1VA0A

Crystal structure of the native form of uroporphyrin iii c-methyl transferase from thermus thermophilus
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
225
structure length
221
Chain Sequence
GRVYLVGAGPGDPELLTLKAYRLLKEAPVVLYDRLVDERVLALAPGEKVYVGKEEKQEEIHRLLLRHARAHPFVVRLKGGDPMVFGRGGEEVLFLLRHGVPVEVVPGVTSLLASGLPLTHRGLAHGFAAVSGVLEGGGYPDLRPFARVPTLVVLMGVGRRVWIAKELLRLGRDPREPTLFVERASTPKERRVHARLEEVAEGKVEVRPPALWILGEVVRVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a closed-form uroporphyrinogen-III C-methyltransferase from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Uroporphyrin-III C-methyltransferase
total genus 64
structure length 221
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2004-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1va0A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1va0A01
2P5CA 2EHLA 2E8HA 2HUVA 2E16A 2ZVBA 2P6IA 1CBFA 2ZVCA 2Z6RA 1WNGA 2DSHA 2ED3A 2NPNA 2DSGA 3HH1A 2EH5A 2E15A 2ELEA 3ND1A 1PJSA 2PB4A 2P6KA 2DV3A 2E4RA 2EGLA 2OWKA 2OWUA 2HUQA 2HR8A 1VCEA 2EMUA 2HUTA 2DXXA 2DXWA 3FQ6A 2YBOA 2ENIA 2EJZA 2EL0A 2EEQA 3NEIA 3FFYA 2BB3A 1VHVA 2EGBA 2EKAA 2DEKA 2E4NA 2EN5A 2PCHA 2E8QA 2E8SA 2OWVA 3NUTA 2EJJA 2EL2A 2EK3A 1PJQA 2EK4A 2PCKA 2PCIA 1VE2A 2E7RA 2E17A 2DXVA 2HUXA 2EJKA 2DV5A 2DSIA 2E08A 2EH4A 2PB6A 2E8RA 2PCMA 2CBFA 2ED5A 2OWFA 5HW4A 1WDEA 2EK7A 2EMRA 1WYZA 4E16A 2EL3A 1PJTA 3I4TA 2E07A 2EL1A 2PCAA 2PB5A 2P9DA 2DV7A 2PCGA 3KWPA 2P2XA 2ELDA 2P6LA 2EK2A 3NDCA 1VA0A 2E0KA 2E0NA 2EHCA 2EH2A 2QBUA 2OWGA 2P5FA 2EGSA 2P6DA 2DV4A 2YBQA 1S4DA 1V9AA
chains in the Genus database with same CATH superfamily
2P5CA 4H4EA 3UV7A 2EHLA 2E8HA 3SZOA 2HUVA 2E16A 2ZVBA 4N7BA 2P6IA 1CBFA 2ZVCA 2Z6RA 1WNGA 3T0FA 2DSHA 2ED3A 2NPNA 2DSGA 3HH1A 2EH5A 2E15A 2ELEA 3ND1A 1PJSA 3DNFA 2PB4A 2P6KA 2DV3A 3KE9A 2E4RA 2EGLA 3KELA 2OWKA 2OWUA 2HUQA 3UTCA 2HR8A 1VCEA 4MUXA 2EMUA 2HUTA 2DXXA 2DXWA 4H4CA 3FQ6A 2YBOA 3SZUA 2ENIA 4EB3A 2EJZA 3SZLA 3URKA 2EL0A 2EEQA 3NEIA 3FFYA 4H4DA 2BB3A 1VHVA 2EGBA 2EKAA 2DEKA 2E4NA 2EN5A 2PCHA 4MUYA 3T0GA 2E8QA 2E8SA 2OWVA 3NUTA 2EJJA 2EL2A 2EK3A 3KE8A 3KEMA 4MV0A 1PJQA 2EK4A 2PCKA 2PCIA 1VE2A 2E7RA 2E17A 2DXVA 2HUXA 3TIXB 2EJKA 2DV5A 2DSIA 2E08A 3KEFA 2EH4A 3UWMA 2PB6A 2E8RA 2PCMA 2CBFA 2ED5A 2OWFA 5HW4A 3UV6A 1WDEA 2EK7A 2EMRA 3LMMA 1WYZA 4E16A 2EL3A 1PJTA 3I4TA 2E07A 2EL1A 2PCAA 2PB5A 2P9DA 2DV7A 3F7TA 3ZGLA 2PCGA 3KWPA 2P2XA 2KYYA 2ELDA 2P6LA 2EK2A 3NDCA 1VA0A 2E0KA 4MV5A 3ZGNA 3UV3A 2E0NA 2EHCA 2EH2A 2QBUA 3UTDA 2OWGA 2P5FA 2EGSA 2P6DA 2DV4A 2YBQA 1S4DA 1V9AA
chains in the Genus database with same CATH topology
2P5CA 4H4EA 3UV7A 2EHLA 2E8HA 3SZOA 2HUVA 2E16A 2ZVBA 4N7BA 2P6IA 1CBFA 2ZVCA 2Z6RA 1WNGA 3T0FA 2DSHA 2ED3A 2NPNA 2DSGA 3HH1A 2EH5A 2E15A 2ELEA 3ND1A 1PJSA 3DNFA 2PB4A 2P6KA 2DV3A 3KE9A 2E4RA 2EGLA 3KELA 2OWKA 2OWUA 2HUQA 3UTCA 2HR8A 1VCEA 4MUXA 2EMUA 2HUTA 2DXXA 2DXWA 4H4CA 3FQ6A 2YBOA 3SZUA 2ENIA 4EB3A 2EJZA 3SZLA 3URKA 2EL0A 2EEQA 3NEIA 3FFYA 4H4DA 2BB3A 1VHVA 2EGBA 2EKAA 2DEKA 2E4NA 2EN5A 2PCHA 4MUYA 3T0GA 2E8QA 2E8SA 2OWVA 3NUTA 2EJJA 2EL2A 2EK3A 3KE8A 3KEMA 4MV0A 1PJQA 2EK4A 2PCKA 2PCIA 1VE2A 2E7RA 2E17A 2DXVA 2HUXA 3TIXB 2EJKA 2DV5A 2DSIA 2E08A 3KEFA 2EH4A 3UWMA 2PB6A 2E8RA 2PCMA 2CBFA 2ED5A 2OWFA 5HW4A 3UV6A 1WDEA 2EK7A 2EMRA 3LMMA 1WYZA 4E16A 2EL3A 1PJTA 3I4TA 2E07A 2EL1A 2PCAA 2PB5A 2P9DA 2DV7A 3F7TA 3ZGLA 2PCGA 3KWPA 2P2XA 2KYYA 2ELDA 2P6LA 2EK2A 3NDCA 1VA0A 2E0KA 4MV5A 3ZGNA 3UV3A 2E0NA 2EHCA 2EH2A 2QBUA 3UTDA 2OWGA 2P5FA 2EGSA 2P6DA 2DV4A 2YBQA 1S4DA 1V9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5C A;  2EHL A;  2E8H A;  2HUV A;  2E16 A;  2ZVB A;  2P6I A;  1CBF A;  2ZVC A;  2Z6R A;  1WNG A;  2DSH A;  2ED3 A;  2NPN A;  2DSG A;  3HH1 A;  2EH5 A;  2E15 A;  2ELE A;  3ND1 A;  1PJS A;  2PB4 A;  2P6K A;  2DV3 A;  2E4R A;  2EGL A;  2OWK A;  2OWU A;  2HUQ A;  2HR8 A;  1VCE A;  2EMU A;  2HUT A;  2DXX A;  2DXW A;  3FQ6 A;  2YBO A;  2ENI A;  2EJZ A;  2EL0 A;  2EEQ A;  3NEI A;  3FFY A;  2BB3 A;  1VHV A;  2EGB A;  2EKA A;  2DEK A;  2E4N A;  2EN5 A;  2PCH A;  2E8Q A;  2E8S A;  2OWV A;  3NUT A;  2EJJ A;  2EL2 A;  2EK3 A;  1PJQ A;  2EK4 A;  2PCK A;  2PCI A;  1VE2 A;  2E7R A;  2E17 A;  2DXV A;  2HUX A;  2EJK A;  2DV5 A;  2DSI A;  2E08 A;  2EH4 A;  2PB6 A;  2E8R A;  2PCM A;  2CBF A;  2ED5 A;  2OWF A;  5HW4 A;  1WDE A;  2EK7 A;  2EMR A;  1WYZ A;  4E16 A;  2EL3 A;  1PJT A;  3I4T A;  2E07 A;  2EL1 A;  2PCA A;  2PB5 A;  2P9D A;  2DV7 A;  2PCG A;  3KWP A;  2P2X A;  2ELD A;  2P6L A;  2EK2 A;  3NDC A;  1VA0 A;  2E0K A;  2E0N A;  2EHC A;  2EH2 A;  2QBU A;  2OWG A;  2P5F A;  2EGS A;  2P6D A;  2DV4 A;  2YBQ A;  1S4D A;  1V9A A; 
#chains in the Genus database with same CATH topology
 2P5C A;  4H4E A;  3UV7 A;  2EHL A;  2E8H A;  3SZO A;  2HUV A;  2E16 A;  2ZVB A;  4N7B A;  2P6I A;  1CBF A;  2ZVC A;  2Z6R A;  1WNG A;  3T0F A;  2DSH A;  2ED3 A;  2NPN A;  2DSG A;  3HH1 A;  2EH5 A;  2E15 A;  2ELE A;  3ND1 A;  1PJS A;  3DNF A;  2PB4 A;  2P6K A;  2DV3 A;  3KE9 A;  2E4R A;  2EGL A;  3KEL A;  2OWK A;  2OWU A;  2HUQ A;  3UTC A;  2HR8 A;  1VCE A;  4MUX A;  2EMU A;  2HUT A;  2DXX A;  2DXW A;  4H4C A;  3FQ6 A;  2YBO A;  3SZU A;  2ENI A;  4EB3 A;  2EJZ A;  3SZL A;  3URK A;  2EL0 A;  2EEQ A;  3NEI A;  3FFY A;  4H4D A;  2BB3 A;  1VHV A;  2EGB A;  2EKA A;  2DEK A;  2E4N A;  2EN5 A;  2PCH A;  4MUY A;  3T0G A;  2E8Q A;  2E8S A;  2OWV A;  3NUT A;  2EJJ A;  2EL2 A;  2EK3 A;  3KE8 A;  3KEM A;  4MV0 A;  1PJQ A;  2EK4 A;  2PCK A;  2PCI A;  1VE2 A;  2E7R A;  2E17 A;  2DXV A;  2HUX A;  3TIX B;  2EJK A;  2DV5 A;  2DSI A;  2E08 A;  3KEF A;  2EH4 A;  3UWM A;  2PB6 A;  2E8R A;  2PCM A;  2CBF A;  2ED5 A;  2OWF A;  5HW4 A;  3UV6 A;  1WDE A;  2EK7 A;  2EMR A;  3LMM A;  1WYZ A;  4E16 A;  2EL3 A;  1PJT A;  3I4T A;  2E07 A;  2EL1 A;  2PCA A;  2PB5 A;  2P9D A;  2DV7 A;  3F7T A;  3ZGL A;  2PCG A;  3KWP A;  2P2X A;  2KYY A;  2ELD A;  2P6L A;  2EK2 A;  3NDC A;  1VA0 A;  2E0K A;  4MV5 A;  3ZGN A;  3UV3 A;  2E0N A;  2EHC A;  2EH2 A;  2QBU A;  3UTD A;  2OWG A;  2P5F A;  2EGS A;  2P6D A;  2DV4 A;  2YBQ A;  1S4D A;  1V9A A; 
#chains in the Genus database with same CATH homology
 2P5C A;  4H4E A;  3UV7 A;  2EHL A;  2E8H A;  3SZO A;  2HUV A;  2E16 A;  2ZVB A;  4N7B A;  2P6I A;  1CBF A;  2ZVC A;  2Z6R A;  1WNG A;  3T0F A;  2DSH A;  2ED3 A;  2NPN A;  2DSG A;  3HH1 A;  2EH5 A;  2E15 A;  2ELE A;  3ND1 A;  1PJS A;  3DNF A;  2PB4 A;  2P6K A;  2DV3 A;  3KE9 A;  2E4R A;  2EGL A;  3KEL A;  2OWK A;  2OWU A;  2HUQ A;  3UTC A;  2HR8 A;  1VCE A;  4MUX A;  2EMU A;  2HUT A;  2DXX A;  2DXW A;  4H4C A;  3FQ6 A;  2YBO A;  3SZU A;  2ENI A;  4EB3 A;  2EJZ A;  3SZL A;  3URK A;  2EL0 A;  2EEQ A;  3NEI A;  3FFY A;  4H4D A;  2BB3 A;  1VHV A;  2EGB A;  2EKA A;  2DEK A;  2E4N A;  2EN5 A;  2PCH A;  4MUY A;  3T0G A;  2E8Q A;  2E8S A;  2OWV A;  3NUT A;  2EJJ A;  2EL2 A;  2EK3 A;  3KE8 A;  3KEM A;  4MV0 A;  1PJQ A;  2EK4 A;  2PCK A;  2PCI A;  1VE2 A;  2E7R A;  2E17 A;  2DXV A;  2HUX A;  3TIX B;  2EJK A;  2DV5 A;  2DSI A;  2E08 A;  3KEF A;  2EH4 A;  3UWM A;  2PB6 A;  2E8R A;  2PCM A;  2CBF A;  2ED5 A;  2OWF A;  5HW4 A;  3UV6 A;  1WDE A;  2EK7 A;  2EMR A;  3LMM A;  1WYZ A;  4E16 A;  2EL3 A;  1PJT A;  3I4T A;  2E07 A;  2EL1 A;  2PCA A;  2PB5 A;  2P9D A;  2DV7 A;  3F7T A;  3ZGL A;  2PCG A;  3KWP A;  2P2X A;  2KYY A;  2ELD A;  2P6L A;  2EK2 A;  3NDC A;  1VA0 A;  2E0K A;  4MV5 A;  3ZGN A;  3UV3 A;  2E0N A;  2EHC A;  2EH2 A;  2QBU A;  3UTD A;  2OWG A;  2P5F A;  2EGS A;  2P6D A;  2DV4 A;  2YBQ A;  1S4D A;  1V9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...