1V9JA

Solution structure of a bola-like protein from mus musculus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
113
Chain Sequence
MKGSSHHHHHHSSGASLVPRGSEGAATMELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELPHIHAFEQKTLTPEQWTRQRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA-like protein RIKEN cDNA 1110025L05
publication title Solution structure of a BolA-like protein from Mus musculus
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 18
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v9jA00
2MA9B 3CSTA 3AULA 3DVNV 2WYQA 4URKA 2MW5A 4DBGA 4BBNF 1WE6A 3APCA 1IYFA 2JXXA 2EKEC 3VUYA 3TCAA 2KZRA 3VTUA 3N32A 2LXCA 4K7WA 2KOXA 3T9LA 4DHJD 3IBEA 3RT3B 3DPDA 2XK5A 2JRIB 4W9EA 3T8MA 3I3TB 1TZ1A 2MRPA 2MBOA 2FCSA 4RM8A 3IVFA 2IO2B 2L05A 2KQ7A 2A4ZA 2DYMA 3PZDA 4HPMB 4MH0E 2M17A 3PS6A 2K6DB 3VVWB 4G3XB 1YJ1A 1QZEA 3QC8B 4FN2A 3QCAA 3DBRI 4MSMB 3JSVB 4II3B 4TQ1A 4WJQA 5DPTA 3M95A 3UQBA 5J17A 2G45B 3KYCD 1KOTA 3PT2B 2ZPYA 2GBNA 3JYUA 4FULA 2ZPNA 3A33B 3AU4A 5G2NA 2DZMA 1WI0A 4WJPA 1KJTA 2KX3A 3WAPA 2MWSB 2MQJA 4HVBA 2NR2A 3K9OB 4BFRA 3EECA 4K7UA 3QIJA 4NJ6A 2DX5B 5JHBA 2NBUA 3WIMA 4B95A 1YQBA 3NZSA 4PS8A 1XT9B 2MX2A 2WX1A 2M0XA 3MHSD 4HLEA 3KUZA 1TBEA 4GGQA 2EMSA 1OQYA 2FCNA 3RYTA 4FA6A 2K25A 2KLCA 2YVCA 3QHTA 4HDQA 1R4MI 2V4LA 2W9NA 4MGKE 5DPSA 4K1RB 1IP9A 1WGDA 1WRDB 2PPHA 4HPLB 1E90A 1WIAA 1EO6A 1XD3B 1Z5SB 2AEHA 1Q1OA 3PHXB 3PV1A 4HCPB 4YL8A 4IWQA 5FR6A 2O2VB 2V3SA 1E8YA 2KK8A 5JH5C 4W9FA 2KTRB 4MELA 4WWNA 2N9EB 1UD7A 2Z0EB 1GC7A 1YX5B 3ML8A 3SD5A 5AZFA 3V61A 1C1YB 3KUCB 3UQAA 3HIZA 4NAWA 1UELA 4W9JA 3NOBA 2LVQA 2JT4B 3TBLD 3R66C 4AP4C 2CHZA 1RLFA 1UBIA 3B0AA 2O6VB 4ZYNA 1A5RA 4KIKA 3H7PB 1UGMA 4W9CA 2IYDB 2IO1B 3A9KA 3EFUA 4LDTD 2CHXA 2CKHB 3NY5A 4XZ4A 2LUEA 1WMHB 1WXSA 4EEWA 1XQQA 3TMPB 3ZNGC 4BKSA 3UIOB 2OJRA 2LXAA 4BKSD 1UH6A 1EUVB 3NS8A 1WZ0A 2IO3B 1P3QU 3RULA 2KFKA 3APFA 1YIWA 4KZ0A 2BKFA 2K6QA 2KWUB 3RZFA 1V9JA 2D07B 4GB9A 5C23A 1TTNA 5D7GA 4GOCA 2IBIB 4IWPA 4CHKA 5L83A 1WR1A 2LWPA 2N1WA 2MBHA 2Z59B 2R2QA 5G55A 1C3TA 4IM3A 3CSFA 4E74A 1EF5A 3OJ4B 2PE6B 4KDLB 3PPAA 4PYUA 3WAMA 4TKNA 1E5WA 3DOWA 4B9KA 3TJPA 4XC2A 4AJWA 1T0YA 2JZZA 4M8NA 1ZGUB 2GBMA 3ENEA 1MG8A 5D94A 2GBRA 3R7RA 3V6EB 1V2YA 4W9DA 1ZW7A 2KWCA 2ZNVB 2ZVNA 1WY8A 4HCNB 3ZO5B 2QHOA 4GDKB 4A3PA 1J0GA 2XBBC 4ICUA 4E3CA 1WJNA 2KO3A 4MDKE 5DPRA 1F9JA 3DCGA 2NBVB 1I35A 4LCDE 3U8ZA 1TGZB 2JF5A 3RD2A 1D3ZA 2JPHA 2C5LC 3R3MA 2NVUI 5JHAA 2LGXA 1Q0WB 3ZLZA 2KNBA 4K81A 4FHJA 4P7IA 3QWZB 4BVUC 4MJSA 3AI5A 2MLBA 3JSVA 4X57B 5AEKB 2J7QB 5CHVC 2LZ6A 3RZWC 3KH0A 2FCMA 2J0JA 5L95C 1J19A 3ALBA 2AYOB 1P9DU 2G4DB 2LGYA 3IFWB 4PS3A 4W9KA 4LJPB 3L17A 4FJVB 4DHZB 2C60A 2FNJB 4N9F4 3ZIMA 1K8RB 4MSQB 4E71A 1R4NI 1IPGA 1OEYJ 3L13A 2KTFA 3NZUA 1Q5WB 2VRRB 2PE9A 2XEWA 2KJRA 2KN5A 3EHVA 5D6JB 3LDZE 4WQOB 2C7NB 3UIPB 1PQSA 3V6CB 5KHQA 1WJ6A 4I6NB 1NBFC 2Y5BB 2LVPA 1LFDA 2CHWA 4MEMA 3VAWA 2J0KA 2KDFB 1E8WA 1WX8A 2N4FA 3HM6X 1V49A 3ZRFA 2I1JA 2XK5B 5IAAC 2Z0DB 2BWES 2GBJA 4FBJB 2ZNVC 2L3ZA 3NHEB 2YLMA 3X0WA 1V6EA 2L0TA 3QJZA 3ZNHB 2IY1B 3B08A 3KW5B 4NNJB 2ZVOA 2CS4A 2KTRA 4BOSC 2N7DA 4IWOA 2D3GA 3AU5A 1E7UA 3ML9A 4HJKA 3VTWA 4GIVA 2LD9A 4DDID 1S3SG 4W9IA 3SU8X 2KC2A 4A3OA 1WX9A 4NQKE 4G0NB 1WYWB 1LXDA 2KX0A 4JQWC 3W1YA 4ANUA 2NPTA 3PGEA 4M8MA 4GU2A 2DZKA 4EZJA 5BO4B 2D10A 1EF1A 2K39A 4A20A 1J8CA 1WFYA 1WMHA 2LVOA 4AUQC 3A9JA 3R7QA 4GDLB 3PHWB 4JLCA 2RGFA 3ZKJC 4ANWA 3O65B 4CYEA 2DZIA 4ASWC 2M8SA 1ISNA 4XX5A 1YX6B 3ONSA 4ANXA 2BF8B 1CMXB 2KHWB 4HK2A 2DYBA 2JUOA 3H1UA 4NJ7A 3V60A 1U4AA 5IA7A 2M4NA 2J0MA 1WE7A 5DPWA 1OGWA 2N9PC 3Q3FA 4DXAB 1OTRB 2DAJA 2K1FA 1FXTB 2LASA 2GMIC 2NBWB 1JRUA 2BWFA 2KXJA 1WGRA 1WXVA 2LJ5A 3A1QA 3VHTC 3WAOA 4DDGD 3MTNB 1KLVA 4EOYA 4MGZE 4IG7B 2A5UA 3M62B 5KHOA 1WX7A 1V86A 1LQBA 3RCZA 2MBQA 3QA8A 3PRZA 1GNUA 1P0RA 3CF6E 4KDIC 4NAWB 2DZJA 1G6JA 4PYZA 4GSWA 3MJWA 2MP2B 3HK0A 1WR6E 2RPQA 4GXBA 2LGDA 2R2OA 4KIKB 1L2NA 2V1YA 3ZNZB 3A9KB 4LDTB 3W1SC 5AZGA 4AOFA 3QK0A 4KZCA 3ZUNA 3M63B 2RD0A 3U30A 1KM7A 3ECIA 1HE8A 1Y8RC 4BOZB 2MBBB 3ZTCA 1WXMA 2KANA 4F7ZA 4W9LA 1RFAA 2N1VA 3C0RB 3JVZX 5CTRC 1L7YA 2KMAA 4NQLB 3PSEB 1S1QB 3GZNI 2KDEB 4F8CB 2WWZA 2MBEA 5LLIA 2KFKB 2C7MB 2IZVB 3P2BA 3TIXA 3OJ3A 2KFJA 3ZDMC 2G3QB 4ANVA 1E7VA 2IO0B 4OVUA 2DAFA 3VUWA 2ZJDA 3DDCB 4DHZE 3ZNID 3SDLC 3H7SA 1V5OA 3UINB 2KDIA 2GBKA 3DVNU 1SIFA 4G11A 4ZRIA 4WWOA 1H4RA 2K8HA 2UYZB 4JIOU 2M1MA 2KC1A 4GN1A 4AJYB 1WM3A 3WANA 1NDDA 2BPSA 3BINA 3L0WB 4WWPA 2L7RA 5J18A 3PLUA 1ZKHA 4RMAA 1WH3A 3JW0X 2PEAA 4MGIE 3H6NA 2L76A 5CHWA 5CHFA 5EDSA 4EUTA 3DBHI 2KVRA 4TUUA 4EZKA 4EFOA 2KWVB 2AL3A 4FJZA 2LI5A 1WJUA 3ZVVA 4LJOB 3A4SC 1I42A 1SGHA 4I6LB 4KSKC 3ZW3A 3EC8A 2CU1A 1SE9A 2WX0A 4ZRJA 2UWQA 1GG3A 3V62A 1VCBA 4IUMB 2JZ3B 3PLVA 1P1AA 4HXDA 4KV2A 5AZHA 2ASQA 4B6WA 4DHJB 2MSED 3OAWA 4IC7B 2O2VA 4MJSB 2C9WB 3W1SA 4OVVA 1WZ3A 2C7HA 3Q3JA 1WM2A 3DBSA 1P98A 1VD2A 2K8BA 5C1ZA 5J2RA 2B3AA 2KKCA 3GOEA 4IM0A 3DVGX 2KMCA 2JY6A 2GOWA 1OEYA 1GUAB 2ZCCA 3U7DA 3QX1A 1BT0A 5CX3A 1WGHA 2MCNB 2L00B 1UZXB 2WDTB 4FLHA 4II2B 3N3KB 4BBNC 4HDOA 4TQ0A 2BYVE 4FJYA 4W9GA 4BKGA 2HJ8A 2ZCBA 3KVFB 3L10B 3LJ3A 4GDLA 2ZZPB 3A4RA 1H8CA 1WF9A 2O6VA 3M3JA 2O6VD 2JRHA 3H7PA 2LRUA 2HE7A 3VFKA 1GJZA 4AWJA 1Z2MA 1M94A 1WXAA 2N9XA 1WGGA 2I1KA 2KDBA 4K7SA 1WJ4A 2DYOA 3ZDTA 4CO7A 2IY0B 2D11A 4EKUA 4JL9A 3CMMB 2RSUA 1X1MA 1UBQA 2KJ6A 1RRBA 3KYDD 2CR5A 2JWZA 3N30A 3QARA 4M0WB 3QQ8B 2BYFA 4ZDVA 2AWTA 4BKTA 4DK5A 2ZEQA 3DBLI 2KJHB 2FUHB 4F1SA 2BYEA 1E8ZA 2OOBB 3DVGY 4FADA 4J6IA 1V80A 2DENB 5E6OA 5HKHA 3APDA 2EMTA 3HHMA 3QAQA 5E6NA 3X23A 4ICVA 4I6PA 3S2AA 2N7EA 2MP2A 2BGFA 3D32A 3OLMD 3PTFC 4RM9A 3VH4B 2NPTB 1YD8U 5DCNA 3UGBB 1NI2A 5JZEB 4HWIB 4NY0A 3K9PB 5GMVA 2RR9A 3A9JB 3L08A 3SHQA 4PS7A 1RAXA 2BKRB 4WJNA 2AL6A 4W9HA 1AARA 4GDKA 4IM2A 3WA0A 3ZRCA 2HTHA 2NCNA 5D2MB 4EZLA 2G4SA 3VDZA 3L54A 3BY4B 3VTVA 2KLGA 3KUDB 2L0FA 3H9DA 3UF8A 3IG3A 3PRMB 4WJOA 3PRPB 2JVCA 2REXA 1V81A 4JGHB 4WAAA 5TR5A 3VQIA 2K8CA 3PVLA 3TL5A 4IW0A 3VUXA 4TV3A 5LXHA 4MM3A 3VXWA 3A1QB 4G50A 3DQVA 4KSLC 1LM8B 1WGYA 2KD0A 4MGYE 3ZTDA 3B1LX 2LRWA 5LXIB 3PREA 3RUIB 3L16A 4KVGB 2FIFA 4GMVA 1E8XA 3WALA 4ZRKA 3VH3B 5E6PA 1GC6A 2FAZA 2PJHA 4NPNA 2NS5A 3AXCA 4FHKA 2L8JA 2KQSA 4DWFA 3HM3A 1V5TA 2DHZA 2HD5B 2FIDA 2FCQA 3IHPC 2D2QA
chains in the Genus database with same CATH superfamily
3AULA 3DVNV 3AE1B 1WE6A 3TSSA 3AECB 5MPOA 3IBEA 1SJED 2XK5A 2MBOA 2FCSA 4RM8A 3FILB 2L05A 3PS6A 4LNKA 1PGXA 2W55A 2Y3AA 1ROEA 4MSMB 4N6EB 1QLBB 1ZUD2 2LEKA 4TQ1A 3L4PA 4WAFA 1IGDA 4JX1C 3SFDB 3KWLA 4WJPA 1EU4A 1JRPA 4BFRA 2L83A 3U52E 3T3NA 3EECA 4K7UA 2AQ3B 1JROA 3KUZA 2JU6X 2FCNA 4M0WA 2BB6A 4KKIA 2K25A 2KLCA 2YVCA 3GB1A 1R4MI 4HPLB 1WIAA 1XXGA 1EO6A 4IWQA 1DOYA 3MC8A 2X8XX 1E8YA 1UGJA 2WXLA 2J4XA 3AEFB 1ENFA 4ZHPA 1TKGA 3N9YC 5AZFA 5BMIA 1YQ3B 4DXFA 2BT6A 3UQAA 3HIZA 4ITKA 5GXGB 4RGTA 3VRBB 2WS3B 1GAQB 4MH8A 1I4RA 2WXPA 3UI3A 3R66C 1UBIA 2O6VB 3H7PB 4W9CA 2IYDB 2CHXA 2CKHB 2JYEA 1KLGD 3NY5A 1FXAA 1EU3A 2H89B 4AS1A 1E7PB 1I4HA 1XQQA 3FC4A 5IP4D 1SXTA 3ZQ4A 1UH6A 1KH0A 4YSZB 1P3QU 4M01A 2KWUB 2D07B 5TSSA 4GOCA 3U2SC 4CHKA 2MBHA 3BYTB 3CSFA 4NAMA 2LFIA 3DOWA 2KACA 4B9KA 3TJPA 1ACCA 4W9DA 2KWCA 1V1PB 4LNFA 3R2IA 2INCC 1WJNA 5DPRA 1I35A 2NBVB 3P4PB 1D3ZA 3RD2A 2JF5A 2JPHA 4BAXA 4WQMA 1Q0WB 4HKZE 4MM3B 3QWZB 4BVUC 2J52A 4MJSA 1OFFA 5AEKB 3I9V1 2J7QB 2ACZB 1TY2A 1R7SA 3W2DA 1GB4A 2AYOB 2G4DB 4W9KA 4ZHOA 3MC0B 3Q8AA 4RF1A 2M56B 3L13A 2DWQA 3NZUA 1MG4A 1Q5WB 4US9A 5D6JB 2N0SB 1YN5A 1SE3A 2LVPA 2KMMA 1E8WA 2EELA 3ZRFA 2Z0DB 4YSYB 2BWES 2ZNVC 1XCTL 3ZNHB 4BOSC 2N7DA 4IWOA 1STEA 3AU5A 2JX5A 1BXTA 1S3SG 4ZYSA 2KC2A 2KDMA 3DBHB 1GOZA 1LXDA 1I4QA 2KX0A 1C76A 3BVGA 4ANUA 3PGEA 2D3AA 4EZJA 3Q3NC 1EF1A 1WMHA 2LVOA 4AUQC 2E6XA 2DNFA 2RGFA 2WP9B 3PZ8A 4CYEA 4ASWC 1GB1A 2PMVA 3NJTA 1CMXB 2KHWB 2W54A 4NJ7A 1U4AA 2J0MA 1M4VA 4JWSC 3Q3FA 1OGWA 2N9PC 2WXMA 2LASA 5EE1A 2GMIC 1F2RI 3R8BA 1WGRA 1WXVA 3A1QA 3WAOA 3ZGZA 2KAJA 4MGZE 3N1XC 3M62B 1WX7A 1V86A 3PRZA 3AE4B 4XGAB 1I4GA 4D2KA 4GXBA 2LGDA 2R2OA 1KLUD 1L2NA 3ZNZB 3QK0A 4KZCA 2LUMA 2L1AA 4TSSA 1KTKA 1VZ6A 1HE8A 1Y8RC 4BOZB 2WGSA 3ZTCA 3AV8A 1WXMA 4F7ZA 5D7GA 3DBLB 4F8CB 3PSEB 3GZNI 2KDEB 2WWZA 2MBEA 2KFKB 3OJ3A 4ANVA 2IO0B 4OVUA 1FO4A 3E56A 3H7SA 3DVNU 4JIOU 1WM3A 3WANA 4HRSA 4WWPA 1HZ5A 3NVWA 1ZKHA 4RMAA 2K0PA 2PEAA 3P1MA 3H6NA 2L76A 5JXVA 5CHFA 4EUTA 2KVRA 2VZKD 3NS1A 3R2TA 2KWVB 1UWMA 4EFOA 3N20C 4HJGE 3ZVVA 1SGHA 3N1ZC 4KSKC 3E9SA 5FKAC 4ZRJA 1ZPSA 1RFKA 3V62A 3V05A 5AZHA 5BMGA 2TSSA 1JALA 3OAWA 2C9WB 4OVVA 1WZ3A 3Q3JA 1P98A 5C1ZA 5J2RA 2KKCA 4IM0A 2GOWA 1OEYA 1GUAB 2ZCCA 3QX1A 1BT0A 1D5XC 2MCNB 1SEBD 2VH1A 1RWSA 5LNK1 1DOIA 3N3KB 4YSXB 4FJYA 1T0QC 4C00A 3L10B 1H8CA 2YEPB 1SE4A 3P4SB 1M94A 1WGGA 2I1KA 2KDBA 2G1EA 3ZDTA 2D11A 4JL9A 3EUB2 1FCCC 2KJ6A 1RRBA 2JWZA 3QARA 1FCLA 2AWTA 4BKTA 4A90A 2BYEA 1E8ZA 4J6IA 1V80A 4OW0A 2OEDA 2MP2A 4YXDB 3RNGC 2BGFA 5T8IA 1DOXA 3BVZA 3OLMD 3PTFC 1FD6A 1IGCA 4NY0A 2RR9A 3A9JB 2XNAC 3L08A 1RAXA 2WU2B 1MJDA 4W9HA 4GDKA 3AEAB 4M02A 1C4AA 3VDZA 1DGJA 3H9DA 2CJNA 4JGHB 2IPKD 4WAAA 5TR5A 3VUXA 4IW0A 3VXWA 1LM8B 1WGYA 4MGYE 2LRWA 1HTOA 2WDRB 5LXIB 4A55A 1PYWD 4LNIA 1QOGA 4GMVA 1E8XA 3SR6A 4A6QA 2DHZA 1TKYA 2HD5B 1FFVA 3IHPC 2D2QA 1JQ4A 3CSTA 5H8YE 1OQRA 2X38A 1L5PA 1N61A 3TCAA 3RFZB 3C19A 4DHJD 3RT3B 3DPDA 2JRIB 3T8MA 1TZ1A 2MJDA 2IO2B 2IJ0A 2KQ7A 2M17A 2Z8LA 2K6DB 3VVWB 4G3XB 2PTLA 2J53A 3QC8B 3JSVB 4II3B 1YMHE 2G45B 3KYCD 3PT2B 2ZPYA 4FULA 2V0GA 1JWSD 5G5HA 1MHXA 1KJTA 2VZKB 2MWSB 1C4PA 3ZXVA 2K22A 2HJ1A 5JHBA 3Q8CA 2NBUA 3WIMA 4B95A 5IKCM 1XT9B 3MHSD 2M0XA 4GGQA 1YOVB 3QHTA 4K3CA 4MGKE 1WRDB 4F1SA 1GPXA 3PHXB 3TEZA 2O2VB 1YJIA 2D5GA 5JH5C 1JWUD 4MELA 1GC7A 3SD5A 1C1YB 3KUCB 1C77A 3IT6B 4NAWA 1UELA 4W9JA 2CHZA 1RLFA 1XLNA 4JPSA 4ZYNA 4GLSC 1A5RA 4KIKA 1JWAD 4LDTD 4RF0A 3AM9A 4XZ4A 2PIAA 3TMPB 2WLBA 4C80A 3DHIC 3UIOB 4S17A 2MHJA 3AE2B 2ZW0A 5HHDG 2K6QA 3RZFA 1V9JA 2WQYB 5EE3A 4IWPA 2IBIB 1E10A 2N1WA 2Z59B 3RNAC 1C3TA 4IM3A 1EF5A 4KDLB 1TIFA 3PPAA 3WAMA 5E6JA 4TKNA 1E5WA 4AJWA 4M8NA 2QMTA 2WXGA 1V2YA 3AH7A 1SB3C 2IGHA 2L32A 1WY8A 4REZA 2QHOA 4MT5A 2KO3A 1F9JA 4LCDE 1QKZA 3R3MA 5JHAA 1MVKA 4C7YA 4JE3B 4P7IA 4O1NA 3P4RB 2N9KA 2MH7A 3KH0A 2J0JA 4US8A 2NTTA 4WURA 1AN8A 1P9DU 4PS3A 4FJVB 4DHZB 1V97A 2LGIA 4HPPA 2C60A 1K8RB 5I4DA 4MSQB 4E71A 1D4BA 1R4NI 3B9JA 1HZ6A 2XEWA 3GZNB 2KN5A 4UDUC 3LDZE 4WQOB 3UIPB 3V6CB 5HG2A 3O13A 1L6VA 4ACFA 1WWTA 3VAWA 3Q8BA 2J0KA 1WX8A 1WSPA 4NJCA 3I57A 2I1JA 3Q8FA 2XK5B 3P63A 3AE6B 2YLMA 3URYA 1JMLA 3B08A 3KW5B 4NNJB 1FNUA 2CS4A 3KQ4A 3BZDB 2K9XA 3VTWA 2LD9A 4W9IA 3SU8X 1WX9A 4A9AA 4NQKE 4G0NB 2NPTA 1SBBB 4M8MA 2DZKA 3MFGA 1J8CA 2Y5PA 3KLSX 3R7QA 1Q10A 4JLCA 1FEHA 4P6VF 3I5JC 2M8SA 4XX5A 3WCQA 1YX6B 4ANXA 4HK2A 2JUOA 1WE7A 1WYGA 3IXSA 2K1FA 1I7HA 2LJ5A 3MHZA 1KLVA 4IKGA 2A5UA 5KHOA 1LQBA 4KDIC 2DZJA 1FMAD 1CK1A 4PYZA 2IDYA 2WU5B 4LDTB 4AOFA 3M63B 4RGMA 3U30A 1T6BX 1KM7A 1TS3A 3ECIA 4XE0A 2BW2A 2MBBB 4P1CC 4W9LA 3I63C 5CTRC 2KMAA 2Q5WD 1TS2A 1D6EC 1TY0A 2KFJA 1E7VA 1NENB 3OG5A 2WXIA 2ZJDA 3Q8EA 3DDCB 2AQ1B 3ZNID 3SDLC 3MJ5A 1H4RA 4AJYB 2I2YA 1BUIC 2B76B 3BINA 2L7RA 1J7BA 2WHIA 3JW0X 1BMLC 4MGIE 2MJEA 4LNNA 5IOIA 2QIEB 2I38A 4LK0M 2W3SA 4FJZA 3NZ3A 2BBCA 2KYWA 4I6LB 2EKIA 2CU1A 1SE9A 3ZYYX 2H88B 4IUMB 3MC9A 1XLQA 4HXDA 2K3UA 4B6WA 4S0RA 4MJSB 4IC7B 1VD2A 2B3AA 2KMCA 3U7DA 1HXYD 4L1BA 1MPEA 1XLOA 2GRIA 2WDTB 1QOFA 4WIPA 2BYVE 4W9GA 3A4RA 3B2GA 3GE8C 3M3JA 2ZW1A 1GJZA 1F77A 1Z2MA 1ZDXA 4K7SA 1WJ4A 2DYOA 2QEJC 3CMMB 3DHGC 2RSUA 1UBQA 3QQ8B 2PLPA 4ARCA 4DK5A 2ZEQA 2ON8A 2KJHB 3BK1A 1I4PA 1L0YB 5E6OA 1P7EA 3HHMA 3X23A 2INNE 1XLPA 3S2AA 1N6ZA 3EGRA 1HEZE 1YD8U 3AE7B 1NI2A 1ET6A 2LHEA 4IM2A 2HTHA 1ZDVA 2JWUA 2RPVA 4KGSA 4MACA 3RMKC 2G4SA 3L54A 1T0SC 2XN9C 3KUDB 2REXA 3BVMA 1C4CA 4ZRPA 3TL5A 4TV3A 1C78A 3A1QB 4G50A 1L6UA 5BYRA 2INDC 4IOIE 2BTEA 3B1LX 4DXGA 3PREA 5BYSA 3AMZA 2FBWB 3L16A 4KVGB 3H8HA 3HVDA 1FRDA 1LGRA 1T3QA 3WALA 1MHHE 5E6PA 1GC6A 4NPNA 4FHKA 1ZXIA 2KQSA 4DWFA 4ICUA 2MA9B 4AQ7A 1J7AA 1PUTA 2MW5A 4BBNF 1WGKA 2EKEC 3VUYA 2KZRA 4K7WA 2KOXA 4C4VA 1OQQA 4W9EA 2DYMA 1UWXA 3AEGB 2CJOA 4XDCA 1KF6B 1YJ1A 3QCAA 1K50A 3UQBA 2N7JA 1ZE3D 3LXFA 4LLGM 1KOTA 3JYUA 1WI0A 2QDFA 3C8YA 2KX3A 4HVBA 2MQJA 2NR2A 1T5XD 2DX5B 1YQBA 4XDDA 4HLEA 1C9FA 1TBEA 1L4ZB 1OQYA 3RYTA 1WXQA 2LHDA 4HDQA 2W9NA 1IP9A 1VJKA 1AWDA 2PPHA 1E90A 5DCNA 1XD3B 4HCPB 1Z5SB 2AEHA 1Q1OA 4YL8A 3PV1A 1IBXA 4DQOC 2KK8A 2KTRB 2YEPF 1UD7A 1T0RC 1YX5B 2Z0EB 3N1YC 3ML8A 1RYJA 4A8XC 1R4NB 2BB5A 2N9LA 4HKQA 2BS4B 3TBLD 4PT5A 5FR3A 2BVCA 4OVZA 1EM7A 3A9KA 3EFUA 2BS3B 1WXSA 4R3DA 4EEWA 3V3XA 3ZNGC 4BKSA 5EE0A 2LXAA 1EUVB 3NS8A 1WZ0A 2IO3B 3APFA 2J42A 4KZ0A 2BKFA 5C23A 1TTNA 1WR1A 3TEWA 2R2QA 5G55A 1E0ZA 3T3OA 2VH2A 4E74A 2PE6B 5H92C 1B9RA 2G9HD 4XC2A 2JZZA 2GBMA 3ENEA 1MG8A 4RCOA 3FKYA 1ZW7A 2ZNVB 4HCNB 3ZO5B 1J0GA 4GDKB 4E3CA 4MDKE 4P1BC 3U8ZA 2WXKA 2C5LC 2NVUI 4EE2A 2LGXA 3ZLZA 1QQRA 3NRZA 4FHJA 3SFEB 5EE9A 2WXRA 3U7ZA 2HTME 3AI5A 2MLBA 3JSVA 4X57B 2JZPA 2LZ6A 2FCMA 3NVZA 2LGYA 3IFWB 3HUIA 3L17A 3DWMA 2FNJB 4N9F4 3RPFC 1TJEA 4OZBA 3ZIMA 1HTQA 2K5PA 1IPGA 2KTFA 1FIQA 2KQ4X 2VRRB 3EHVA 1WJ6A 2KT7A 4YWGG 4TMAB 1NBFC 4OHJA 4MEMA 2KDFB 3HM6X 4RNAA 1V49A 3TEXA 1V1OA 3X0WA 2L0TA 3AE9B 2ZVOA 2KN4A 3P42A 3AB5A 4HJKA 1CQVA 5AUIA 4DDID 3TUOA 3VRAB 1ZOYB 1RM6C 2PKOA 1WYWB 2SEBD 4FXCA 3W1YA 3Q14C 3J9CA 4GU2A 5BO4B 2D10A 2K39A 4A20A 2M0AA 2LMCA 4GDLB 3ZKJC 3OWEB 3O65B 2DZIA 2IGGA 2DYBA 3H1UA 1FRRA 5IA7A 2M4NA 2BQQA 4DXAB 1OTRB 2DAJA 2LJIA 1FXTB 1JRUA 2KXJA 4DDGD 3VHTC 3MTNB 4EOYA 3IT4B 1AW7A 4N58A 1FNWA 3RCZA 2MBQA 1TYGB 3QA8A 2D3CA 1P0RA 3CF6E 4NAWB 4RH6A 1G6JA 1QF6A 4GSWA 2JXTA 4XWWA 4KIKB 1TS4A 1FPYA 2KWDA 1NI3A 3ZUNA 2MEKA 2RD0A 1YN4A 2Y5CA 2KANA 3JVZX 1N60A 4NQLB 2QCZA 2INPE 5LLIA 1Y56A 2C7MB 2IZVB 3TIXA 2DAFA 3FILA 3VUWA 1KFYB 4DHZE 1V5OA 2KDIA 2GBKA 1SIFA 4WWOA 2K8HA 2UYZB 2M1MA 4GN1A 1MI0A 4YTPB 3Q3MC 2BPSA 3RI7C 1FM0D 1UNSA 5J18A 5D3IB 1WH3A 1EWCA 5CHWA 1PGAA 1V8CA 1K51A 2JSVX 1VZ8A 2V4IB 2HDEA 2WXJA 4LJOB 1I42A 3IAM1 3ZW3A 3EC8A 2WX0A 4HROA 1GG3A 2LGSA 1VCBA 4KV2A 2DBYA 3B2FA 3AEBB 4DHJB 1ZP0B 2MSED 4L2YA 3W1SA 2C7HA 1WM2A 3DBSA 2K8BA 3DVGX 1SIJA 1UZXB 5BMHA 2JYTA 4FLHA 4IDIA 4BBNC 4BKGA 2HJ8A 3IAS1 3LJ3A 1K53A 1WF9A 2O6VA 2WDVB 3H7PA 2LRUA 2HE7A 3BIID 3KWVA 4AWJA 2N9XA 4CO7A 4EKUA 4BZAA 1K52A 4WWMA 1CJEA 1X1MA 3KYDD 3FAHA 1I4XA 1SJHD 4M0WB 2FUHB 1NVID 3LB8C 3DVGY 3RNEC 5HKHA 3APDA 1F0ZA 4ICVA 4I6PA 4C7ZA 3AE3B 4ZRQA 2N7EA 3D32A 4YTMB 3VH4B 2NPTB 3UGBB 4ARIA 1DYQA 1F52A 5JZEB 4HWIB 1SE2A 3K9PB 2NMQA 2IGDA 3SHQA 4PS7A 2AL6A 1V1PA 1AARA 3ETRA 4B0MA 1L0XB 1KRHA 5D2MB 3TEYA 3AN1A 4QAYA 2L0FA 3UF8A 3IG3A 4WJOA 1VRAB 1XEEA 2JVCA 3PRPB 2QSDA 3PVLA 1TT5B 5LXHA 4MM3A 4J3OD 1SSNA 2RMMA 3GE3C 1VR9A 3RUIB 5D3DA 1JW9D 4KKJA 2FUG1 3RNCC 3AE5B 3VH3B 2PJHA 2L8JA 3HM3A 2PVOD 2AX5A 3ABVB 2PW9A 4URKA 2WYQA 3BK2A 4DBGA 2RDGA 3APCA 1IYFA 2JXXA 3VTUA 3N32A 2LXCA 3T9LA 1NYRA 3I3TB 2MRPA 3IVFA 2A4ZA 1C79A 3PZDA 4HPMB 4MH0E 1ET9A 4WH4A 3ZXRA 1QZEA 4FN2A 3DBRI 3RNBC 5DPTA 4WJQA 3M95A 1E6EB 5J17A 1FFUA 3SEBA 2GBNA 2ZPNA 2JQRB 3A33B 3AU4A 5G2NA 2DZMA 1YJJA 1VLBA 3WAPA 3K9OB 3AEDB 3QIJA 4NJ6A 1SF0A 2QILA 3NZSA 4PS8A 3ZJUA 2MX2A 4USAA 2WX1A 2KVZA 2EMSA 2UU7A 4FA6A 4JWUC 2V4LA 5DPSA 4K1RB 1WGDA 2ONQA 5FR6A 2DLBA 1YNTE 2V3SA 1F1HA 4W9FA 3DWGC 4WWNA 1XO3A 2N9EB 4KX6B 5HI1A 2V9HA 3V61A 3HRDD 3NOBA 2WXQA 2LVQA 2JT4B 3BWUD 4AP4C 3B0AA 2RDHA 1UGMA 3GS2A 2IO1B 1UUPA 1ZXHA 1TKEA 2LUEA 1WMHB 2WXOA 1P7FA 4K3BA 2OJRA 3NG0A 4BKSD 4B0EA 3RULA 2M19A 2KFKA 1YIWA 1VZ7A 2D3BA 2RDBC 4GB9A 3Q69A 5L83A 4P16A 2LWPA 2PVGC 1YQ4B 3OJ4B 4PYUA 5G5GA 2WDQB 1MFWA 1JWMD 1T0YA 3R7RA 1ZGUB 5D94A 3V6EB 2GBRA 1UF0A 2ZVNA 1CZPA 4A3PA 2XBBC 3DCGA 4OZAA 2W82A 1TGZB 4Q2JA 4KGRA 2KNBA 3W5UB 1D5MC 4K81A 2V3PA 3RN9C 1HA5A 1VDVA 4NZLB 5C3JB 5CHVC 2WXHA 3RZWC 5L95C 1J19A 3ALBA 3NVYA 1PDXA 2OJWA 1B1ZA 4LJPB 3RNFC 2WNMA 2QJLA 1OEYJ 2PE9A 2GLSA 2KJRA 2C7NB 1PQSA 5KHQA 4I6NB 2Y5BB 1LFDA 2CHWA 2N4FA 1D5ZC 5IAAC 4C4VB 2GBJA 4FBJB 2L3ZA 3NHEB 1V6EA 3QJZA 2IY1B 4OZCA 3VR8B 2KTRA 2D3GA 1E7UA 3ML9A 2CU3A 1YN3A 4GIVA 1IUEA 1F2RC 4A3OA 2V3NA 4YT0B 4JQWC 4HEA1 5IN7A 4PK1A 4CQNA 1N5XA 1WFYA 3U4EG 3A9JA 2AQ2B 3PHWB 4H2AA 1A70A 4ANWA 1ISNA 4XYCA 3ONSA 1N5WA 2BF8B 2WXFA 4RFBA 3V60A 5DPWA 3NVVA 1IBXB 2NBWB 2BWFA 4N59A 2BYTA 3ZJTA 4IG7B 1HQRD 1J7CA 1GNUA 1LO5D 1FNVA 1E9MA 1L0VB 3MJWA 2MP2B 2ICIA 3HK0A 3Q6BA 1WR6E 2RPQA 3MP9A 1R4MB 2V1YA 3A9KB 5FK9C 3W1SC 5AZGA 1NEKB 1N62A 1XF5L 2OHFA 2MJ3A 1RFAA 2N1VA 3C0RB 1L7YA 2E3TA 1S1QB 3PZ7A 3VR9B 1NYQA 3P2BA 3ZDMC 5HFYA 2G3QB 1AYFA 3UINB 4G11A 4L23A 4ZRIA 4RGNA 1WRIA 2KC1A 1TS5A 1NDDA 2NTSA 3L0WB 4LTUA 3PLUA 1JWBD 4ZOHC 5EDSA 3Q2AC 3DBHI 1FXIA 4TUUA 4EZKA 3HVZA 2R61A 1QOAA 2AL3A 3Q3OC 2LI5A 1PFDA 3EA6A 1WJUA 1L4DB 3A4SC 3PO0A 2QC8A 1XCQL 2UWQA 3ZJVA 2WXNA 2JZ3B 3PLVA 1P1AA 3DHHC 4LNOA 2ASQA 2O2VA 3BYYB 1PGBA 3GOEA 2JY6A 5CX3A 1WGHA 4XWTA 2FE8A 2L00B 4M00A 4II2B 2BS2B 4HDOA 4TQ0A 4C56C 2ZCBA 3KVFB 4GDLA 2ZZPB 4YTNB 2SAKA 2O6VD 2JRHA 3VFKA 1WXAA 3EFCA 2IY0B 1ESFA 2CR5A 3N30A 2L52A 2BYFA 4ZDVA 3DBRB 3DBLI 1QILA 5C2TB 4FADA 2OOBB 2DENB 5BYQA 3GP7A 2EMTA 3QAQA 5E6NA 3W5VB 2GB1A 1JCKB 4RM9A 1EWYC 1N63A 5GMVA 3P4QB 2BKRB 4WJNA 3ZRCA 5AUKA 3WA0A 1QT9A 2NCNA 3CWIA 4EZLA 3CIRB 3BY4B 3VTVA 2KLGA 5IO9A 3PRMB 1TZOA 1V81A 3VQIA 2K8CA 3DQVA 4KSLC 2KD0A 3ZTDA 3NUHB 3LYYA 2W3RA 4KGTA 3AEEB 2FIFA 4ZRKA 2FAZA 2NS5A 3AXCA 2GI9A 1QOBA 3W9CB 1V5TA 4RGOS 2FIDA 2FCQA 3AE8B
chains in the Genus database with same CATH topology
2MA9B 3CSTA 3AULA 3DVNV 2WYQA 4URKA 2MW5A 4DBGA 4BBNF 1WE6A 3APCA 1IYFA 2JXXA 2EKEC 3VUYA 3TCAA 2KZRA 3VTUA 3N32A 2LXCA 4K7WA 2KOXA 3T9LA 4DHJD 3IBEA 3RT3B 3DPDA 2XK5A 2JRIB 4W9EA 3T8MA 3I3TB 1TZ1A 2MRPA 2MBOA 2FCSA 4RM8A 3IVFA 2IO2B 2L05A 2KQ7A 2A4ZA 2DYMA 3PZDA 4HPMB 4MH0E 2M17A 3PS6A 2K6DB 3VVWB 4G3XB 1YJ1A 1QZEA 3QC8B 4FN2A 3QCAA 3DBRI 4MSMB 3JSVB 4II3B 4TQ1A 4WJQA 5DPTA 3M95A 3UQBA 5J17A 2G45B 3KYCD 1KOTA 3PT2B 2ZPYA 2GBNA 3JYUA 4FULA 2ZPNA 3A33B 3AU4A 5G2NA 2DZMA 1WI0A 4WJPA 1KJTA 2KX3A 3WAPA 2MWSB 2MQJA 4HVBA 2NR2A 3K9OB 4BFRA 3EECA 4K7UA 3QIJA 4NJ6A 2DX5B 5JHBA 2NBUA 3WIMA 4B95A 1YQBA 3NZSA 4PS8A 1XT9B 2MX2A 2WX1A 2M0XA 3MHSD 4HLEA 3KUZA 1TBEA 4GGQA 2EMSA 1OQYA 2FCNA 3RYTA 4FA6A 2K25A 2KLCA 2YVCA 3QHTA 4HDQA 1R4MI 2V4LA 2W9NA 4MGKE 5DPSA 4K1RB 1IP9A 1WGDA 1WRDB 2PPHA 4HPLB 1E90A 1WIAA 1EO6A 1XD3B 1Z5SB 2AEHA 1Q1OA 3PHXB 3PV1A 4HCPB 4YL8A 4IWQA 5FR6A 2O2VB 2V3SA 1E8YA 2KK8A 5JH5C 4W9FA 2KTRB 4MELA 4WWNA 2N9EB 1UD7A 2Z0EB 1GC7A 1YX5B 3ML8A 3SD5A 5AZFA 3V61A 1C1YB 3KUCB 3UQAA 3HIZA 4NAWA 1UELA 4W9JA 3NOBA 2LVQA 2JT4B 3TBLD 3R66C 4AP4C 2CHZA 1RLFA 1UBIA 3B0AA 2O6VB 4ZYNA 1A5RA 4KIKA 3H7PB 1UGMA 4W9CA 2IYDB 2IO1B 3A9KA 3EFUA 4LDTD 2CHXA 2CKHB 3NY5A 4XZ4A 2LUEA 1WMHB 1WXSA 4EEWA 1XQQA 3TMPB 3ZNGC 4BKSA 3UIOB 2OJRA 2LXAA 4BKSD 1UH6A 1EUVB 3NS8A 1WZ0A 2IO3B 1P3QU 3RULA 2KFKA 3APFA 1YIWA 4KZ0A 2BKFA 2K6QA 2KWUB 3RZFA 1V9JA 2D07B 4GB9A 5C23A 1TTNA 5D7GA 4GOCA 2IBIB 4IWPA 4CHKA 5L83A 1WR1A 2LWPA 2N1WA 2MBHA 2Z59B 2R2QA 5G55A 1C3TA 4IM3A 3CSFA 4E74A 1EF5A 3OJ4B 2PE6B 4KDLB 3PPAA 4PYUA 3WAMA 4TKNA 1E5WA 3DOWA 4B9KA 3TJPA 4XC2A 4AJWA 1T0YA 2JZZA 4M8NA 1ZGUB 2GBMA 3ENEA 1MG8A 5D94A 2GBRA 3R7RA 3V6EB 1V2YA 4W9DA 1ZW7A 2KWCA 2ZNVB 2ZVNA 1WY8A 4HCNB 3ZO5B 2QHOA 4GDKB 4A3PA 1J0GA 2XBBC 4ICUA 4E3CA 1WJNA 2KO3A 4MDKE 5DPRA 1F9JA 3DCGA 2NBVB 1I35A 4LCDE 3U8ZA 1TGZB 2JF5A 3RD2A 1D3ZA 2JPHA 2C5LC 3R3MA 2NVUI 5JHAA 2LGXA 1Q0WB 3ZLZA 2KNBA 4K81A 4FHJA 4P7IA 3QWZB 4BVUC 4MJSA 3AI5A 2MLBA 3JSVA 4X57B 5AEKB 2J7QB 5CHVC 2LZ6A 3RZWC 3KH0A 2FCMA 2J0JA 5L95C 1J19A 3ALBA 2AYOB 1P9DU 2G4DB 2LGYA 3IFWB 4PS3A 4W9KA 4LJPB 3L17A 4FJVB 4DHZB 2C60A 2FNJB 4N9F4 3ZIMA 1K8RB 4MSQB 4E71A 1R4NI 1IPGA 1OEYJ 3L13A 2KTFA 3NZUA 1Q5WB 2VRRB 2PE9A 2XEWA 2KJRA 2KN5A 3EHVA 5D6JB 3LDZE 4WQOB 2C7NB 3UIPB 1PQSA 3V6CB 5KHQA 1WJ6A 4I6NB 1NBFC 2Y5BB 2LVPA 1LFDA 2CHWA 4MEMA 3VAWA 2J0KA 2KDFB 1E8WA 1WX8A 2N4FA 3HM6X 1V49A 3ZRFA 2I1JA 2XK5B 5IAAC 2Z0DB 2BWES 2GBJA 4FBJB 2ZNVC 2L3ZA 3NHEB 2YLMA 3X0WA 1V6EA 2L0TA 3QJZA 3ZNHB 2IY1B 3B08A 3KW5B 4NNJB 2ZVOA 2CS4A 2KTRA 4BOSC 2N7DA 4IWOA 2D3GA 3AU5A 1E7UA 3ML9A 4HJKA 3VTWA 4GIVA 2LD9A 4DDID 1S3SG 4W9IA 3SU8X 2KC2A 4A3OA 1WX9A 4NQKE 4G0NB 1WYWB 1LXDA 2KX0A 4JQWC 3W1YA 4ANUA 2NPTA 3PGEA 4M8MA 4GU2A 2DZKA 4EZJA 5BO4B 2D10A 1EF1A 2K39A 4A20A 1J8CA 1WFYA 1WMHA 2LVOA 4AUQC 3A9JA 3R7QA 4GDLB 3PHWB 4JLCA 2RGFA 3ZKJC 4ANWA 3O65B 4CYEA 2DZIA 4ASWC 2M8SA 1ISNA 4XX5A 1YX6B 3ONSA 4ANXA 2BF8B 1CMXB 2KHWB 4HK2A 2DYBA 2JUOA 3H1UA 4NJ7A 3V60A 1U4AA 5IA7A 2M4NA 2J0MA 1WE7A 5DPWA 1OGWA 2N9PC 3Q3FA 4DXAB 1OTRB 2DAJA 2K1FA 1FXTB 2LASA 2GMIC 2NBWB 1JRUA 2BWFA 2KXJA 1WGRA 1WXVA 2LJ5A 3A1QA 3VHTC 3WAOA 4DDGD 3MTNB 1KLVA 4EOYA 4MGZE 4IG7B 2A5UA 3M62B 5KHOA 1WX7A 1V86A 1LQBA 3RCZA 2MBQA 3QA8A 3PRZA 1GNUA 1P0RA 3CF6E 4KDIC 4NAWB 2DZJA 1G6JA 4PYZA 4GSWA 3MJWA 2MP2B 3HK0A 1WR6E 2RPQA 4GXBA 2LGDA 2R2OA 4KIKB 1L2NA 2V1YA 3ZNZB 3A9KB 4LDTB 3W1SC 5AZGA 4AOFA 3QK0A 4KZCA 3ZUNA 3M63B 2RD0A 3U30A 1KM7A 3ECIA 1HE8A 1Y8RC 4BOZB 2MBBB 3ZTCA 1WXMA 2KANA 4F7ZA 4W9LA 1RFAA 2N1VA 3C0RB 3JVZX 5CTRC 1L7YA 2KMAA 4NQLB 3PSEB 1S1QB 3GZNI 2KDEB 4F8CB 2WWZA 2MBEA 5LLIA 2KFKB 2C7MB 2IZVB 3P2BA 3TIXA 3OJ3A 2KFJA 3ZDMC 2G3QB 4ANVA 1E7VA 2IO0B 4OVUA 2DAFA 3VUWA 2ZJDA 3DDCB 4DHZE 3ZNID 3SDLC 3H7SA 1V5OA 3UINB 2KDIA 2GBKA 3DVNU 1SIFA 4G11A 4ZRIA 4WWOA 1H4RA 2K8HA 2UYZB 4JIOU 2M1MA 2KC1A 4GN1A 4AJYB 1WM3A 3WANA 1NDDA 2BPSA 3BINA 3L0WB 4WWPA 2L7RA 5J18A 3PLUA 1ZKHA 4RMAA 1WH3A 3JW0X 2PEAA 4MGIE 3H6NA 2L76A 5CHWA 5CHFA 5EDSA 4EUTA 3DBHI 2KVRA 4TUUA 4EZKA 4EFOA 2KWVB 2AL3A 4FJZA 2LI5A 1WJUA 3ZVVA 4LJOB 3A4SC 1I42A 1SGHA 4I6LB 4KSKC 3ZW3A 3EC8A 2CU1A 1SE9A 2WX0A 4ZRJA 2UWQA 1GG3A 3V62A 1VCBA 4IUMB 2JZ3B 3PLVA 1P1AA 4HXDA 4KV2A 5AZHA 2ASQA 4B6WA 4DHJB 2MSED 3OAWA 4IC7B 2O2VA 4MJSB 2C9WB 3W1SA 4OVVA 1WZ3A 2C7HA 3Q3JA 1WM2A 3DBSA 1P98A 1VD2A 2K8BA 5C1ZA 5J2RA 2B3AA 2KKCA 3GOEA 4IM0A 3DVGX 2KMCA 2JY6A 2GOWA 1OEYA 1GUAB 2ZCCA 3U7DA 3QX1A 1BT0A 5CX3A 1WGHA 2MCNB 2L00B 1UZXB 2WDTB 4FLHA 4II2B 3N3KB 4BBNC 4HDOA 4TQ0A 2BYVE 4FJYA 4W9GA 4BKGA 2HJ8A 2ZCBA 3KVFB 3L10B 3LJ3A 4GDLA 2ZZPB 3A4RA 1H8CA 1WF9A 2O6VA 3M3JA 2O6VD 2JRHA 3H7PA 2LRUA 2HE7A 3VFKA 1GJZA 4AWJA 1Z2MA 1M94A 1WXAA 2N9XA 1WGGA 2I1KA 2KDBA 4K7SA 1WJ4A 2DYOA 3ZDTA 4CO7A 2IY0B 2D11A 4EKUA 4JL9A 3CMMB 2RSUA 1X1MA 1UBQA 2KJ6A 1RRBA 3KYDD 2CR5A 2JWZA 3N30A 3QARA 4M0WB 3QQ8B 2BYFA 4ZDVA 2AWTA 4BKTA 4DK5A 2ZEQA 3DBLI 2KJHB 2FUHB 4F1SA 2BYEA 1E8ZA 2OOBB 3DVGY 4FADA 4J6IA 1V80A 2DENB 5E6OA 5HKHA 3APDA 2EMTA 3HHMA 3QAQA 5E6NA 3X23A 4ICVA 4I6PA 3S2AA 2N7EA 2MP2A 2BGFA 3D32A 3OLMD 3PTFC 4RM9A 3VH4B 2NPTB 1YD8U 5DCNA 3UGBB 1NI2A 5JZEB 4HWIB 4NY0A 3K9PB 5GMVA 2RR9A 3A9JB 3L08A 3SHQA 4PS7A 1RAXA 2BKRB 4WJNA 2AL6A 4W9HA 1AARA 4GDKA 4IM2A 3WA0A 3ZRCA 2HTHA 2NCNA 5D2MB 4EZLA 2G4SA 3VDZA 3L54A 3BY4B 3VTVA 2KLGA 3KUDB 2L0FA 3H9DA 3UF8A 3IG3A 3PRMB 4WJOA 3PRPB 2JVCA 2REXA 1V81A 4JGHB 4WAAA 5TR5A 3VQIA 2K8CA 3PVLA 3TL5A 4IW0A 3VUXA 4TV3A 5LXHA 4MM3A 3VXWA 3A1QB 4G50A 3DQVA 4KSLC 1LM8B 1WGYA 2KD0A 4MGYE 3ZTDA 3B1LX 2LRWA 5LXIB 3PREA 3RUIB 3L16A 4KVGB 2FIFA 4GMVA 1E8XA 3WALA 4ZRKA 3VH3B 5E6PA 1GC6A 2FAZA 2PJHA 4NPNA 2NS5A 3AXCA 4FHKA 2L8JA 2KQSA 4DWFA 3HM3A 1V5TA 2DHZA 2HD5B 2FIDA 2FCQA 3IHPC 2D2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA9 B;  3CST A;  3AUL A;  3DVN V;  2WYQ A;  4URK A;  2MW5 A;  4DBG A;  4BBN F;  1WE6 A;  3APC A;  1IYF A;  2JXX A;  2EKE C;  3VUY A;  3TCA A;  2KZR A;  3VTU A;  3N32 A;  2LXC A;  4K7W A;  2KOX A;  3T9L A;  4DHJ D;  3IBE A;  3RT3 B;  3DPD A;  2XK5 A;  2JRI B;  4W9E A;  3T8M A;  3I3T B;  1TZ1 A;  2MRP A;  2MBO A;  2FCS A;  4RM8 A;  3IVF A;  2IO2 B;  2L05 A;  2KQ7 A;  2A4Z A;  2DYM A;  3PZD A;  4HPM B;  4MH0 E;  2M17 A;  3PS6 A;  2K6D B;  3VVW B;  4G3X B;  1YJ1 A;  1QZE A;  3QC8 B;  4FN2 A;  3QCA A;  3DBR I;  4MSM B;  3JSV B;  4II3 B;  4TQ1 A;  4WJQ A;  5DPT A;  3M95 A;  3UQB A;  5J17 A;  2G45 B;  3KYC D;  1KOT A;  3PT2 B;  2ZPY A;  2GBN A;  3JYU A;  4FUL A;  2ZPN A;  3A33 B;  3AU4 A;  5G2N A;  2DZM A;  1WI0 A;  4WJP A;  1KJT A;  2KX3 A;  3WAP A;  2MWS B;  2MQJ A;  4HVB A;  2NR2 A;  3K9O B;  4BFR A;  3EEC A;  4K7U A;  3QIJ A;  4NJ6 A;  2DX5 B;  5JHB A;  2NBU A;  3WIM A;  4B95 A;  1YQB A;  3NZS A;  4PS8 A;  1XT9 B;  2MX2 A;  2WX1 A;  2M0X A;  3MHS D;  4HLE A;  3KUZ A;  1TBE A;  4GGQ A;  2EMS A;  1OQY A;  2FCN A;  3RYT A;  4FA6 A;  2K25 A;  2KLC A;  2YVC A;  3QHT A;  4HDQ A;  1R4M I;  2V4L A;  2W9N A;  4MGK E;  5DPS A;  4K1R B;  1IP9 A;  1WGD A;  1WRD B;  2PPH A;  4HPL B;  1E90 A;  1WIA A;  1EO6 A;  1XD3 B;  1Z5S B;  2AEH A;  1Q1O A;  3PHX B;  3PV1 A;  4HCP B;  4YL8 A;  4IWQ A;  5FR6 A;  2O2V B;  2V3S A;  1E8Y A;  2KK8 A;  5JH5 C;  4W9F A;  2KTR B;  4MEL A;  4WWN A;  2N9E B;  1UD7 A;  2Z0E B;  1GC7 A;  1YX5 B;  3ML8 A;  3SD5 A;  5AZF A;  3V61 A;  1C1Y B;  3KUC B;  3UQA A;  3HIZ A;  4NAW A;  1UEL A;  4W9J A;  3NOB A;  2LVQ A;  2JT4 B;  3TBL D;  3R66 C;  4AP4 C;  2CHZ A;  1RLF A;  1UBI A;  3B0A A;  2O6V B;  4ZYN A;  1A5R A;  4KIK A;  3H7P B;  1UGM A;  4W9C A;  2IYD B;  2IO1 B;  3A9K A;  3EFU A;  4LDT D;  2CHX A;  2CKH B;  3NY5 A;  4XZ4 A;  2LUE A;  1WMH B;  1WXS A;  4EEW A;  1XQQ A;  3TMP B;  3ZNG C;  4BKS A;  3UIO B;  2OJR A;  2LXA A;  4BKS D;  1UH6 A;  1EUV B;  3NS8 A;  1WZ0 A;  2IO3 B;  1P3Q U;  3RUL A;  2KFK A;  3APF A;  1YIW A;  4KZ0 A;  2BKF A;  2K6Q A;  2KWU B;  3RZF A;  1V9J A;  2D07 B;  4GB9 A;  5C23 A;  1TTN A;  5D7G A;  4GOC A;  2IBI B;  4IWP A;  4CHK A;  5L83 A;  1WR1 A;  2LWP A;  2N1W A;  2MBH A;  2Z59 B;  2R2Q A;  5G55 A;  1C3T A;  4IM3 A;  3CSF A;  4E74 A;  1EF5 A;  3OJ4 B;  2PE6 B;  4KDL B;  3PPA A;  4PYU A;  3WAM A;  4TKN A;  1E5W A;  3DOW A;  4B9K A;  3TJP A;  4XC2 A;  4AJW A;  1T0Y A;  2JZZ A;  4M8N A;  1ZGU B;  2GBM A;  3ENE A;  1MG8 A;  5D94 A;  2GBR A;  3R7R A;  3V6E B;  1V2Y A;  4W9D A;  1ZW7 A;  2KWC A;  2ZNV B;  2ZVN A;  1WY8 A;  4HCN B;  3ZO5 B;  2QHO A;  4GDK B;  4A3P A;  1J0G A;  2XBB C;  4ICU A;  4E3C A;  1WJN A;  2KO3 A;  4MDK E;  5DPR A;  1F9J A;  3DCG A;  2NBV B;  1I35 A;  4LCD E;  3U8Z A;  1TGZ B;  2JF5 A;  3RD2 A;  1D3Z A;  2JPH A;  2C5L C;  3R3M A;  2NVU I;  5JHA A;  2LGX A;  1Q0W B;  3ZLZ A;  2KNB A;  4K81 A;  4FHJ A;  4P7I A;  3QWZ B;  4BVU C;  4MJS A;  3AI5 A;  2MLB A;  3JSV A;  4X57 B;  5AEK B;  2J7Q B;  5CHV C;  2LZ6 A;  3RZW C;  3KH0 A;  2FCM A;  2J0J A;  5L95 C;  1J19 A;  3ALB A;  2AYO B;  1P9D U;  2G4D B;  2LGY A;  3IFW B;  4PS3 A;  4W9K A;  4LJP B;  3L17 A;  4FJV B;  4DHZ B;  2C60 A;  2FNJ B;  4N9F 4;  3ZIM A;  1K8R B;  4MSQ B;  4E71 A;  1R4N I;  1IPG A;  1OEY J;  3L13 A;  2KTF A;  3NZU A;  1Q5W B;  2VRR B;  2PE9 A;  2XEW A;  2KJR A;  2KN5 A;  3EHV A;  5D6J B;  3LDZ E;  4WQO B;  2C7N B;  3UIP B;  1PQS A;  3V6C B;  5KHQ A;  1WJ6 A;  4I6N B;  1NBF C;  2Y5B B;  2LVP A;  1LFD A;  2CHW A;  4MEM A;  3VAW A;  2J0K A;  2KDF B;  1E8W A;  1WX8 A;  2N4F A;  3HM6 X;  1V49 A;  3ZRF A;  2I1J A;  2XK5 B;  5IAA C;  2Z0D B;  2BWE S;  2GBJ A;  4FBJ B;  2ZNV C;  2L3Z A;  3NHE B;  2YLM A;  3X0W A;  1V6E A;  2L0T A;  3QJZ A;  3ZNH B;  2IY1 B;  3B08 A;  3KW5 B;  4NNJ B;  2ZVO A;  2CS4 A;  2KTR A;  4BOS C;  2N7D A;  4IWO A;  2D3G A;  3AU5 A;  1E7U A;  3ML9 A;  4HJK A;  3VTW A;  4GIV A;  2LD9 A;  4DDI D;  1S3S G;  4W9I A;  3SU8 X;  2KC2 A;  4A3O A;  1WX9 A;  4NQK E;  4G0N B;  1WYW B;  1LXD A;  2KX0 A;  4JQW C;  3W1Y A;  4ANU A;  2NPT A;  3PGE A;  4M8M A;  4GU2 A;  2DZK A;  4EZJ A;  5BO4 B;  2D10 A;  1EF1 A;  2K39 A;  4A20 A;  1J8C A;  1WFY A;  1WMH A;  2LVO A;  4AUQ C;  3A9J A;  3R7Q A;  4GDL B;  3PHW B;  4JLC A;  2RGF A;  3ZKJ C;  4ANW A;  3O65 B;  4CYE A;  2DZI A;  4ASW C;  2M8S A;  1ISN A;  4XX5 A;  1YX6 B;  3ONS A;  4ANX A;  2BF8 B;  1CMX B;  2KHW B;  4HK2 A;  2DYB A;  2JUO A;  3H1U A;  4NJ7 A;  3V60 A;  1U4A A;  5IA7 A;  2M4N A;  2J0M A;  1WE7 A;  5DPW A;  1OGW A;  2N9P C;  3Q3F A;  4DXA B;  1OTR B;  2DAJ A;  2K1F A;  1FXT B;  2LAS A;  2GMI C;  2NBW B;  1JRU A;  2BWF A;  2KXJ A;  1WGR A;  1WXV A;  2LJ5 A;  3A1Q A;  3VHT C;  3WAO A;  4DDG D;  3MTN B;  1KLV A;  4EOY A;  4MGZ E;  4IG7 B;  2A5U A;  3M62 B;  5KHO A;  1WX7 A;  1V86 A;  1LQB A;  3RCZ A;  2MBQ A;  3QA8 A;  3PRZ A;  1GNU A;  1P0R A;  3CF6 E;  4KDI C;  4NAW B;  2DZJ A;  1G6J A;  4PYZ A;  4GSW A;  3MJW A;  2MP2 B;  3HK0 A;  1WR6 E;  2RPQ A;  4GXB A;  2LGD A;  2R2O A;  4KIK B;  1L2N A;  2V1Y A;  3ZNZ B;  3A9K B;  4LDT B;  3W1S C;  5AZG A;  4AOF A;  3QK0 A;  4KZC A;  3ZUN A;  3M63 B;  2RD0 A;  3U30 A;  1KM7 A;  3ECI A;  1HE8 A;  1Y8R C;  4BOZ B;  2MBB B;  3ZTC A;  1WXM A;  2KAN A;  4F7Z A;  4W9L A;  1RFA A;  2N1V A;  3C0R B;  3JVZ X;  5CTR C;  1L7Y A;  2KMA A;  4NQL B;  3PSE B;  1S1Q B;  3GZN I;  2KDE B;  4F8C B;  2WWZ A;  2MBE A;  5LLI A;  2KFK B;  2C7M B;  2IZV B;  3P2B A;  3TIX A;  3OJ3 A;  2KFJ A;  3ZDM C;  2G3Q B;  4ANV A;  1E7V A;  2IO0 B;  4OVU A;  2DAF A;  3VUW A;  2ZJD A;  3DDC B;  4DHZ E;  3ZNI D;  3SDL C;  3H7S A;  1V5O A;  3UIN B;  2KDI A;  2GBK A;  3DVN U;  1SIF A;  4G11 A;  4ZRI A;  4WWO A;  1H4R A;  2K8H A;  2UYZ B;  4JIO U;  2M1M A;  2KC1 A;  4GN1 A;  4AJY B;  1WM3 A;  3WAN A;  1NDD A;  2BPS A;  3BIN A;  3L0W B;  4WWP A;  2L7R A;  5J18 A;  3PLU A;  1ZKH A;  4RMA A;  1WH3 A;  3JW0 X;  2PEA A;  4MGI E;  3H6N A;  2L76 A;  5CHW A;  5CHF A;  5EDS A;  4EUT A;  3DBH I;  2KVR A;  4TUU A;  4EZK A;  4EFO A;  2KWV B;  2AL3 A;  4FJZ A;  2LI5 A;  1WJU A;  3ZVV A;  4LJO B;  3A4S C;  1I42 A;  1SGH A;  4I6L B;  4KSK C;  3ZW3 A;  3EC8 A;  2CU1 A;  1SE9 A;  2WX0 A;  4ZRJ A;  2UWQ A;  1GG3 A;  3V62 A;  1VCB A;  4IUM B;  2JZ3 B;  3PLV A;  1P1A A;  4HXD A;  4KV2 A;  5AZH A;  2ASQ A;  4B6W A;  4DHJ B;  2MSE D;  3OAW A;  4IC7 B;  2O2V A;  4MJS B;  2C9W B;  3W1S A;  4OVV A;  1WZ3 A;  2C7H A;  3Q3J A;  1WM2 A;  3DBS A;  1P98 A;  1VD2 A;  2K8B A;  5C1Z A;  5J2R A;  2B3A A;  2KKC A;  3GOE A;  4IM0 A;  3DVG X;  2KMC A;  2JY6 A;  2GOW A;  1OEY A;  1GUA B;  2ZCC A;  3U7D A;  3QX1 A;  1BT0 A;  5CX3 A;  1WGH A;  2MCN B;  2L00 B;  1UZX B;  2WDT B;  4FLH A;  4II2 B;  3N3K B;  4BBN C;  4HDO A;  4TQ0 A;  2BYV E;  4FJY A;  4W9G A;  4BKG A;  2HJ8 A;  2ZCB A;  3KVF B;  3L10 B;  3LJ3 A;  4GDL A;  2ZZP B;  3A4R A;  1H8C A;  1WF9 A;  2O6V A;  3M3J A;  2O6V D;  2JRH A;  3H7P A;  2LRU A;  2HE7 A;  3VFK A;  1GJZ A;  4AWJ A;  1Z2M A;  1M94 A;  1WXA A;  2N9X A;  1WGG A;  2I1K A;  2KDB A;  4K7S A;  1WJ4 A;  2DYO A;  3ZDT A;  4CO7 A;  2IY0 B;  2D11 A;  4EKU A;  4JL9 A;  3CMM B;  2RSU A;  1X1M A;  1UBQ A;  2KJ6 A;  1RRB A;  3KYD D;  2CR5 A;  2JWZ A;  3N30 A;  3QAR A;  4M0W B;  3QQ8 B;  2BYF A;  4ZDV A;  2AWT A;  4BKT A;  4DK5 A;  2ZEQ A;  3DBL I;  2KJH B;  2FUH B;  4F1S A;  2BYE A;  1E8Z A;  2OOB B;  3DVG Y;  4FAD A;  4J6I A;  1V80 A;  2DEN B;  5E6O A;  5HKH A;  3APD A;  2EMT A;  3HHM A;  3QAQ A;  5E6N A;  3X23 A;  4ICV A;  4I6P A;  3S2A A;  2N7E A;  2MP2 A;  2BGF A;  3D32 A;  3OLM D;  3PTF C;  4RM9 A;  3VH4 B;  2NPT B;  1YD8 U;  5DCN A;  3UGB B;  1NI2 A;  5JZE B;  4HWI B;  4NY0 A;  3K9P B;  5GMV A;  2RR9 A;  3A9J B;  3L08 A;  3SHQ A;  4PS7 A;  1RAX A;  2BKR B;  4WJN A;  2AL6 A;  4W9H A;  1AAR A;  4GDK A;  4IM2 A;  3WA0 A;  3ZRC A;  2HTH A;  2NCN A;  5D2M B;  4EZL A;  2G4S A;  3VDZ A;  3L54 A;  3BY4 B;  3VTV A;  2KLG A;  3KUD B;  2L0F A;  3H9D A;  3UF8 A;  3IG3 A;  3PRM B;  4WJO A;  3PRP B;  2JVC A;  2REX A;  1V81 A;  4JGH B;  4WAA A;  5TR5 A;  3VQI A;  2K8C A;  3PVL A;  3TL5 A;  4IW0 A;  3VUX A;  4TV3 A;  5LXH A;  4MM3 A;  3VXW A;  3A1Q B;  4G50 A;  3DQV A;  4KSL C;  1LM8 B;  1WGY A;  2KD0 A;  4MGY E;  3ZTD A;  3B1L X;  2LRW A;  5LXI B;  3PRE A;  3RUI B;  3L16 A;  4KVG B;  2FIF A;  4GMV A;  1E8X A;  3WAL A;  4ZRK A;  3VH3 B;  5E6P A;  1GC6 A;  2FAZ A;  2PJH A;  4NPN A;  2NS5 A;  3AXC A;  4FHK A;  2L8J A;  2KQS A;  4DWF A;  3HM3 A;  1V5T A;  2DHZ A;  2HD5 B;  2FID A;  2FCQ A;  3IHP C;  2D2Q A; 
#chains in the Genus database with same CATH topology
 3AUL A;  3DVN V;  3AE1 B;  1WE6 A;  3TSS A;  3AEC B;  5MPO A;  3IBE A;  1SJE D;  2XK5 A;  2MBO A;  2FCS A;  4RM8 A;  3FIL B;  2L05 A;  3PS6 A;  4LNK A;  1PGX A;  2W55 A;  2Y3A A;  1ROE A;  4MSM B;  4N6E B;  1QLB B;  1ZUD 2;  2LEK A;  4TQ1 A;  3L4P A;  4WAF A;  1IGD A;  4JX1 C;  3SFD B;  3KWL A;  4WJP A;  1EU4 A;  1JRP A;  4BFR A;  2L83 A;  3U52 E;  3T3N A;  3EEC A;  4K7U A;  2AQ3 B;  1JRO A;  3KUZ A;  2JU6 X;  2FCN A;  4M0W A;  2BB6 A;  4KKI A;  2K25 A;  2KLC A;  2YVC A;  3GB1 A;  1R4M I;  4HPL B;  1WIA A;  1XXG A;  1EO6 A;  4IWQ A;  1DOY A;  3MC8 A;  2X8X X;  1E8Y A;  1UGJ A;  2WXL A;  2J4X A;  3AEF B;  1ENF A;  4ZHP A;  1TKG A;  3N9Y C;  5AZF A;  5BMI A;  1YQ3 B;  4DXF A;  2BT6 A;  3UQA A;  3HIZ A;  4ITK A;  5GXG B;  4RGT A;  3VRB B;  2WS3 B;  1GAQ B;  4MH8 A;  1I4R A;  2WXP A;  3UI3 A;  3R66 C;  1UBI A;  2O6V B;  3H7P B;  4W9C A;  2IYD B;  2CHX A;  2CKH B;  2JYE A;  1KLG D;  3NY5 A;  1FXA A;  1EU3 A;  2H89 B;  4AS1 A;  1E7P B;  1I4H A;  1XQQ A;  3FC4 A;  5IP4 D;  1SXT A;  3ZQ4 A;  1UH6 A;  1KH0 A;  4YSZ B;  1P3Q U;  4M01 A;  2KWU B;  2D07 B;  5TSS A;  4GOC A;  3U2S C;  4CHK A;  2MBH A;  3BYT B;  3CSF A;  4NAM A;  2LFI A;  3DOW A;  2KAC A;  4B9K A;  3TJP A;  1ACC A;  4W9D A;  2KWC A;  1V1P B;  4LNF A;  3R2I A;  2INC C;  1WJN A;  5DPR A;  1I35 A;  2NBV B;  3P4P B;  1D3Z A;  3RD2 A;  2JF5 A;  2JPH A;  4BAX A;  4WQM A;  1Q0W B;  4HKZ E;  4MM3 B;  3QWZ B;  4BVU C;  2J52 A;  4MJS A;  1OFF A;  5AEK B;  3I9V 1;  2J7Q B;  2ACZ B;  1TY2 A;  1R7S A;  3W2D A;  1GB4 A;  2AYO B;  2G4D B;  4W9K A;  4ZHO A;  3MC0 B;  3Q8A A;  4RF1 A;  2M56 B;  3L13 A;  2DWQ A;  3NZU A;  1MG4 A;  1Q5W B;  4US9 A;  5D6J B;  2N0S B;  1YN5 A;  1SE3 A;  2LVP A;  2KMM A;  1E8W A;  2EEL A;  3ZRF A;  2Z0D B;  4YSY B;  2BWE S;  2ZNV C;  1XCT L;  3ZNH B;  4BOS C;  2N7D A;  4IWO A;  1STE A;  3AU5 A;  2JX5 A;  1BXT A;  1S3S G;  4ZYS A;  2KC2 A;  2KDM A;  3DBH B;  1GOZ A;  1LXD A;  1I4Q A;  2KX0 A;  1C76 A;  3BVG A;  4ANU A;  3PGE A;  2D3A A;  4EZJ A;  3Q3N C;  1EF1 A;  1WMH A;  2LVO A;  4AUQ C;  2E6X A;  2DNF A;  2RGF A;  2WP9 B;  3PZ8 A;  4CYE A;  4ASW C;  1GB1 A;  2PMV A;  3NJT A;  1CMX B;  2KHW B;  2W54 A;  4NJ7 A;  1U4A A;  2J0M A;  1M4V A;  4JWS C;  3Q3F A;  1OGW A;  2N9P C;  2WXM A;  2LAS A;  5EE1 A;  2GMI C;  1F2R I;  3R8B A;  1WGR A;  1WXV A;  3A1Q A;  3WAO A;  3ZGZ A;  2KAJ A;  4MGZ E;  3N1X C;  3M62 B;  1WX7 A;  1V86 A;  3PRZ A;  3AE4 B;  4XGA B;  1I4G A;  4D2K A;  4GXB A;  2LGD A;  2R2O A;  1KLU D;  1L2N A;  3ZNZ B;  3QK0 A;  4KZC A;  2LUM A;  2L1A A;  4TSS A;  1KTK A;  1VZ6 A;  1HE8 A;  1Y8R C;  4BOZ B;  2WGS A;  3ZTC A;  3AV8 A;  1WXM A;  4F7Z A;  5D7G A;  3DBL B;  4F8C B;  3PSE B;  3GZN I;  2KDE B;  2WWZ A;  2MBE A;  2KFK B;  3OJ3 A;  4ANV A;  2IO0 B;  4OVU A;  1FO4 A;  3E56 A;  3H7S A;  3DVN U;  4JIO U;  1WM3 A;  3WAN A;  4HRS A;  4WWP A;  1HZ5 A;  3NVW A;  1ZKH A;  4RMA A;  2K0P A;  2PEA A;  3P1M A;  3H6N A;  2L76 A;  5JXV A;  5CHF A;  4EUT A;  2KVR A;  2VZK D;  3NS1 A;  3R2T A;  2KWV B;  1UWM A;  4EFO A;  3N20 C;  4HJG E;  3ZVV A;  1SGH A;  3N1Z C;  4KSK C;  3E9S A;  5FKA C;  4ZRJ A;  1ZPS A;  1RFK A;  3V62 A;  3V05 A;  5AZH A;  5BMG A;  2TSS A;  1JAL A;  3OAW A;  2C9W B;  4OVV A;  1WZ3 A;  3Q3J A;  1P98 A;  5C1Z A;  5J2R A;  2KKC A;  4IM0 A;  2GOW A;  1OEY A;  1GUA B;  2ZCC A;  3QX1 A;  1BT0 A;  1D5X C;  2MCN B;  1SEB D;  2VH1 A;  1RWS A;  5LNK 1;  1DOI A;  3N3K B;  4YSX B;  4FJY A;  1T0Q C;  4C00 A;  3L10 B;  1H8C A;  2YEP B;  1SE4 A;  3P4S B;  1M94 A;  1WGG A;  2I1K A;  2KDB A;  2G1E A;  3ZDT A;  2D11 A;  4JL9 A;  3EUB 2;  1FCC C;  2KJ6 A;  1RRB A;  2JWZ A;  3QAR A;  1FCL A;  2AWT A;  4BKT A;  4A90 A;  2BYE A;  1E8Z A;  4J6I A;  1V80 A;  4OW0 A;  2OED A;  2MP2 A;  4YXD B;  3RNG C;  2BGF A;  5T8I A;  1DOX A;  3BVZ A;  3OLM D;  3PTF C;  1FD6 A;  1IGC A;  4NY0 A;  2RR9 A;  3A9J B;  2XNA C;  3L08 A;  1RAX A;  2WU2 B;  1MJD A;  4W9H A;  4GDK A;  3AEA B;  4M02 A;  1C4A A;  3VDZ A;  1DGJ A;  3H9D A;  2CJN A;  4JGH B;  2IPK D;  4WAA A;  5TR5 A;  3VUX A;  4IW0 A;  3VXW A;  1LM8 B;  1WGY A;  4MGY E;  2LRW A;  1HTO A;  2WDR B;  5LXI B;  4A55 A;  1PYW D;  4LNI A;  1QOG A;  4GMV A;  1E8X A;  3SR6 A;  4A6Q A;  2DHZ A;  1TKY A;  2HD5 B;  1FFV A;  3IHP C;  2D2Q A;  1JQ4 A;  3CST A;  5H8Y E;  1OQR A;  2X38 A;  1L5P A;  1N61 A;  3TCA A;  3RFZ B;  3C19 A;  4DHJ D;  3RT3 B;  3DPD A;  2JRI B;  3T8M A;  1TZ1 A;  2MJD A;  2IO2 B;  2IJ0 A;  2KQ7 A;  2M17 A;  2Z8L A;  2K6D B;  3VVW B;  4G3X B;  2PTL A;  2J53 A;  3QC8 B;  3JSV B;  4II3 B;  1YMH E;  2G45 B;  3KYC D;  3PT2 B;  2ZPY A;  4FUL A;  2V0G A;  1JWS D;  5G5H A;  1MHX A;  1KJT A;  2VZK B;  2MWS B;  1C4P A;  3ZXV A;  2K22 A;  2HJ1 A;  5JHB A;  3Q8C A;  2NBU A;  3WIM A;  4B95 A;  5IKC M;  1XT9 B;  3MHS D;  2M0X A;  4GGQ A;  1YOV B;  3QHT A;  4K3C A;  4MGK E;  1WRD B;  4F1S A;  1GPX A;  3PHX B;  3TEZ A;  2O2V B;  1YJI A;  2D5G A;  5JH5 C;  1JWU D;  4MEL A;  1GC7 A;  3SD5 A;  1C1Y B;  3KUC B;  1C77 A;  3IT6 B;  4NAW A;  1UEL A;  4W9J A;  2CHZ A;  1RLF A;  1XLN A;  4JPS A;  4ZYN A;  4GLS C;  1A5R A;  4KIK A;  1JWA D;  4LDT D;  4RF0 A;  3AM9 A;  4XZ4 A;  2PIA A;  3TMP B;  2WLB A;  4C80 A;  3DHI C;  3UIO B;  4S17 A;  2MHJ A;  3AE2 B;  2ZW0 A;  5HHD G;  2K6Q A;  3RZF A;  1V9J A;  2WQY B;  5EE3 A;  4IWP A;  2IBI B;  1E10 A;  2N1W A;  2Z59 B;  3RNA C;  1C3T A;  4IM3 A;  1EF5 A;  4KDL B;  1TIF A;  3PPA A;  3WAM A;  5E6J A;  4TKN A;  1E5W A;  4AJW A;  4M8N A;  2QMT A;  2WXG A;  1V2Y A;  3AH7 A;  1SB3 C;  2IGH A;  2L32 A;  1WY8 A;  4REZ A;  2QHO A;  4MT5 A;  2KO3 A;  1F9J A;  4LCD E;  1QKZ A;  3R3M A;  5JHA A;  1MVK A;  4C7Y A;  4JE3 B;  4P7I A;  4O1N A;  3P4R B;  2N9K A;  2MH7 A;  3KH0 A;  2J0J A;  4US8 A;  2NTT A;  4WUR A;  1AN8 A;  1P9D U;  4PS3 A;  4FJV B;  4DHZ B;  1V97 A;  2LGI A;  4HPP A;  2C60 A;  1K8R B;  5I4D A;  4MSQ B;  4E71 A;  1D4B A;  1R4N I;  3B9J A;  1HZ6 A;  2XEW A;  3GZN B;  2KN5 A;  4UDU C;  3LDZ E;  4WQO B;  3UIP B;  3V6C B;  5HG2 A;  3O13 A;  1L6V A;  4ACF A;  1WWT A;  3VAW A;  3Q8B A;  2J0K A;  1WX8 A;  1WSP A;  4NJC A;  3I57 A;  2I1J A;  3Q8F A;  2XK5 B;  3P63 A;  3AE6 B;  2YLM A;  3URY A;  1JML A;  3B08 A;  3KW5 B;  4NNJ B;  1FNU A;  2CS4 A;  3KQ4 A;  3BZD B;  2K9X A;  3VTW A;  2LD9 A;  4W9I A;  3SU8 X;  1WX9 A;  4A9A A;  4NQK E;  4G0N B;  2NPT A;  1SBB B;  4M8M A;  2DZK A;  3MFG A;  1J8C A;  2Y5P A;  3KLS X;  3R7Q A;  1Q10 A;  4JLC A;  1FEH A;  4P6V F;  3I5J C;  2M8S A;  4XX5 A;  3WCQ A;  1YX6 B;  4ANX A;  4HK2 A;  2JUO A;  1WE7 A;  1WYG A;  3IXS A;  2K1F A;  1I7H A;  2LJ5 A;  3MHZ A;  1KLV A;  4IKG A;  2A5U A;  5KHO A;  1LQB A;  4KDI C;  2DZJ A;  1FMA D;  1CK1 A;  4PYZ A;  2IDY A;  2WU5 B;  4LDT B;  4AOF A;  3M63 B;  4RGM A;  3U30 A;  1T6B X;  1KM7 A;  1TS3 A;  3ECI A;  4XE0 A;  2BW2 A;  2MBB B;  4P1C C;  4W9L A;  3I63 C;  5CTR C;  2KMA A;  2Q5W D;  1TS2 A;  1D6E C;  1TY0 A;  2KFJ A;  1E7V A;  1NEN B;  3OG5 A;  2WXI A;  2ZJD A;  3Q8E A;  3DDC B;  2AQ1 B;  3ZNI D;  3SDL C;  3MJ5 A;  1H4R A;  4AJY B;  2I2Y A;  1BUI C;  2B76 B;  3BIN A;  2L7R A;  1J7B A;  2WHI A;  3JW0 X;  1BML C;  4MGI E;  2MJE A;  4LNN A;  5IOI A;  2QIE B;  2I38 A;  4LK0 M;  2W3S A;  4FJZ A;  3NZ3 A;  2BBC A;  2KYW A;  4I6L B;  2EKI A;  2CU1 A;  1SE9 A;  3ZYY X;  2H88 B;  4IUM B;  3MC9 A;  1XLQ A;  4HXD A;  2K3U A;  4B6W A;  4S0R A;  4MJS B;  4IC7 B;  1VD2 A;  2B3A A;  2KMC A;  3U7D A;  1HXY D;  4L1B A;  1MPE A;  1XLO A;  2GRI A;  2WDT B;  1QOF A;  4WIP A;  2BYV E;  4W9G A;  3A4R A;  3B2G A;  3GE8 C;  3M3J A;  2ZW1 A;  1GJZ A;  1F77 A;  1Z2M A;  1ZDX A;  4K7S A;  1WJ4 A;  2DYO A;  2QEJ C;  3CMM B;  3DHG C;  2RSU A;  1UBQ A;  3QQ8 B;  2PLP A;  4ARC A;  4DK5 A;  2ZEQ A;  2ON8 A;  2KJH B;  3BK1 A;  1I4P A;  1L0Y B;  5E6O A;  1P7E A;  3HHM A;  3X23 A;  2INN E;  1XLP A;  3S2A A;  1N6Z A;  3EGR A;  1HEZ E;  1YD8 U;  3AE7 B;  1NI2 A;  1ET6 A;  2LHE A;  4IM2 A;  2HTH A;  1ZDV A;  2JWU A;  2RPV A;  4KGS A;  4MAC A;  3RMK C;  2G4S A;  3L54 A;  1T0S C;  2XN9 C;  3KUD B;  2REX A;  3BVM A;  1C4C A;  4ZRP A;  3TL5 A;  4TV3 A;  1C78 A;  3A1Q B;  4G50 A;  1L6U A;  5BYR A;  2IND C;  4IOI E;  2BTE A;  3B1L X;  4DXG A;  3PRE A;  5BYS A;  3AMZ A;  2FBW B;  3L16 A;  4KVG B;  3H8H A;  3HVD A;  1FRD A;  1LGR A;  1T3Q A;  3WAL A;  1MHH E;  5E6P A;  1GC6 A;  4NPN A;  4FHK A;  1ZXI A;  2KQS A;  4DWF A;  4ICU A;  2MA9 B;  4AQ7 A;  1J7A A;  1PUT A;  2MW5 A;  4BBN F;  1WGK A;  2EKE C;  3VUY A;  2KZR A;  4K7W A;  2KOX A;  4C4V A;  1OQQ A;  4W9E A;  2DYM A;  1UWX A;  3AEG B;  2CJO A;  4XDC A;  1KF6 B;  1YJ1 A;  3QCA A;  1K50 A;  3UQB A;  2N7J A;  1ZE3 D;  3LXF A;  4LLG M;  1KOT A;  3JYU A;  1WI0 A;  2QDF A;  3C8Y A;  2KX3 A;  4HVB A;  2MQJ A;  2NR2 A;  1T5X D;  2DX5 B;  1YQB A;  4XDD A;  4HLE A;  1C9F A;  1TBE A;  1L4Z B;  1OQY A;  3RYT A;  1WXQ A;  2LHD A;  4HDQ A;  2W9N A;  1IP9 A;  1VJK A;  1AWD A;  2PPH A;  1E90 A;  5DCN A;  1XD3 B;  4HCP B;  1Z5S B;  2AEH A;  1Q1O A;  4YL8 A;  3PV1 A;  1IBX A;  4DQO C;  2KK8 A;  2KTR B;  2YEP F;  1UD7 A;  1T0R C;  1YX5 B;  2Z0E B;  3N1Y C;  3ML8 A;  1RYJ A;  4A8X C;  1R4N B;  2BB5 A;  2N9L A;  4HKQ A;  2BS4 B;  3TBL D;  4PT5 A;  5FR3 A;  2BVC A;  4OVZ A;  1EM7 A;  3A9K A;  3EFU A;  2BS3 B;  1WXS A;  4R3D A;  4EEW A;  3V3X A;  3ZNG C;  4BKS A;  5EE0 A;  2LXA A;  1EUV B;  3NS8 A;  1WZ0 A;  2IO3 B;  3APF A;  2J42 A;  4KZ0 A;  2BKF A;  5C23 A;  1TTN A;  1WR1 A;  3TEW A;  2R2Q A;  5G55 A;  1E0Z A;  3T3O A;  2VH2 A;  4E74 A;  2PE6 B;  5H92 C;  1B9R A;  2G9H D;  4XC2 A;  2JZZ A;  2GBM A;  3ENE A;  1MG8 A;  4RCO A;  3FKY A;  1ZW7 A;  2ZNV B;  4HCN B;  3ZO5 B;  1J0G A;  4GDK B;  4E3C A;  4MDK E;  4P1B C;  3U8Z A;  2WXK A;  2C5L C;  2NVU I;  4EE2 A;  2LGX A;  3ZLZ A;  1QQR A;  3NRZ A;  4FHJ A;  3SFE B;  5EE9 A;  2WXR A;  3U7Z A;  2HTM E;  3AI5 A;  2MLB A;  3JSV A;  4X57 B;  2JZP A;  2LZ6 A;  2FCM A;  3NVZ A;  2LGY A;  3IFW B;  3HUI A;  3L17 A;  3DWM A;  2FNJ B;  4N9F 4;  3RPF C;  1TJE A;  4OZB A;  3ZIM A;  1HTQ A;  2K5P A;  1IPG A;  2KTF A;  1FIQ A;  2KQ4 X;  2VRR B;  3EHV A;  1WJ6 A;  2KT7 A;  4YWG G;  4TMA B;  1NBF C;  4OHJ A;  4MEM A;  2KDF B;  3HM6 X;  4RNA A;  1V49 A;  3TEX A;  1V1O A;  3X0W A;  2L0T A;  3AE9 B;  2ZVO A;  2KN4 A;  3P42 A;  3AB5 A;  4HJK A;  1CQV A;  5AUI A;  4DDI D;  3TUO A;  3VRA B;  1ZOY B;  1RM6 C;  2PKO A;  1WYW B;  2SEB D;  4FXC A;  3W1Y A;  3Q14 C;  3J9C A;  4GU2 A;  5BO4 B;  2D10 A;  2K39 A;  4A20 A;  2M0A A;  2LMC A;  4GDL B;  3ZKJ C;  3OWE B;  3O65 B;  2DZI A;  2IGG A;  2DYB A;  3H1U A;  1FRR A;  5IA7 A;  2M4N A;  2BQQ A;  4DXA B;  1OTR B;  2DAJ A;  2LJI A;  1FXT B;  1JRU A;  2KXJ A;  4DDG D;  3VHT C;  3MTN B;  4EOY A;  3IT4 B;  1AW7 A;  4N58 A;  1FNW A;  3RCZ A;  2MBQ A;  1TYG B;  3QA8 A;  2D3C A;  1P0R A;  3CF6 E;  4NAW B;  4RH6 A;  1G6J A;  1QF6 A;  4GSW A;  2JXT A;  4XWW A;  4KIK B;  1TS4 A;  1FPY A;  2KWD A;  1NI3 A;  3ZUN A;  2MEK A;  2RD0 A;  1YN4 A;  2Y5C A;  2KAN A;  3JVZ X;  1N60 A;  4NQL B;  2QCZ A;  2INP E;  5LLI A;  1Y56 A;  2C7M B;  2IZV B;  3TIX A;  2DAF A;  3FIL A;  3VUW A;  1KFY B;  4DHZ E;  1V5O A;  2KDI A;  2GBK A;  1SIF A;  4WWO A;  2K8H A;  2UYZ B;  2M1M A;  4GN1 A;  1MI0 A;  4YTP B;  3Q3M C;  2BPS A;  3RI7 C;  1FM0 D;  1UNS A;  5J18 A;  5D3I B;  1WH3 A;  1EWC A;  5CHW A;  1PGA A;  1V8C A;  1K51 A;  2JSV X;  1VZ8 A;  2V4I B;  2HDE A;  2WXJ A;  4LJO B;  1I42 A;  3IAM 1;  3ZW3 A;  3EC8 A;  2WX0 A;  4HRO A;  1GG3 A;  2LGS A;  1VCB A;  4KV2 A;  2DBY A;  3B2F A;  3AEB B;  4DHJ B;  1ZP0 B;  2MSE D;  4L2Y A;  3W1S A;  2C7H A;  1WM2 A;  3DBS A;  2K8B A;  3DVG X;  1SIJ A;  1UZX B;  5BMH A;  2JYT A;  4FLH A;  4IDI A;  4BBN C;  4BKG A;  2HJ8 A;  3IAS 1;  3LJ3 A;  1K53 A;  1WF9 A;  2O6V A;  2WDV B;  3H7P A;  2LRU A;  2HE7 A;  3BII D;  3KWV A;  4AWJ A;  2N9X A;  4CO7 A;  4EKU A;  4BZA A;  1K52 A;  4WWM A;  1CJE A;  1X1M A;  3KYD D;  3FAH A;  1I4X A;  1SJH D;  4M0W B;  2FUH B;  1NVI D;  3LB8 C;  3DVG Y;  3RNE C;  5HKH A;  3APD A;  1F0Z A;  4ICV A;  4I6P A;  4C7Z A;  3AE3 B;  4ZRQ A;  2N7E A;  3D32 A;  4YTM B;  3VH4 B;  2NPT B;  3UGB B;  4ARI A;  1DYQ A;  1F52 A;  5JZE B;  4HWI B;  1SE2 A;  3K9P B;  2NMQ A;  2IGD A;  3SHQ A;  4PS7 A;  2AL6 A;  1V1P A;  1AAR A;  3ETR A;  4B0M A;  1L0X B;  1KRH A;  5D2M B;  3TEY A;  3AN1 A;  4QAY A;  2L0F A;  3UF8 A;  3IG3 A;  4WJO A;  1VRA B;  1XEE A;  2JVC A;  3PRP B;  2QSD A;  3PVL A;  1TT5 B;  5LXH A;  4MM3 A;  4J3O D;  1SSN A;  2RMM A;  3GE3 C;  1VR9 A;  3RUI B;  5D3D A;  1JW9 D;  4KKJ A;  2FUG 1;  3RNC C;  3AE5 B;  3VH3 B;  2PJH A;  2L8J A;  3HM3 A;  2PVO D;  2AX5 A;  3ABV B;  2PW9 A;  4URK A;  2WYQ A;  3BK2 A;  4DBG A;  2RDG A;  3APC A;  1IYF A;  2JXX A;  3VTU A;  3N32 A;  2LXC A;  3T9L A;  1NYR A;  3I3T B;  2MRP A;  3IVF A;  2A4Z A;  1C79 A;  3PZD A;  4HPM B;  4MH0 E;  1ET9 A;  4WH4 A;  3ZXR A;  1QZE A;  4FN2 A;  3DBR I;  3RNB C;  5DPT A;  4WJQ A;  3M95 A;  1E6E B;  5J17 A;  1FFU A;  3SEB A;  2GBN A;  2ZPN A;  2JQR B;  3A33 B;  3AU4 A;  5G2N A;  2DZM A;  1YJJ A;  1VLB A;  3WAP A;  3K9O B;  3AED B;  3QIJ A;  4NJ6 A;  1SF0 A;  2QIL A;  3NZS A;  4PS8 A;  3ZJU A;  2MX2 A;  4USA A;  2WX1 A;  2KVZ A;  2EMS A;  2UU7 A;  4FA6 A;  4JWU C;  2V4L A;  5DPS A;  4K1R B;  1WGD A;  2ONQ A;  5FR6 A;  2DLB A;  1YNT E;  2V3S A;  1F1H A;  4W9F A;  3DWG C;  4WWN A;  1XO3 A;  2N9E B;  4KX6 B;  5HI1 A;  2V9H A;  3V61 A;  3HRD D;  3NOB A;  2WXQ A;  2LVQ A;  2JT4 B;  3BWU D;  4AP4 C;  3B0A A;  2RDH A;  1UGM A;  3GS2 A;  2IO1 B;  1UUP A;  1ZXH A;  1TKE A;  2LUE A;  1WMH B;  2WXO A;  1P7F A;  4K3B A;  2OJR A;  3NG0 A;  4BKS D;  4B0E A;  3RUL A;  2M19 A;  2KFK A;  1YIW A;  1VZ7 A;  2D3B A;  2RDB C;  4GB9 A;  3Q69 A;  5L83 A;  4P16 A;  2LWP A;  2PVG C;  1YQ4 B;  3OJ4 B;  4PYU A;  5G5G A;  2WDQ B;  1MFW A;  1JWM D;  1T0Y A;  3R7R A;  1ZGU B;  5D94 A;  3V6E B;  2GBR A;  1UF0 A;  2ZVN A;  1CZP A;  4A3P A;  2XBB C;  3DCG A;  4OZA A;  2W82 A;  1TGZ B;  4Q2J A;  4KGR A;  2KNB A;  3W5U B;  1D5M C;  4K81 A;  2V3P A;  3RN9 C;  1HA5 A;  1VDV A;  4NZL B;  5C3J B;  5CHV C;  2WXH A;  3RZW C;  5L95 C;  1J19 A;  3ALB A;  3NVY A;  1PDX A;  2OJW A;  1B1Z A;  4LJP B;  3RNF C;  2WNM A;  2QJL A;  1OEY J;  2PE9 A;  2GLS A;  2KJR A;  2C7N B;  1PQS A;  5KHQ A;  4I6N B;  2Y5B B;  1LFD A;  2CHW A;  2N4F A;  1D5Z C;  5IAA C;  4C4V B;  2GBJ A;  4FBJ B;  2L3Z A;  3NHE B;  1V6E A;  3QJZ A;  2IY1 B;  4OZC A;  3VR8 B;  2KTR A;  2D3G A;  1E7U A;  3ML9 A;  2CU3 A;  1YN3 A;  4GIV A;  1IUE A;  1F2R C;  4A3O A;  2V3N A;  4YT0 B;  4JQW C;  4HEA 1;  5IN7 A;  4PK1 A;  4CQN A;  1N5X A;  1WFY A;  3U4E G;  3A9J A;  2AQ2 B;  3PHW B;  4H2A A;  1A70 A;  4ANW A;  1ISN A;  4XYC A;  3ONS A;  1N5W A;  2BF8 B;  2WXF A;  4RFB A;  3V60 A;  5DPW A;  3NVV A;  1IBX B;  2NBW B;  2BWF A;  4N59 A;  2BYT A;  3ZJT A;  4IG7 B;  1HQR D;  1J7C A;  1GNU A;  1LO5 D;  1FNV A;  1E9M A;  1L0V B;  3MJW A;  2MP2 B;  2ICI A;  3HK0 A;  3Q6B A;  1WR6 E;  2RPQ A;  3MP9 A;  1R4M B;  2V1Y A;  3A9K B;  5FK9 C;  3W1S C;  5AZG A;  1NEK B;  1N62 A;  1XF5 L;  2OHF A;  2MJ3 A;  1RFA A;  2N1V A;  3C0R B;  1L7Y A;  2E3T A;  1S1Q B;  3PZ7 A;  3VR9 B;  1NYQ A;  3P2B A;  3ZDM C;  5HFY A;  2G3Q B;  1AYF A;  3UIN B;  4G11 A;  4L23 A;  4ZRI A;  4RGN A;  1WRI A;  2KC1 A;  1TS5 A;  1NDD A;  2NTS A;  3L0W B;  4LTU A;  3PLU A;  1JWB D;  4ZOH C;  5EDS A;  3Q2A C;  3DBH I;  1FXI A;  4TUU A;  4EZK A;  3HVZ A;  2R61 A;  1QOA A;  2AL3 A;  3Q3O C;  2LI5 A;  1PFD A;  3EA6 A;  1WJU A;  1L4D B;  3A4S C;  3PO0 A;  2QC8 A;  1XCQ L;  2UWQ A;  3ZJV A;  2WXN A;  2JZ3 B;  3PLV A;  1P1A A;  3DHH C;  4LNO A;  2ASQ A;  2O2V A;  3BYY B;  1PGB A;  3GOE A;  2JY6 A;  5CX3 A;  1WGH A;  4XWT A;  2FE8 A;  2L00 B;  4M00 A;  4II2 B;  2BS2 B;  4HDO A;  4TQ0 A;  4C56 C;  2ZCB A;  3KVF B;  4GDL A;  2ZZP B;  4YTN B;  2SAK A;  2O6V D;  2JRH A;  3VFK A;  1WXA A;  3EFC A;  2IY0 B;  1ESF A;  2CR5 A;  3N30 A;  2L52 A;  2BYF A;  4ZDV A;  3DBR B;  3DBL I;  1QIL A;  5C2T B;  4FAD A;  2OOB B;  2DEN B;  5BYQ A;  3GP7 A;  2EMT A;  3QAQ A;  5E6N A;  3W5V B;  2GB1 A;  1JCK B;  4RM9 A;  1EWY C;  1N63 A;  5GMV A;  3P4Q B;  2BKR B;  4WJN A;  3ZRC A;  5AUK A;  3WA0 A;  1QT9 A;  2NCN A;  3CWI A;  4EZL A;  3CIR B;  3BY4 B;  3VTV A;  2KLG A;  5IO9 A;  3PRM B;  1TZO A;  1V81 A;  3VQI A;  2K8C A;  3DQV A;  4KSL C;  2KD0 A;  3ZTD A;  3NUH B;  3LYY A;  2W3R A;  4KGT A;  3AEE B;  2FIF A;  4ZRK A;  2FAZ A;  2NS5 A;  3AXC A;  2GI9 A;  1QOB A;  3W9C B;  1V5T A;  4RGO S;  2FID A;  2FCQ A;  3AE8 B; 
#chains in the Genus database with same CATH homology
 2MA9 B;  3CST A;  3AUL A;  3DVN V;  2WYQ A;  4URK A;  2MW5 A;  4DBG A;  4BBN F;  1WE6 A;  3APC A;  1IYF A;  2JXX A;  2EKE C;  3VUY A;  3TCA A;  2KZR A;  3VTU A;  3N32 A;  2LXC A;  4K7W A;  2KOX A;  3T9L A;  4DHJ D;  3IBE A;  3RT3 B;  3DPD A;  2XK5 A;  2JRI B;  4W9E A;  3T8M A;  3I3T B;  1TZ1 A;  2MRP A;  2MBO A;  2FCS A;  4RM8 A;  3IVF A;  2IO2 B;  2L05 A;  2KQ7 A;  2A4Z A;  2DYM A;  3PZD A;  4HPM B;  4MH0 E;  2M17 A;  3PS6 A;  2K6D B;  3VVW B;  4G3X B;  1YJ1 A;  1QZE A;  3QC8 B;  4FN2 A;  3QCA A;  3DBR I;  4MSM B;  3JSV B;  4II3 B;  4TQ1 A;  4WJQ A;  5DPT A;  3M95 A;  3UQB A;  5J17 A;  2G45 B;  3KYC D;  1KOT A;  3PT2 B;  2ZPY A;  2GBN A;  3JYU A;  4FUL A;  2ZPN A;  3A33 B;  3AU4 A;  5G2N A;  2DZM A;  1WI0 A;  4WJP A;  1KJT A;  2KX3 A;  3WAP A;  2MWS B;  2MQJ A;  4HVB A;  2NR2 A;  3K9O B;  4BFR A;  3EEC A;  4K7U A;  3QIJ A;  4NJ6 A;  2DX5 B;  5JHB A;  2NBU A;  3WIM A;  4B95 A;  1YQB A;  3NZS A;  4PS8 A;  1XT9 B;  2MX2 A;  2WX1 A;  2M0X A;  3MHS D;  4HLE A;  3KUZ A;  1TBE A;  4GGQ A;  2EMS A;  1OQY A;  2FCN A;  3RYT A;  4FA6 A;  2K25 A;  2KLC A;  2YVC A;  3QHT A;  4HDQ A;  1R4M I;  2V4L A;  2W9N A;  4MGK E;  5DPS A;  4K1R B;  1IP9 A;  1WGD A;  1WRD B;  2PPH A;  4HPL B;  1E90 A;  1WIA A;  1EO6 A;  1XD3 B;  1Z5S B;  2AEH A;  1Q1O A;  3PHX B;  3PV1 A;  4HCP B;  4YL8 A;  4IWQ A;  5FR6 A;  2O2V B;  2V3S A;  1E8Y A;  2KK8 A;  5JH5 C;  4W9F A;  2KTR B;  4MEL A;  4WWN A;  2N9E B;  1UD7 A;  2Z0E B;  1GC7 A;  1YX5 B;  3ML8 A;  3SD5 A;  5AZF A;  3V61 A;  1C1Y B;  3KUC B;  3UQA A;  3HIZ A;  4NAW A;  1UEL A;  4W9J A;  3NOB A;  2LVQ A;  2JT4 B;  3TBL D;  3R66 C;  4AP4 C;  2CHZ A;  1RLF A;  1UBI A;  3B0A A;  2O6V B;  4ZYN A;  1A5R A;  4KIK A;  3H7P B;  1UGM A;  4W9C A;  2IYD B;  2IO1 B;  3A9K A;  3EFU A;  4LDT D;  2CHX A;  2CKH B;  3NY5 A;  4XZ4 A;  2LUE A;  1WMH B;  1WXS A;  4EEW A;  1XQQ A;  3TMP B;  3ZNG C;  4BKS A;  3UIO B;  2OJR A;  2LXA A;  4BKS D;  1UH6 A;  1EUV B;  3NS8 A;  1WZ0 A;  2IO3 B;  1P3Q U;  3RUL A;  2KFK A;  3APF A;  1YIW A;  4KZ0 A;  2BKF A;  2K6Q A;  2KWU B;  3RZF A;  1V9J A;  2D07 B;  4GB9 A;  5C23 A;  1TTN A;  5D7G A;  4GOC A;  2IBI B;  4IWP A;  4CHK A;  5L83 A;  1WR1 A;  2LWP A;  2N1W A;  2MBH A;  2Z59 B;  2R2Q A;  5G55 A;  1C3T A;  4IM3 A;  3CSF A;  4E74 A;  1EF5 A;  3OJ4 B;  2PE6 B;  4KDL B;  3PPA A;  4PYU A;  3WAM A;  4TKN A;  1E5W A;  3DOW A;  4B9K A;  3TJP A;  4XC2 A;  4AJW A;  1T0Y A;  2JZZ A;  4M8N A;  1ZGU B;  2GBM A;  3ENE A;  1MG8 A;  5D94 A;  2GBR A;  3R7R A;  3V6E B;  1V2Y A;  4W9D A;  1ZW7 A;  2KWC A;  2ZNV B;  2ZVN A;  1WY8 A;  4HCN B;  3ZO5 B;  2QHO A;  4GDK B;  4A3P A;  1J0G A;  2XBB C;  4ICU A;  4E3C A;  1WJN A;  2KO3 A;  4MDK E;  5DPR A;  1F9J A;  3DCG A;  2NBV B;  1I35 A;  4LCD E;  3U8Z A;  1TGZ B;  2JF5 A;  3RD2 A;  1D3Z A;  2JPH A;  2C5L C;  3R3M A;  2NVU I;  5JHA A;  2LGX A;  1Q0W B;  3ZLZ A;  2KNB A;  4K81 A;  4FHJ A;  4P7I A;  3QWZ B;  4BVU C;  4MJS A;  3AI5 A;  2MLB A;  3JSV A;  4X57 B;  5AEK B;  2J7Q B;  5CHV C;  2LZ6 A;  3RZW C;  3KH0 A;  2FCM A;  2J0J A;  5L95 C;  1J19 A;  3ALB A;  2AYO B;  1P9D U;  2G4D B;  2LGY A;  3IFW B;  4PS3 A;  4W9K A;  4LJP B;  3L17 A;  4FJV B;  4DHZ B;  2C60 A;  2FNJ B;  4N9F 4;  3ZIM A;  1K8R B;  4MSQ B;  4E71 A;  1R4N I;  1IPG A;  1OEY J;  3L13 A;  2KTF A;  3NZU A;  1Q5W B;  2VRR B;  2PE9 A;  2XEW A;  2KJR A;  2KN5 A;  3EHV A;  5D6J B;  3LDZ E;  4WQO B;  2C7N B;  3UIP B;  1PQS A;  3V6C B;  5KHQ A;  1WJ6 A;  4I6N B;  1NBF C;  2Y5B B;  2LVP A;  1LFD A;  2CHW A;  4MEM A;  3VAW A;  2J0K A;  2KDF B;  1E8W A;  1WX8 A;  2N4F A;  3HM6 X;  1V49 A;  3ZRF A;  2I1J A;  2XK5 B;  5IAA C;  2Z0D B;  2BWE S;  2GBJ A;  4FBJ B;  2ZNV C;  2L3Z A;  3NHE B;  2YLM A;  3X0W A;  1V6E A;  2L0T A;  3QJZ A;  3ZNH B;  2IY1 B;  3B08 A;  3KW5 B;  4NNJ B;  2ZVO A;  2CS4 A;  2KTR A;  4BOS C;  2N7D A;  4IWO A;  2D3G A;  3AU5 A;  1E7U A;  3ML9 A;  4HJK A;  3VTW A;  4GIV A;  2LD9 A;  4DDI D;  1S3S G;  4W9I A;  3SU8 X;  2KC2 A;  4A3O A;  1WX9 A;  4NQK E;  4G0N B;  1WYW B;  1LXD A;  2KX0 A;  4JQW C;  3W1Y A;  4ANU A;  2NPT A;  3PGE A;  4M8M A;  4GU2 A;  2DZK A;  4EZJ A;  5BO4 B;  2D10 A;  1EF1 A;  2K39 A;  4A20 A;  1J8C A;  1WFY A;  1WMH A;  2LVO A;  4AUQ C;  3A9J A;  3R7Q A;  4GDL B;  3PHW B;  4JLC A;  2RGF A;  3ZKJ C;  4ANW A;  3O65 B;  4CYE A;  2DZI A;  4ASW C;  2M8S A;  1ISN A;  4XX5 A;  1YX6 B;  3ONS A;  4ANX A;  2BF8 B;  1CMX B;  2KHW B;  4HK2 A;  2DYB A;  2JUO A;  3H1U A;  4NJ7 A;  3V60 A;  1U4A A;  5IA7 A;  2M4N A;  2J0M A;  1WE7 A;  5DPW A;  1OGW A;  2N9P C;  3Q3F A;  4DXA B;  1OTR B;  2DAJ A;  2K1F A;  1FXT B;  2LAS A;  2GMI C;  2NBW B;  1JRU A;  2BWF A;  2KXJ A;  1WGR A;  1WXV A;  2LJ5 A;  3A1Q A;  3VHT C;  3WAO A;  4DDG D;  3MTN B;  1KLV A;  4EOY A;  4MGZ E;  4IG7 B;  2A5U A;  3M62 B;  5KHO A;  1WX7 A;  1V86 A;  1LQB A;  3RCZ A;  2MBQ A;  3QA8 A;  3PRZ A;  1GNU A;  1P0R A;  3CF6 E;  4KDI C;  4NAW B;  2DZJ A;  1G6J A;  4PYZ A;  4GSW A;  3MJW A;  2MP2 B;  3HK0 A;  1WR6 E;  2RPQ A;  4GXB A;  2LGD A;  2R2O A;  4KIK B;  1L2N A;  2V1Y A;  3ZNZ B;  3A9K B;  4LDT B;  3W1S C;  5AZG A;  4AOF A;  3QK0 A;  4KZC A;  3ZUN A;  3M63 B;  2RD0 A;  3U30 A;  1KM7 A;  3ECI A;  1HE8 A;  1Y8R C;  4BOZ B;  2MBB B;  3ZTC A;  1WXM A;  2KAN A;  4F7Z A;  4W9L A;  1RFA A;  2N1V A;  3C0R B;  3JVZ X;  5CTR C;  1L7Y A;  2KMA A;  4NQL B;  3PSE B;  1S1Q B;  3GZN I;  2KDE B;  4F8C B;  2WWZ A;  2MBE A;  5LLI A;  2KFK B;  2C7M B;  2IZV B;  3P2B A;  3TIX A;  3OJ3 A;  2KFJ A;  3ZDM C;  2G3Q B;  4ANV A;  1E7V A;  2IO0 B;  4OVU A;  2DAF A;  3VUW A;  2ZJD A;  3DDC B;  4DHZ E;  3ZNI D;  3SDL C;  3H7S A;  1V5O A;  3UIN B;  2KDI A;  2GBK A;  3DVN U;  1SIF A;  4G11 A;  4ZRI A;  4WWO A;  1H4R A;  2K8H A;  2UYZ B;  4JIO U;  2M1M A;  2KC1 A;  4GN1 A;  4AJY B;  1WM3 A;  3WAN A;  1NDD A;  2BPS A;  3BIN A;  3L0W B;  4WWP A;  2L7R A;  5J18 A;  3PLU A;  1ZKH A;  4RMA A;  1WH3 A;  3JW0 X;  2PEA A;  4MGI E;  3H6N A;  2L76 A;  5CHW A;  5CHF A;  5EDS A;  4EUT A;  3DBH I;  2KVR A;  4TUU A;  4EZK A;  4EFO A;  2KWV B;  2AL3 A;  4FJZ A;  2LI5 A;  1WJU A;  3ZVV A;  4LJO B;  3A4S C;  1I42 A;  1SGH A;  4I6L B;  4KSK C;  3ZW3 A;  3EC8 A;  2CU1 A;  1SE9 A;  2WX0 A;  4ZRJ A;  2UWQ A;  1GG3 A;  3V62 A;  1VCB A;  4IUM B;  2JZ3 B;  3PLV A;  1P1A A;  4HXD A;  4KV2 A;  5AZH A;  2ASQ A;  4B6W A;  4DHJ B;  2MSE D;  3OAW A;  4IC7 B;  2O2V A;  4MJS B;  2C9W B;  3W1S A;  4OVV A;  1WZ3 A;  2C7H A;  3Q3J A;  1WM2 A;  3DBS A;  1P98 A;  1VD2 A;  2K8B A;  5C1Z A;  5J2R A;  2B3A A;  2KKC A;  3GOE A;  4IM0 A;  3DVG X;  2KMC A;  2JY6 A;  2GOW A;  1OEY A;  1GUA B;  2ZCC A;  3U7D A;  3QX1 A;  1BT0 A;  5CX3 A;  1WGH A;  2MCN B;  2L00 B;  1UZX B;  2WDT B;  4FLH A;  4II2 B;  3N3K B;  4BBN C;  4HDO A;  4TQ0 A;  2BYV E;  4FJY A;  4W9G A;  4BKG A;  2HJ8 A;  2ZCB A;  3KVF B;  3L10 B;  3LJ3 A;  4GDL A;  2ZZP B;  3A4R A;  1H8C A;  1WF9 A;  2O6V A;  3M3J A;  2O6V D;  2JRH A;  3H7P A;  2LRU A;  2HE7 A;  3VFK A;  1GJZ A;  4AWJ A;  1Z2M A;  1M94 A;  1WXA A;  2N9X A;  1WGG A;  2I1K A;  2KDB A;  4K7S A;  1WJ4 A;  2DYO A;  3ZDT A;  4CO7 A;  2IY0 B;  2D11 A;  4EKU A;  4JL9 A;  3CMM B;  2RSU A;  1X1M A;  1UBQ A;  2KJ6 A;  1RRB A;  3KYD D;  2CR5 A;  2JWZ A;  3N30 A;  3QAR A;  4M0W B;  3QQ8 B;  2BYF A;  4ZDV A;  2AWT A;  4BKT A;  4DK5 A;  2ZEQ A;  3DBL I;  2KJH B;  2FUH B;  4F1S A;  2BYE A;  1E8Z A;  2OOB B;  3DVG Y;  4FAD A;  4J6I A;  1V80 A;  2DEN B;  5E6O A;  5HKH A;  3APD A;  2EMT A;  3HHM A;  3QAQ A;  5E6N A;  3X23 A;  4ICV A;  4I6P A;  3S2A A;  2N7E A;  2MP2 A;  2BGF A;  3D32 A;  3OLM D;  3PTF C;  4RM9 A;  3VH4 B;  2NPT B;  1YD8 U;  5DCN A;  3UGB B;  1NI2 A;  5JZE B;  4HWI B;  4NY0 A;  3K9P B;  5GMV A;  2RR9 A;  3A9J B;  3L08 A;  3SHQ A;  4PS7 A;  1RAX A;  2BKR B;  4WJN A;  2AL6 A;  4W9H A;  1AAR A;  4GDK A;  4IM2 A;  3WA0 A;  3ZRC A;  2HTH A;  2NCN A;  5D2M B;  4EZL A;  2G4S A;  3VDZ A;  3L54 A;  3BY4 B;  3VTV A;  2KLG A;  3KUD B;  2L0F A;  3H9D A;  3UF8 A;  3IG3 A;  3PRM B;  4WJO A;  3PRP B;  2JVC A;  2REX A;  1V81 A;  4JGH B;  4WAA A;  5TR5 A;  3VQI A;  2K8C A;  3PVL A;  3TL5 A;  4IW0 A;  3VUX A;  4TV3 A;  5LXH A;  4MM3 A;  3VXW A;  3A1Q B;  4G50 A;  3DQV A;  4KSL C;  1LM8 B;  1WGY A;  2KD0 A;  4MGY E;  3ZTD A;  3B1L X;  2LRW A;  5LXI B;  3PRE A;  3RUI B;  3L16 A;  4KVG B;  2FIF A;  4GMV A;  1E8X A;  3WAL A;  4ZRK A;  3VH3 B;  5E6P A;  1GC6 A;  2FAZ A;  2PJH A;  4NPN A;  2NS5 A;  3AXC A;  4FHK A;  2L8J A;  2KQS A;  4DWF A;  3HM3 A;  1V5T A;  2DHZ A;  2HD5 B;  2FID A;  2FCQ A;  3IHP C;  2D2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...