2MBH A;  4KDL B;  4GU2 A;  2HJ8 A;  2H88 B;  1CK1 A;  4XC2 A;  4PS3 A;  3PT2 B;  2V3N A;  3L08 A;  2DHZ A;  2DNF A;  2MRP A;  4HEA 1;  4ARC A;  1FXT B;  1JWS D;  1XCQ L;  2BKR B;  2XBB C;  4KIK A;  3DHH C;  2DZM A;  4K1R B;  3R2T A;  1L0V B;  2D3G A;  2VZK B;  1MHX A;  1KRH A;  2IYD B;  1T0Q C;  1T5X D;  3ZVV A;  2LVP A;  4A3O A;  2XN9 C;  2LGX A;  2D3C A;  2LAS A;  3DOW A;  3TSS A;  3ZXV A;  3H8H A;  3RT3 B;  1I4Q A;  3DBL I;  4I6N B;  1OQR A;  3BVZ A;  1WZ3 A;  1N61 A;  2AYO B;  2HTM E;  3EA6 A;  1SXT A;  2BYF A;  2FAZ A;  4HJG E;  2FUG 1;  2L52 A;  1CZP A;  2MLB A;  3FIL B;  2WWZ A;  2FID A;  1V6E A;  1E9M A;  1AYF A;  4LNI A;  3V05 A;  3QHT A;  2MCN B;  4OVZ A;  4YTM B;  2KXJ A;  1XEE A;  2QHO A;  3TEX A;  3EFU A;  4MH0 E;  4WWN A;  1GB4 A;  2LUE A;  2N1W A;  4HLE A;  1WYW B;  1SJE D;  2RR9 A;  1AWD A;  1TBE A;  3HM3 A;  1YMH E;  1T0R C;  4X57 B;  1ZW7 A;  3N20 C;  1ZPS A;  4IWP A;  1J7A A;  2KTR A;  1P98 A;  4TQ0 A;  3DWG C;  1WR6 E;  1EU3 A;  1UH6 A;  3EGR A;  5BO4 B;  4W9D A;  2I1K A;  3U7D A;  2BYT A;  4EFO A;  3X0W A;  1JWM D;  3PRE A;  1P0R A;  1EWY C;  4GDK B;  1PGA A;  2J7Q B;  3TEW A;  4GMV A;  2KC2 A;  3W5V B;  4M00 A;  3V6C B;  3V60 A;  4F7Z A;  4W9G A;  2J0M A;  2O6V D;  1RWS A;  4AP4 C;  2O2V A;  3L4P A;  4K3C A;  2O6V A;  2G4S A;  1YJ1 A;  2G1E A;  3DVG Y;  1R4M I;  3QX1 A;  1OTR B;  4ICV A;  3WCQ A;  1FFU A;  4E3C A;  1DOI A;  2KC1 A;  2KT7 A;  2MH7 A;  3A33 B;  4HPP A;  3GOE A;  2KFK A;  1QZE A;  2KQ7 A;  3JSV A;  2ZPN A;  4ANX A;  4C00 A;  1ZKH A;  1NEK B;  4K7U A;  2E6X A;  3AU4 A;  4M8M A;  5EE9 A;  1Q10 A;  3BYY B;  2BGF A;  2L0T A;  4KSL C;  3P4P B;  1WM2 A;  1PGB A;  4J3O D;  2BB5 A;  2M0X A;  3MC0 B;  3W1S C;  3IT4 B;  2KDF B;  2XNA C;  1F52 A;  4WJQ A;  3VAW A;  5JHB A;  1XLP A;  3EFC A;  2MBQ A;  3ALB A;  4TV3 A;  2V4L A;  3QJZ A;  4MGZ E;  1KLU D;  1WXV A;  4ZYN A;  2WXP A;  1KFY B;  3NJT A;  3AE6 B;  2KWU B;  2JYT A;  4XWW A;  4HDO A;  2IPK D;  3B0A A;  2KN5 A;  4DHJ D;  1E10 A;  1P3Q U;  2MP2 A;  4RCO A;  2ZVO A;  3B2G A;  2IND C;  2IZV B;  2L00 B;  2JZP A;  1FCL A;  3T3N A;  3AE4 B;  3SD5 A;  4BVU C;  2INN E;  1UD7 A;  2AQ1 B;  4ASW C;  4M8N A;  1MI0 A;  1B9R A;  3J9C A;  5J17 A;  4P1C C;  3BII D;  1KOT A;  2BT6 A;  3ZNZ B;  3VUY A;  3PRM B;  3N30 A;  4LDT D;  2KOX A;  2DAF A;  3W2D A;  4DWF A;  3EEC A;  1Q5W B;  1RM6 C;  3LYY A;  1TZO A;  3Q8F A;  1KF6 B;  3IBE A;  1V81 A;  1WY8 A;  4YSZ B;  1IBX A;  2NMQ A;  2OJR A;  2PTL A;  2FNJ B;  1VCB A;  2PE9 A;  2WX1 A;  3RMK C;  4L1B A;  2GB1 A;  1ROE A;  4AJW A;  2BTE A;  2NS5 A;  1T0Y A;  2Z8L A;  3H6N A;  3NRZ A;  3E9S A;  3OWE B;  3I63 C;  4EUT A;  1YIW A;  3EHV A;  2WP9 B;  3GE8 C;  4CHK A;  2BVC A;  2WYQ A;  2C9W B;  1WH3 A;  1JWU D;  1NI3 A;  2D3A A;  4GDL B;  4TQ1 A;  3FC4 A;  1XLN A;  2AWT A;  2Z59 B;  1AAR A;  2M56 B;  3M95 A;  5BYS A;  2TSS A;  3QQ8 B;  3MHS D;  2IO1 B;  2R61 A;  1HZ6 A;  2DEN B;  1UGJ A;  4WWM A;  2D5G A;  1S3S G;  3GB1 A;  5J2R A;  3SR6 A;  1SJH D;  4ACF A;  2J42 A;  2QEJ C;  3AN1 A;  1SE4 A;  1EO6 A;  2LGD A;  2QJL A;  2C7H A;  3PZ8 A;  4NAW B;  4EZL A;  4ZOH C;  1P7F A;  2WDR B;  1G6J A;  4IWQ A;  3S2A A;  1V1P B;  2XK5 A;  4IM2 A;  4A90 A;  2G4D B;  3RZW C;  4YSX B;  1AW7 A;  1FIQ A;  1E5W A;  3P4S B;  1GG3 A;  3NS1 A;  4HXD A;  5HFY A;  2A5U A;  4FJV B;  4HWI B;  1E90 A;  2LGY A;  3LDZ E;  4JX1 C;  5IKC M;  2L7R A;  4BBN F;  2BYE A;  1BML C;  2W9N A;  3AEE B;  3ONS A;  4DQO C;  3DBR I;  3WAP A;  2NPT B;  3B08 A;  2MQJ A;  1KLV A;  2WXG A;  2IGH A;  5FR6 A;  1HQR D;  3APD A;  2C5L C;  4IUM B;  4K7S A;  5HHD G;  5DPR A;  3RUL A;  3W1S A;  3OJ3 A;  3N32 A;  1JRO A;  1GC6 A;  5EDS A;  1FMA D;  3PPA A;  5AUI A;  1NI2 A;  3QCA A;  3D32 A;  2UWQ A;  1STE A;  2W82 A;  3DBH I;  3NVW A;  1I4G A;  1WSP A;  2K0P A;  4OHJ A;  2WX0 A;  1JAL A;  1NBF C;  4A6Q A;  2KVZ A;  1HA5 A;  3I3T B;  3Q8A A;  2V4I B;  2PE6 B;  1BUI C;  2G9H D;  2KLC A;  1WMH B;  2IY0 B;  4C4V B;  1QT9 A;  2KTF A;  3Q8B A;  1E8X A;  3L17 A;  1WGD A;  4CO7 A;  2MWS B;  3GE3 C;  3ML9 A;  3UI3 A;  1MHH E;  2BF8 B;  1L2N A;  2Y3A A;  4K81 A;  3JVZ X;  1LM8 B;  4DXF A;  4RF0 A;  3VH3 B;  2AL3 A;  1F1H A;  4II2 B;  4DHZ E;  3KH0 A;  3ECI A;  1ET9 A;  1H8C A;  1RAX A;  2RD0 A;  1UNS A;  3LXF A;  3HUI A;  2NTT A;  2OHF A;  2VH1 A;  4XX5 A;  1RFA A;  4RGM A;  2M1M A;  5I4D A;  2N9K A;  4MSQ B;  5IOI A;  3H9D A;  4DHZ B;  4RH6 A;  3KLS X;  4NQL B;  3R7R A;  1TJE A;  3AE5 B;  1D6E C;  4L2Y A;  2GMI C;  2G45 B;  3ZGZ A;  1TY0 A;  1FRD A;  3NHE B;  2VRR B;  2KX3 A;  5E6O A;  5C23 A;  1FXI A;  2N7D A;  3CWI A;  2ZW0 A;  4G0N B;  3DHG C;  1FNW A;  3PSE B;  5AZG A;  2J4X A;  3CIR B;  5EE1 A;  5D2M B;  3H7P B;  1EWC A;  1TZ1 A;  3C8Y A;  5BMG A;  2DX5 B;  4FHK A;  2RMM A;  2QDF A;  1LGR A;  3PHX B;  4KVG B;  2OOB B;  1K8R B;  4R3D A;  4FBJ B;  3R7Q A;  3M3J A;  1T0S C;  2FUH B;  1MG4 A;  1WX7 A;  3ZDT A;  3KQ4 A;  4RM8 A;  3Q8C A;  4IDI A;  5LXI B;  4EE2 A;  3QWZ B;  3FKY A;  2BQQ A;  3VTV A;  3A9K B;  3OJ4 B;  3DDC B;  1C1Y B;  5DPW A;  4HRO A;  4CYE A;  4B9K A;  3TEZ A;  3A1Q B;  1V49 A;  3JYU A;  1E7V A;  5EE0 A;  2LJ5 A;  2WXI A;  1N60 A;  3ZNG C;  2PPH A;  2Y5P A;  1WE6 A;  4IOI E;  4W9E A;  1NVI D;  4G50 A;  3H7S A;  3ZJV A;  3QAQ A;  3TMP B;  2MX2 A;  4ZRQ A;  2L0F A;  5BYR A;  3OLM D;  5DCN A;  1C78 A;  2IO0 B;  2WXJ A;  2BWF A;  2JT4 B;  1JRP A;  1L4Z B;  1NEN B;  4GB9 A;  2N9P C;  2KN4 A;  3AM9 A;  4DXA B;  3UIN B;  2K8H A;  4ICU A;  1WZ0 A;  1WYG A;  2MBE A;  4GLS C;  4KV2 A;  1ZXH A;  2HTH A;  2LMC A;  3K9O B;  1V80 A;  2NCN A;  2DZJ A;  3IG3 A;  2BS4 B;  3MC9 A;  2JXX A;  3VH4 B;  1QLB B;  3AV8 A;  2KWV B;  3PLV A;  2WXQ A;  2NR2 A;  3IT6 B;  5G2N A;  3P4Q B;  2JUO A;  2YVC A;  1UEL A;  4ANU A;  3SEB A;  5HG2 A;  1R4N I;  1J7B A;  4HK2 A;  4GSW A;  3VDZ A;  3N9Y C;  3DVG X;  3AE8 B;  1L4D B;  4DBG A;  1C9F A;  3KWL A;  3NZU A;  2JPH A;  3AH7 A;  2Z0D B;  2C60 A;  1IGD A;  2ONQ A;  4RNA A;  4MGI E;  5CHV C;  1V1O A;  4L23 A;  1WXA A;  4PK1 A;  1K51 A;  1LO5 D;  3O65 B;  4KGS A;  3SU8 X;  3W9C B;  2YEP F;  2WXH A;  4WAA A;  3RFZ B;  2WXR A;  3I9V 1;  3APF A;  1EF5 A;  2DLB A;  2E3T A;  5LXH A;  2LVQ A;  1UWX A;  1MG8 A;  4C56 C;  3TBL D;  1L7Y A;  3RUI B;  1VJK A;  2K1F A;  1WGY A;  4KSK C;  4S17 A;  2PIA A;  2SAK A;  4I6L B;  2AX5 A;  4GN1 A;  4ANW A;  3SFD B;  4DXG A;  3FIL A;  2FCN A;  3CST A;  5D3I B;  1QQR A;  1OQQ A;  3NOB A;  2WDV B;  1WE7 A;  1E8W A;  3GZN B;  5GXG B;  5J18 A;  4C80 A;  3ML8 A;  1OGW A;  5KHQ A;  1KJT A;  4W9K A;  2WXN A;  3VXW A;  2PLP A;  2K25 A;  1LQB A;  1V2Y A;  4JPS A;  1M94 A;  2CJO A;  3IFW B;  3TCA A;  1C77 A;  3ZDM C;  2GBJ A;  2WDQ B;  3KYD D;  1DGJ A;  2BYV E;  4XDD A;  1F77 A;  4K3B A;  1DYQ A;  1PDX A;  1Q1O A;  2WGS A;  1XF5 L;  1SGH A;  5IO9 A;  5T8I A;  1VDV A;  4PYZ A;  4WUR A;  2KJR A;  4MT5 A;  1TGZ B;  2O6V B;  2FCS A;  4KKJ A;  4GDK A;  1XT9 B;  3EUB 2;  2LZ6 A;  3NY5 A;  1WM3 A;  3L0W B;  1PUT A;  2KO3 A;  2KQ4 X;  2HE7 A;  2KFK B;  2HDE A;  3AEA B;  3TL5 A;  3KWV A;  4XYC A;  2IGD A;  2BS2 B;  2EEL A;  4USA A;  1E8Z A;  3BVG A;  4BKT A;  2JY6 A;  3HM6 X;  3AU5 A;  4HPL B;  4EKU A;  2LFI A;  3BK1 A;  2CHZ A;  1ZDX A;  3ZRF A;  2HD5 B;  4IM3 A;  2D07 B;  1PQS A;  4XGA B;  1VZ8 A;  1FM0 D;  1MPE A;  1WWT A;  5CHF A;  3M63 B;  2KJ6 A;  1GC7 A;  4ZDV A;  1WXS A;  2J52 A;  5CHW A;  4MEM A;  1BT0 A;  1XLO A;  2FE8 A;  4MJS B;  1EU4 A;  4RMA A;  3IHP C;  3HHM A;  3Q69 A;  2X8X X;  3AEG B;  3ZNH B;  4YWG G;  4US9 A;  2ZEQ A;  5E6N A;  4DHJ B;  3T3O A;  3LJ3 A;  4ZRI A;  2JRH A;  3IVF A;  2X38 A;  2WU5 B;  1NYR A;  1TS3 A;  1UF0 A;  2K8B A;  4TSS A;  2ZZP B;  4MM3 B;  1OQY A;  4KZ0 A;  2C7M B;  4PS8 A;  3RYT A;  4LCD E;  4KGT A;  5EE3 A;  1YQB A;  2JQR B;  1TY2 A;  1FO4 A;  3AE7 B;  4G3X B;  4XWT A;  3PTF C;  1S1Q B;  5D6J B;  4HVB A;  3RCZ A;  2GBK A;  2LVO A;  2L05 A;  2UU7 A;  4LDT B;  3MJW A;  3Q8E A;  3VR8 B;  2PMV A;  3NVY A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  4FA6 A;  1XD3 B;  5DPS A;  2WX0 A;  4I6P A;  3CMM B;  1NBF C;  1WI0 A;  4JQW C;  2NBV B;  2FCM A;  4WJP A;  4DDI D;  3ZW3 A;  3I3T B;  4G11 A;  1YX5 B;  2KQS A;  3A4R A;  3VQI A;  2PE6 B;  2KNB A;  2CR5 A;  3HIZ A;  2KK8 A;  2KLC A;  3KYC D;  3UF8 A;  1WMH B;  3QA8 A;  1WGG A;  4FLH A;  2IY0 B;  2O2V B;  2LRW A;  2KTF A;  3DVN V;  2LXA A;  3KW5 B;  2MBB B;  4MGK E;  1E8X A;  2ZNV C;  3L17 A;  1WGD A;  5KHO A;  3U8Z A;  1RLF A;  2MWS B;  4CO7 A;  5JZE B;  1Z2M A;  2K8C A;  3CF6 E;  3GZN I;  3ML9 A;  2BF8 B;  5G55 A;  1L2N A;  1EUV B;  3PV1 A;  3RD2 A;  2R2Q A;  4K81 A;  5L95 C;  3JVZ X;  3HK0 A;  1LM8 B;  2MBO A;  1EF1 A;  3VH3 B;  4P7I A;  2AL3 A;  3Q3F A;  3VHT C;  2LD9 A;  4II2 B;  4DHZ E;  3KH0 A;  3QIJ A;  4XZ4 A;  3ECI A;  2DAJ A;  3JSV B;  2KAN A;  2Z0E B;  1H8C A;  1RAX A;  2RPQ A;  2KHW B;  2J0K A;  2RD0 A;  2MBH A;  4KDL B;  4GU2 A;  2HJ8 A;  2L76 A;  2ZNV B;  2K6D B;  3QC8 B;  4XC2 A;  4PS3 A;  3PRZ A;  3PT2 B;  2ZVN A;  3NZS A;  4XX5 A;  3L08 A;  2DHZ A;  2MRP A;  1OEY J;  3UIP B;  2XEW A;  1FXT B;  1RFA A;  2M1M A;  4JL9 A;  1IPG A;  2XBB C;  2BKR B;  4GOC A;  4MSQ B;  4KIK A;  2DZM A;  3H1U A;  1LFD A;  3H9D A;  2M4N A;  3JW0 X;  4GDL A;  2WDT B;  4K1R B;  4OVV A;  3WIM A;  4DHZ B;  4AUQ C;  2D3G A;  2KKC A;  4E74 A;  4JGH B;  1YD8 U;  2RGF A;  1HE8 A;  4NQL B;  2IYD B;  3R7R A;  2ZJD A;  3VVW B;  3ZVV A;  1VD2 A;  2LVP A;  4A3O A;  2GMI C;  2LGX A;  1UBQ A;  2LAS A;  2G45 B;  2KDE B;  2AL6 A;  3DOW A;  3SHQ A;  3VFK A;  2K39 A;  5C1Z A;  3SDL C;  3NHE B;  1X1M A;  2LXC A;  2VRR B;  3RT3 B;  1V86 A;  2KX3 A;  5E6O A;  5C23 A;  2N7D A;  2CS4 A;  2UYZ B;  3DBL I;  4I6N B;  4G0N B;  1WZ3 A;  1WJ6 A;  2AYO B;  3L54 A;  3PSE B;  2MP2 B;  2BYF A;  2DYB A;  4NAW A;  2LRU A;  3MTN B;  5AZG A;  2FAZ A;  4WJN A;  5D2M B;  3H7P B;  5D94 A;  4ZRJ A;  2MLB A;  4HDQ A;  1TZ1 A;  2FID A;  2RSU A;  1V6E A;  2WWZ A;  4W9F A;  3T8M A;  2ZPY A;  4MJS A;  2DX5 B;  4FHK A;  3QHT A;  4LJO B;  2MCN B;  1J0G A;  4AJY B;  3KUC B;  1I35 A;  3NS8 A;  3PHX B;  4KDI C;  2OOB B;  4KVG B;  1K8R B;  4MEL A;  4MGY E;  2KXJ A;  4FUL A;  4FBJ B;  1C3T A;  2QHO A;  3R7Q A;  3M3J A;  3EFU A;  2FUH B;  2IY1 B;  4MH0 E;  1WF9 A;  4WWN A;  3V62 A;  4URK A;  2JF5 A;  1WX7 A;  2LUE A;  2N1W A;  3ZDT A;  2IO2 B;  4RM8 A;  4HLE A;  4IG7 B;  3DPD A;  1WYW B;  5LXI B;  2LI5 A;  2RR9 A;  3QWZ B;  4JIO U;  4IW0 A;  1TBE A;  3T9L A;  3HM3 A;  2NPT A;  2NBU A;  2V3S A;  3VTV A;  3A9K B;  4TKN A;  3OJ4 B;  4X57 B;  3DDC B;  1ZW7 A;  1Q0W B;  4MM3 A;  4IWP A;  4FJY A;  1C1Y B;  1P98 A;  2KTR A;  3DQV A;  4TQ0 A;  5DPW A;  1WR6 E;  4CYE A;  2BPS A;  4WQO B;  4B9K A;  5AZH A;  1UH6 A;  3ENE A;  1KM7 A;  5BO4 B;  2MA9 B;  3A1Q B;  1V49 A;  3JYU A;  4W9D A;  2I1K A;  4NJ6 A;  1E7V A;  4JLC A;  3U7D A;  2LJ5 A;  3DCG A;  4FJZ A;  3VUW A;  4EFO A;  3BY4 B;  3X0W A;  5E6P A;  3ZNG C;  2PPH A;  1WE6 A;  3PRE A;  2DYM A;  1P0R A;  2G3Q B;  4W9E A;  3PVL A;  4G50 A;  3H7S A;  4GDK B;  3Q3J A;  2J7Q B;  1Z5S B;  3QAQ A;  3TMP B;  2MX2 A;  4EZJ A;  4GMV A;  2KC2 A;  2B3A A;  4HJK A;  4NQK E;  4PYU A;  2L0F A;  3WA0 A;  3KUZ A;  3RZF A;  3OLM D;  5DCN A;  4F1S A;  3V6C B;  2IO0 B;  3V60 A;  3APC A;  5CX3 A;  4F7Z A;  2BWF A;  2JT4 B;  2J0M A;  4W9G A;  2FCQ A;  4GB9 A;  2N9P C;  2C7N B;  2D2Q A;  3AI5 A;  2O6V D;  4DXA B;  3UIN B;  4AP4 C;  1ISN A;  2K8H A;  1WXM A;  2O2V A;  3B1L X;  4ICU A;  1IP9 A;  1WZ0 A;  2MBE A;  1WRD B;  1RRB A;  1OEY A;  2O6V A;  2G4S A;  4KV2 A;  1YJ1 A;  3VTU A;  2DZI A;  3PHW B;  3DVG Y;  1J8C A;  3KUD B;  2HTH A;  3ZUN A;  1R4M I;  3QX1 A;  1E7U A;  1OTR B;  3K9O B;  1V80 A;  1Y8R C;  2NCN A;  4ICV A;  3ZLZ A;  5JH5 C;  3ZTC A;  2DZJ A;  1E8Y A;  4NNJ B;  4W9J A;  4E3C A;  3IG3 A;  2KC1 A;  4FAD A;  2N1V A;  2JXX A;  3A33 B;  3VH4 B;  4EOY A;  2KWV B;  3PLV A;  3GOE A;  2KFK A;  1QZE A;  2KJH B;  3V61 A;  2NR2 A;  2KQ7 A;  3ZIM A;  4WWO A;  5G2N A;  3JSV A;  2ZPN A;  4ANV A;  4ANX A;  1WJU A;  3TIX A;  1ZKH A;  3L10 B;  4BFR A;  1WX9 A;  2JUO A;  1A5R A;  4K7U A;  3AU4 A;  5DPT A;  2YVC A;  3PZD A;  1UEL A;  4ANU A;  4M8M A;  1GNU A;  1R4N I;  2NVU I;  3PRP B;  4HK2 A;  4LJP B;  4GSW A;  3VDZ A;  1WX8 A;  3QAR A;  3DVG X;  2BGF A;  2XK5 B;  1JRU A;  2L0T A;  4DBG A;  1WFY A;  1IYF A;  4KSL C;  1WM2 A;  2N9E B;  1V9J A;  3NZU A;  4GIV A;  3X23 A;  2JPH A;  2MSE D;  2Z0D B;  2C60 A;  2J0J A;  2M0X A;  1J19 A;  1UZX B;  4RM9 A;  4MGI E;  2IBI B;  5CHV C;  5TR5 A;  3W1S C;  5L83 A;  1WXA A;  2KLG A;  1H4R A;  4IM0 A;  1GJZ A;  4EZK A;  1ZGU B;  4WJO A;  2KDF B;  2L3Z A;  4W9H A;  4WJQ A;  3O65 B;  3SU8 X;  3VAW A;  4ZRK A;  5JHB A;  4F8C B;  2MBQ A;  3ALB A;  2IO3 B;  4WAA A;  2CHW A;  4TV3 A;  1CMX B;  2V4L A;  3QJZ A;  4EEW A;  3WAO A;  4MGZ E;  4OVU A;  4A20 A;  1WXV A;  4ZYN A;  4MDK E;  4HCN B;  3APF A;  1EF5 A;  1WIA A;  5LXH A;  2ASQ A;  3ZRC A;  2KWU B;  2LVQ A;  1GUA B;  4HDO A;  3ZNI D;  4HPM B;  1MG8 A;  3AUL A;  4FN2 A;  2CKH B;  1WGH A;  3TBL D;  1V5T A;  3B0A A;  4MSM B;  2KN5 A;  1L7Y A;  4DHJ D;  2KVR A;  2JZZ A;  2K1F A;  3RUI B;  2DYO A;  1P3Q U;  3A9J A;  2MP2 A;  2N7E A;  1WGY A;  5AZF A;  4WWP A;  4KSK C;  1P1A A;  2NBW B;  4I6L B;  1SIF A;  1V5O A;  2ZVO A;  3H7P A;  4GN1 A;  4ANW A;  2FCN A;  3CST A;  2IZV B;  2L00 B;  2K6Q A;  1WGR A;  3R66 C;  4AWJ A;  2PJH A;  3SD5 A;  3NOB A;  4KZC A;  4BVU C;  2M8S A;  3DBS A;  4NJ7 A;  1WE7 A;  3TJP A;  3WAM A;  1UD7 A;  2KFJ A;  1E8W A;  4ASW C;  4M8N A;  2Y5B B;  4W9I A;  5J18 A;  4B6W A;  5J17 A;  3VUX A;  2CHX A;  1KOT A;  3ML8 A;  1OGW A;  2JRI B;  3ZNZ B;  1NDD A;  4IWO A;  5KHQ A;  1D3Z A;  3U30 A;  3V6E B;  5JHA A;  1KJT A;  2ZCC A;  3PRM B;  4W9K A;  4FHJ A;  3N30 A;  3VUY A;  3VXW A;  2N9X A;  4LDT D;  2KOX A;  2K25 A;  2DAF A;  1I42 A;  3A9K A;  1LQB A;  1V2Y A;  1YX6 B;  4DWF A;  1M94 A;  3EEC A;  1Q5W B;  2BWE S;  4HCP B;  3IFW B;  4NPN A;  3L16 A;  4BKS D;  3TCA A;  3ZDM C;  3IBE A;  2GBJ A;  1V81 A;  3KYD D;  2GBR A;  2BYV E;  1WY8 A;  4BKS A;  3P2B A;  3A1Q A;  2OJR A;  2FNJ B;  1VCB A;  2PE9 A;  2WX1 A;  1Q1O A;  1WR1 A;  3CSF A;  1SGH A;  4AJW A;  1WMH A;  4W9C A;  4BOZ B;  2NS5 A;  4M0W B;  4PYZ A;  2KJR A;  1T0Y A;  1TGZ B;  2O6V B;  4AOF A;  3H6N A;  2KDB A;  2FCS A;  3N3K B;  2N4F A;  4GDK A;  1XT9 B;  3UGB B;  4EUT A;  1YIW A;  5CTR C;  2KMA A;  2LZ6 A;  3EHV A;  4CHK A;  3NY5 A;  1U4A A;  1WM3 A;  3A4S C;  3L0W B;  2JZ3 B;  1TTN A;  2WYQ A;  2C9W B;  1WH3 A;  2KO3 A;  4KIK B;  2HE7 A;  2KFK B;  4W9L A;  4GDL B;  4TQ1 A;  2AWT A;  2Z59 B;  4J6I A;  3TL5 A;  1AAR A;  3M95 A;  4IC7 B;  4BKG A;  2EMT A;  1F9J A;  2PEA A;  3QQ8 B;  3MHS D;  2GBN A;  3KVF B;  2IO1 B;  4A3P A;  3ZTD A;  1E8Z A;  4GXB A;  3EC8 A;  2DEN B;  4BKT A;  2JY6 A;  3HM6 X;  3PS6 A;  4DK5 A;  3L13 A;  1S3S G;  3AU5 A;  4PS7 A;  4HPL B;  4EKU A;  3DVN U;  3BIN A;  5J2R A;  2CHZ A;  3ZKJ C;  3WAL A;  3VTW A;  2I1J A;  3ZRF A;  5GMV A;  2HD5 B;  1P9D U;  1UBI A;  2BKF A;  4IM3 A;  2D07 B;  2KX0 A;  1EO6 A;  1PQS A;  2LGD A;  4DDG D;  2FIF A;  2C7H A;  4NAW B;  5CHF A;  2R2O A;  5D7G A;  4EZL A;  2L8J A;  3M63 B;  1WJN A;  1G6J A;  2KJ6 A;  1GC7 A;  4ZDV A;  1WXS A;  2EKE C;  5CHW A;  4IWQ A;  4MEM A;  3S2A A;  1BT0 A;  4MJS B;  3PGE A;  2XK5 A;  4IM2 A;  2G4D B;  3RZW C;  3W1Y A;  2D11 A;  2CU1 A;  2AEH A;  5IAA C;  1E5W A;  5LLI A;  4RMA A;  1LXD A;  3IHP C;  1GG3 A;  3HHM A;  3PLU A;  3UQA A;  4HXD A;  2A5U A;  2EMS A;  4FJV B;  4HWI B;  3UIO B;  5IA7 A;  5AEK B;  1E90 A;  3A9J B;  3ZNH B;  2JWZ A;  2LGY A;  2V1Y A;  3LDZ E;  2KDI A;  2L7R A;  2ZEQ A;  2BYE A;  5E6N A;  4BBN F;  4DHJ B;  3LJ3 A;  2W9N A;  4ZRI A;  2JRH A;  3IVF A;  3ONS A;  2DZK A;  2D10 A;  3DBR I;  4K7W A;  3WAP A;  2NPT B;  3C0R B;  3B08 A;  4TUU A;  1XQQ A;  3ZO5 B;  5HKH A;  2MQJ A;  2K8B A;  2GBM A;  1KLV A;  2ZZP B;  1OQY A;  4KZ0 A;  4N9F 4;  3WAN A;  3OAW A;  2KTR B;  2C7M B;  3R3M A;  5FR6 A;  4GGQ A;  2MW5 A;  3AXC A;  2ZCB A;  2C5L C;  3APD A;  4IUM B;  4PS8 A;  1UGM A;  4K7S A;  2M17 A;  2REX A;  4YL8 A;  2KMC A;  4NY0 A;  3RYT A;  4LCD E;  5DPR A;  2GOW A;  3UQB A;  4E71 A;  2A4Z A;  2KZR A;  3RUL A;  3W1S A;  3OJ3 A;  1YQB A;  3N32 A;  2KWC A;  1GC6 A;  5EDS A;  4G3X B;  1WJ4 A;  4II3 B;  3PTF C;  3K9P B;  1S1Q B;  3PPA A;  1NI2 A;  3M62 B;  3QCA A;  3D32 A;  5D6J B;  4BOS C;  4HVB A;  4BBN C;  2JVC A;  3RCZ A;  2GBK A;  2LVO A;  2L05 A;  2LWP A;  2UWQ A;  3MJW A;  2KD0 A;  4LDT B;  2YLM A;  1SE9 A;  3DBH I;  4B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...