1V9KA

The crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
DVIMYEDDHILVLNKPSGTAVHGGSGLSFGVIEGLRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKRCLQKMRNAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal large subunit pseudouridine synthase C
publication title Crystal structures of the catalytic domains of pseudouridine synthases RluC and RluD from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 65
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.4.99.24: 23S rRNA pseudouridine(955/2504/2580) synthase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 1v9kA00
1PRZA 3HJYA 3HJWA 1V9KA 1R3FA 1ZE1A 1KSKA 2ISTA 3HAXA 2AUSA 2RFKA 2I82A 3LWQA 1SGVA 4LABA 4LGTA 3LWRA 3LWVA 2APOA 1QYUA 3MQKA 1KSLA 1K8WA 2HVYA 1XPIA 3DH3A 3LWPA 2EY4A 3LWOA 1R3EA 1ZE2A 1KSVA 3UAIA 1V9FA 2AB4A 3U28A 1ZL3A
chains in the Genus database with same CATH superfamily
1PRZA 3HJYA 1Z2ZA 3HJWA 1V9KA 1R3FA 1ZE1A 1KSKA 2ISTA 3HAXA 2AUSA 2RFKA 2I82A 3LWQA 1SGVA 4LABA 1SB7A 4LGTA 3LWRA 3LWVA 2APOA 1QYUA 3MQKA 1KSLA 1K8WA 2HVYA 1XPIA 3DH3A 3LWPA 2EY4A 3LWOA 1R3EA 1ZE2A 1SZWA 1KSVA 3UAIA 1V9FA 2AB4A 3U28A 1SI7A 1ZL3A
chains in the Genus database with same CATH topology
1PRZA 3HJYA 1Z2ZA 3HJWA 1V9KA 1R3FA 1ZE1A 1KSKA 2ISTA 3HAXA 2AUSA 2RFKA 2I82A 3LWQA 1SGVA 4LABA 1SB7A 4LGTA 3LWRA 3LWVA 2APOA 1QYUA 3MQKA 1KSLA 1K8WA 2HVYA 1XPIA 3DH3A 3LWPA 2EY4A 3LWOA 1R3EA 1ZE2A 1SZWA 1KSVA 3UAIA 1V9FA 2AB4A 3U28A 1SI7A 1ZL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRZ A;  3HJY A;  3HJW A;  1V9K A;  1R3F A;  1ZE1 A;  1KSK A;  2IST A;  3HAX A;  2AUS A;  2RFK A;  2I82 A;  3LWQ A;  1SGV A;  4LAB A;  4LGT A;  3LWR A;  3LWV A;  2APO A;  1QYU A;  3MQK A;  1KSL A;  1K8W A;  2HVY A;  1XPI A;  3DH3 A;  3LWP A;  2EY4 A;  3LWO A;  1R3E A;  1ZE2 A;  1KSV A;  3UAI A;  1V9F A;  2AB4 A;  3U28 A;  1ZL3 A; 
#chains in the Genus database with same CATH topology
 1PRZ A;  3HJY A;  1Z2Z A;  3HJW A;  1V9K A;  1R3F A;  1ZE1 A;  1KSK A;  2IST A;  3HAX A;  2AUS A;  2RFK A;  2I82 A;  3LWQ A;  1SGV A;  4LAB A;  1SB7 A;  4LGT A;  3LWR A;  3LWV A;  2APO A;  1QYU A;  3MQK A;  1KSL A;  1K8W A;  2HVY A;  1XPI A;  3DH3 A;  3LWP A;  2EY4 A;  3LWO A;  1R3E A;  1ZE2 A;  1SZW A;  1KSV A;  3UAI A;  1V9F A;  2AB4 A;  3U28 A;  1SI7 A;  1ZL3 A; 
#chains in the Genus database with same CATH homology
 1PRZ A;  3HJY A;  1Z2Z A;  3HJW A;  1V9K A;  1R3F A;  1ZE1 A;  1KSK A;  2IST A;  3HAX A;  2AUS A;  2RFK A;  2I82 A;  3LWQ A;  1SGV A;  4LAB A;  1SB7 A;  4LGT A;  3LWR A;  3LWV A;  2APO A;  1QYU A;  3MQK A;  1KSL A;  1K8W A;  2HVY A;  1XPI A;  3DH3 A;  3LWP A;  2EY4 A;  3LWO A;  1R3E A;  1ZE2 A;  1SZW A;  1KSV A;  3UAI A;  1V9F A;  2AB4 A;  3U28 A;  1SI7 A;  1ZL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...