1VA4A

Pseudomonas fluorescens aryl esterase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWLLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an aryl esterase from Pseudomonas fluorescens.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords Arylesterase
total genus 103
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1va4A00
2W22A 1YS1X 2WU3A 4DMFA 3FLBA 1AURA 2V98A 4JYPA 1A8QA 3D3NA 4DMHA 1CLEA 2FX5A 3I6YA 5HK9A 1MNAA 4TGLA 2ZVDA 3C70A 2C5GA 5C8ZA 5AOCA 2OQVA 2DHEA 2OCLA 1VE6A 1Z68A 2GYUA 5BV7A 1U8EA 3F67A 2PM8A 4Y9SA 4K6GA 1JKMA 4HRXA 1THGA 2WHPA 2VAXA 4LKOA 1XZKA 4LHEA 1AX9A 3L1JA 1XFDA 2J3DA 1GXSA 4CCYB 3PF9A 4Y2UA 5K3BA 3ED1A 5EI5A 1PFQA 3WL7A 2CJPA 1MX5A 2HHAA 3BDIA 4W9RA 5AK6A 2WJ6A 1XZJA 5SYNA 3H2GA 2XMRA 5HQ3B 2IX9A 4EB0A 4Q3OA 3RK4A 2D0DA 2YXPX 1CUCA 4HXEB 3O0DA 2HA0A 3STYA 2PL5A 3G9TA 3OG9A 3Q8WA 4AN1A 1JJIA 5ALWA 5ALRA 4V2IA 1OCEA 3R3WA 5K3AA 1A7UA 5DTIA 2FJ0A 3BE8A 1MTZA 2CB9A 3WK9A 2HA4A 3K6KA 4J0JA 1XZIA 4OD0A 2PPLA 4LYEA 1DQZA 1LPOA 4DGQA 1QOZA 3WK8A 3VJLA 4E11A 5AK4A 4XIIA 1B6GA 3V1LA 4KRYA 3HEAA 2H1IA 1MPXA 4E15A 4MEAA 4CIAA 1QIHA 2QT9A 4PO3X 2OGZA 1C7IA 3I2IA 1GKLA 3I2JA 3DDUA 4KJXA 4AO6A 5AP9A 4DSZA 3H2HA 5E4TA 4CG3A 1C7JA 1ZIYA 1DWOA 3C87A 5AI4A 3LS2A 2PUHA 3FSGD 1BRTA 3C6ZA 1UK6A 4OSEA 2PBLA 4GI1A 4GW3A 3ZLUA 4WDQA 4Y2VA 4WJLA 5CTAA 5BWBA 1TRHA 4NS4A 3FNBA 2RI6A 4B9EA 3BJRA 3C6BA 2X76A 1WHTA 4K6HA 3DJYA 3C6XA 4MXDA 2H7XA 4OYLA 1QIEA 4E46A 4C01A 3AINA 1ACJA 5AJHA 4BDSA 2BGRA 4Y2RA 4CCWA 1QGED 1CIJA 5A71A 3R0VA 1MNQA 5K5EA 3H04A 4MEBA 2C5FA 2RGUA 3NOXA 4UHFA 1EDDA 5DYWA 5F4ZA 3WKCA 5DYYA 4M0MA 4FMPA 1H2YA 3VJKA 2QZPA 4G8CA 3V1KA 5I8PA 1T4MA 1W4LA 4BYMA 4UBKA 5EGNA 1ZGBA 4Q05A 5AHXA 4KRXA 4QEKA 2H9YA 1TKRA 3WL6A 1D07A 2CEKA 2WUEA 3JYHA 2PSHA 3ESCA 3WL8A 2DQZA 1UOQA 3V1NA 3L1HA 5CXXA 1G5FA 4PSUA 1TIBA 3AZPA 1N1MA 3G02A 3O4JA 3RM3A 5AKYA 2VEOA 3WKBA 4B9AA 4JUIA 5KWJA 4WFIA 1FFBA 3TEJA 3H2IA 3LP5A 1R4ZA 4UBIA 2OQIA 1EVEA 4J7AA 5AIBA 2DSNA 4G4IA 5T4EA 2GBIA 2PSEA 1ZI8A 5JZ9A 2X5XA 4MYDA 4AN0A 4IH1A 3O4GA 3JW8A 5JANA 1R3DA 5AM5A 4ETWA 1CV2A 2XQFA 5AI9A 1YAJA 1E5TA 3GBSA 3CN7A 1WPRA 4MJ3A 5HF5A 2WTNA 3P2MA 5LZ5A 4AXBA 2PUJA 1EXWA 2HIHA 2WSLA 5AKHA 1ZD2P 5JATA 3I6ZA 2K2QB 2WHRA 3UUFA 4GLBA 3WWCA 1YCDA 3N2ZB 4FNMA 1GT6A 1USWA 2JGMA 1XZEA 4FTWA 2RHWA 3G0CA 1N8SA 5JAHA 3V1MA 2GYWA 1MJ5A 1ACLA 5E4YA 1GZ7A 3AIOA 3FYUA 3R3YA 4MWSA 5EHZA 1K63A 3GA7A 1EK1A 4BE4A 1DX6A 4EY7A 4DNFA 4M0EA 1MN6A 4FBLA 5FUMA 1TCCA 1U65A 3OC0A 1QO7A 1CFJA 5T4FA 3TJMA 2Y1KA 2E3JA 3ANTA 1BEZA 4QE3A 3FSGA 2QMQA 2IITA 4FBMA 3RARA 2EDAA 5CH3A 2HADA 2XLCA 4KE6A 4W1PA 5JD4A 3MUOA 4GWLA 1XZHA 4I3FA 3HABA 1EK2A 5AI6A 4ZWNA 3WZLA 1X2EA 2OCIA 3TRDA 2BUBA 3OTQA 1JU4A 2ZYRA 3BIXA 2Z8XA 2VQ6A 5JAOA 3D2AA 3H17A 2WIDA 3X3HA 3ICWA 4OB7A 1UKCA 4I4CA 1F6WA 3G0GA 4YK7A 4H7KA 1GKKA 4G1FA 4A16A 3UMJA 1IVYA 1QZ3A 5JALA 4J3JA 3LIIA 2HDWA 3AJAA 1BS9A 1ZD3A 1EX9A 1IZ7A 1H2ZA 1P0IA 2AJBA 4G5XA 1VXOA 3PUIA 1MAHA 1XZCA 2ZJ7A 1SCQA 3NWOA 3OURA 4H7EA 1CUBA 2ZYIA 3O4IA 1LPMA 3O4HA 1XZFA 1CUYA 1CUUA 4YX9A 3A6ZA 4QNNA 1HL7A 5CURA 4EBBA 4BRSA 4FFVA 3AILA 2QXTA 3BIWA 4BBZA 3R40A 4BP9A 3R3XA 3D0KA 4Y2JA 1HBJA 4KE7A 2JGLA 3KWJA 3EBLA 3I2KA 1CUZA 2I3DA 2O2HA 4UBMA 1PV1A 1BROA 4U2FA 2RONA 4B0PA 3ESDA 4FDMA 2G5PA 2R8BA 1GQSA 2QJRA 4QDXA 2JGJA 1DWQA 2ONCA 4X85A 2HA7A 4J0IA 2XUGA 1QO9A 1QIKA 4H7HA 4CG1A 4AQDA 4KE9A 2PSJA 3WK5A 5JD6A 1LPPA 2OGTA 1S8OA 3QMVA 2WJ4A 4G4JA 1XZLA 2JIDA 3AFIA 4H7JA 5HK8A 3CN9A 2HU5A 5EHNA 3ZI7A 5LP1A 4QWWA 4AMZA 5D6OA 4YASA 5JASA 5JARA 3C43A 1I6WA 5AICA 4XWGA 1Y7IA 3TGLA 1ZI9A 1LBSA 2XMDA 3WKAA 5CBKA 4EY8A 5AK3A 4MQLA 2WU4A 1QTIA 1EA5A 5D3ZA 4BB0A 3D59A 1CR6A 1EDEA 3WK4A 2XUAA 3R3VA 4Y2XA 2Z3WA 4KR0A 1YASA 3KOOA 3IA2A 4FLEA 4PV7A 2WUFA 3GELA 1QIDA 3Q0TA 4HZGA 3ZLVA 1KEZA 4H35A 1ODCA 4KAAA 4C4XA 2PU5A 5CT6A 4CIBA 2QTBA 1ORVA 1CUHA 5K3DA 1BU8A 1E3QA 1XQWA 4B7ZA 1H2WA 4RE5A 3STWA 3IDAA 1SFRA 1BEEA 4PSDA 5ALYA 3V48A 3H18A 5FPQA 1AUOA 5AOAA 5AM0A 4WY5A 5AKJA 1JJFA 1L7QA 5A7FA 3QPCA 1G4HA 1QLWA 3C5VA 3G0IA 1FFEA 2WFZA 5JZBA 1M33A 2YH2A 5LKAA 1P0PA 3KXPA 3BWXA 3UUEA 1XROA 5AKKA 5ALDA 4GXNA 5LZ2A 5LLSA 4ZI5A 2XQGA 4K5QA 1CVLA 2WHQA 1UFOA 2VJCA 1T2NA 3IUQA 4H7FA 3F98A 1CUXA 5AKLA 4RNCA 3KD2A 1ISPA 4BCCA 3QM1A 5DJ5A 2EEPA 1ORWA 3FOBA 5DNVA 2WFLB 1ODTC 2WG0A 4KAJA 1Q83A 3DKKA 3E3AA 5FPPA 4G8DA 5DYTA 5C8XA 4N5IX 3QBJA 4C4ZA 3R3UA 4DLNA 3R3ZA 4TPKA 1UZAA 3FBWA 1N5MA 4F60A 2QKYA 1R9MA 4BC0A 2QS9A 1JMKC 4N8DA 1XZAA 4WCVA 2QJWA 3PI6A 2CZQA 2C7BA 1UWCA 3T52A 5HQ3A 2D5LA 1N5RA 1G66A 2DQYA 3QH4A 3EQ9A 2O2GA 5T4HA 3MGAA 5AM1A 2C0QA 1DX4A 5IH7A 4PNZA 4X7BA 2WLSA 4X00A 2ZJFA 5ALJA 4HXFB 4O08A 4CI9A 2OLEA 5H3HA 4FKBA 4DM7A 2XQIA 3PICA 5HF6A 5FDFA 2GBFA 1H23A 4IHAA 3NGMA 4BZZA 1EI9A 1QFMA 1AQLA 1CUDA 1ZD4A 3I28A 1FFDA 3E0XA 2AJLI 5CH8A 4JYMA 4UPDA 2WG1A 4Q82A 5JAUA 2GZSA 3KWFA 2PU7A 2GBGA 1PJAA 1UK7A 5DLPA 3DL4A 4J0KA 1IZ8A 3VVMA 2GBCA 1YA4A 5CW2A 4Z49A 4BCDA 3QMMA 4BAGA 3O9VA 3W06A 5FV4A 1JT2A 4Q34A 4EY5A 1UOOA 2PSFA 5ALTA 4C89A 4DNOA 3FCYA 1YSCA 5ALSA 4DIUA 1DTEA 1VXRA 2ACEA 3QMWA 1JFRA 4W63A 1YS2X 2Z8ZA 4P93A 3HXKA 1MU0A 4B80A 4EHBA 3STUA 4C88A 4AO8A 5LIPA 4DMCA 3RLIA 2X8BA 4UBJA 3OM8A 3CXUA 2WIJA 3D5EA 1CUVA 4OU5A 2C58A 2Z3ZA 1K6EA 1FJ2A 3HJUA 1R50A 4EZIA 1MX9A 3I1IA 2BKLA 3S2ZA 2ES4A 1Y37A 2RIPA 1SCIA 3ESAA 1GGVA 5HFNA 1OILA 2JEYA 2BFNA 2Y6UA 1K8QA 4KEAA 2QUAA 1J06A 2R11A 3FYTA 1QTRA 4Q3KA 3VDXA 4BVJA 5ALFA 5IVKA 3WWOA 5HKBA 5ALQA 4IH9A 4DSAA 3B3QA 1A8SA 3IUNA 2G5TA 1W75A 2OGSA 1UXOA 1QIGA 3GUUA 1QIIA 2JGIA 5E4JA 1P0MA 4UBLA 4F21A 4BATA 4LXIA 4W1RA 1LGYA 3QITA 5BWCA 2FJPA 5FP0A 4MWTA 5FLKA 4XX1A 4NMWA 4A5SA 2XMBA 5A7GA 2HA2A 2QXUA 5AI0A 3HYSA 5AKIA 4ZGBA 4QDUA 3SC2A 4UHEA 5ALIA 1LLFA 1Q0RA 4BP8A 2B61A 3FYUB 1NX9A 1EH5A 1CRLA 2DHCA 3C6YA 3QVMA 3PDCA 4W1SA 3G9XA 1XRQA 2WUGA 4FOLA 2XB6A 3EF3A 2VJBA 4HXGA 3EIOA 3H19A 2CKMA 5CT4A 3STTA 3WA7A 2QUBA 1CQWA 3WK6A 5AI5A 5LZ9A 1G42A 5ALKA 3IUJA 2P8SA 1HPLA 5EIEA 3M82A 5K3FB 1E89A 3BDVA 4HTAA 2WFMA 2VTVA 5A2GA 2OPHA 1HDEA 4XVCA 3M83A 1EINA 4KYVA 1AKNA 2VATA 4X97A 5ALLA 1Y7HA 3ZPXA 2I03A 5LYYA 2PVSA 1TAHA 1JU3A 5C8VA 1GPNA 1F0PA 3I2HA 3PE6A 2HA5A 2O7RA 2ZSHA 4K6KA 4X91A 1LPNA 2PSDA 4EY4A 5ALEA 4UHDA 1XRLA 2EDCA 1AZWA 3A2LA 5C81A 4JNCA 3U0VA 4FNGA 3WYNA 3S8YA 4DNQA 4UHCA 4I19A 3K2IA 3W9UA 5I9IA 2PX6A 2BUAA 1MO2A 3DL7A 2HRRA 1EB9A 3AZOA 1ETHA 3W04A 4J0CA 5HF9A 1EHYA 3QPDA 4HVTA 4L72A 2GYVA 1UKAA 2FUKA 1KU6A 5DTJA 3FVTA 3N0TA 5DNWA 1J2EA 2LIPA 4G9EA 2B9VA 1XRRA 2V9ZA 1A88A 4EY6A 2OAGA 2BAGA 4OUKX 4GBGA 1ZJ5A 4X3CA 5JD5A 2VSQA 4OU4A 3BL8A 4AO7A 3B5EA 4ZRDA 4PQEA 1O6GA 3QPAA 2OAEA 1WB6A 4QDZA 4DMKA 4KAFA 5ALUA 3WZMA 5HF8A 3C8HA 4AB1A 4U2BA 1CUJA 4MYSA 4F0JA 1OXMA 1W1IA 3WKDA 4M0FA 3E1GA 3AIMA 2HFKA 5ALXA 4RE6A 2HL6A 2XQKA 3D7RA 5JZSA 1DWPA 1JI3A 1JMYA 4U2DA 1WM1A 3IBTA 1XRMA 3LIPA 3G0BA 3DD5A 4UBOA 1L7AA 1QE3A 4W1QA 2JGKA 1VA5A 5T4BA 1H22A 1XZMA 3B12A 3BF8A 4Y7DA 5C7YA 5AKXA 2XMQA 4XJVA 2XUPA 2WHPB 4PSCA 3VXKA 3WIOA 5DWDA 4P08A 2JF0A 5A6VA 4IO0A 1J1IA 2O2IA 1K5PA 4X6UA 4FWBA 1U2EA 3SK0A 5LZ7A 3GROA 3IULA 4L3WA 2XMZA 1DINA 5AM2A 3ESBA 2HU7A 4IQ4A 1AMNA 4UHHA 1XZBA 2BUCA 1XKLA 4UFNA 2WIKA 1MX1A 1ZIXA 2XLBA 4E14A 1XZDA 3BXPA 4Y2PA 3ZWQA 1BCSA 2WUDA 5AKEA 1CEXA 3QZUA 4X6XA 1EVQA 1CUAA 1XZGA 1W52X 3VKFA 4BTLA 4J03A 5AKZA 3IB3A 2JGEA 2WQZA 4QLOA 4F5ZA 1EDBA 4J0GA 2PKYX 3IIIA 1LZKA 1EB8A 5AM4A 4X71A 2OCKA 1NU6A 5KREA 1XQXA 5AKGA 1W76A 4S0XA 3OPMA 4BRZA 5LKRA 4X93A 4QA9A 5K3EA 4DNPA 2C0PA 3F9CA 2ROQA 2AJ8A 3C45A 3WMRA 2CUTA 4Q3LA 3EQ8A 4WDRA 3IUMA 3A70A 3G7NA 5ALVA 2XT0A 1L7RA 1C4XA 3WWPA 3FLEA 3WI7A 2DFPA 5E2IA 1CUIA 5HCUA 5LZ4A 5ALGA 2WM2A 3VJMA 3T4UA 1UK9A 4GHWA 4NVRA 1XLVA 5CH5A 5BOVA 3STVA 5FOQA 5CT8A 4WY8A 3SWWA 2YYSA 3ANSA 1FFCA 4WFJA 1ZOIA 4U2CA 4ZREA 1QONA 1E8NA 3DLTA 3KSRA 5SYMA 3WKEA 3FLAA 3I2GA 2G63A 5IKXA 4ROTA 2YASA 4U2EA 1KU0A 1CUFA 3MUNA 1SCKA 1ZJ4A 4OPMA 2BCEA 4HRYA 1MAAA 3IURA 1VE7A 2QM0A 1BCRA 1IUOA 3WYDA 1CQZA 3H2JA 5YASA 1YA8A 4LYDA 4ZV7A 3FVRA 2WIGA 4JH0A 4QDTA 2O7VA 4BTVA 4Y2SA 1DQYA 1TQHA 4BE9A 4B82A 3MVEA 4G8BA 3HRHA 3I2FA 4B6GA 2JBWA 3WK7A 4IH4A 4GDMA 1FFAA 3C8DA 2HFJA 5AK5A 4ARAA 3DOIA 2G4LA 5ALOA 2J3QA 1ZGCA 3STXA 2XMSA 2OXEA 4OYYA 4FLFA 1F8UA 1UK8A 4B83A 3WJ2A 3M3DA 5HKAA 5JAPA 4UFOA 1RP1A 2W6CX 1IMJA 3CCCA 1TCBA 1U4NA 2VA9A 1ZI6A 2XUHA 5AM3A 3K9BA 2B20A 3O9MA 2C4HA 3I6MA 2XUIA 2WILA 2DCMA 5EIAA 2ZJ6A 3H0CA 1BE0A 1IUNA 2ECFA 4BVLA 3DKRA 3PFCA 2RAUA 3EQ7A 2AJDA 3DS8A 4N5HX 5JYCA 3AUKA 4K2AA 1GQRA 1TCAA 4Y2QA 1VZ3A 4X94A 4BAUA 4ARBA 2J4CA 3ZLTA 1F0NA 5ALZA 2AJCA 4KE8A 3DYVA 1NU8A 4FFWA 3AZQA 1TK3A 2QOEA 4AMYA 5JADA 1YB7A 4RPCA 1E66A 5EHXA 1CUGA 3VVLA 3FAKA 1HLGA 4G9GA 1YAHA 2OG1A 3FYUC 1CPYA 5EFZA 3LLCA 3M81A 3KDAA 4B0OA 3DNMA 1SOMA 4BCBA 1FSSA 4X90A 4QZVA 5FRDA 5ALHA 4Y2TA 3L1IA 1AC5A 4B84A 4QLAA 4CCYA 4YPVA 4MQMA 1LPSA 1Q84A 4J0HA 1B41A 2HU8A 2BGNA 3FCXA 1DU4A 1W6RA 1WPXA 4BZWA 2Y2UA 2HM7A 1DT3A 2UZ0A 2IIVA 3ICVA 2Q0XA 3D4LA 3WLAA 3U1TA 5DNUA 2AXEA 4AZ0A 4C4YA 2QRUA 3AIKA 4DYHA 5JIBA 2HA3A 4HAIA 5D3KA 4X95A 1DT5A 5FKJA 3JWEA 2BJHA 1ZD5A 4X92A 1Q0ZA 4C6HA 1CUWA 3IVMA 2H7CA 1LPBB 1K4YA 1LPAB 5CT5A 1VJ5A 1CUEA 4RGYA 1RYYA 5ALMA 1QJ4A 4N8SA 1HQDA 1UOPA 3W2TA 3WL5A 5CT9A 3HACA 1THTA 2QVBA 4LIPD 2XUOA 2B4KA 4P9NA 1MT3A 1R88A 3GZJA 3RKSA 2RHTA 4A23A 5KWIA 2ZYSA 2OCGA 2XE4A 5I7UA 5LZ8A 3NUZA 4UUQA 4NZZA 5CXUA 1O6FA 5ALPA 5IVIA 3HC7A 1IUPA 3F8SA 4OCZA 4C87A 1QIJA 3DEAA 4UBNA 3ZV7A 4GECA 4CFSA 5IVHA 2XUFA 3WJ1A 4ZXFA 2H7YA 3D2CA 4INZA 2XUQA 3H1BA 4UFPA 4L0CA 1LZLA 4B81A 4X6YA 3W05A 3E4DA 2ORYA 5A62A 2GZRA 3DYIA 1HKHA 5K3CA 1VKHA 3CCBA 2I3ZA 3HSSA 4BC1A 1QIMA 3G9ZA 2QR5A 4H18A 2VAVA 4WFKA 4H0CA 2NW6A 3F97A 1UT6A 3A2MA 4OB6A 5AOBA 4EUSA 4JEIA 5J3JA 5FXMA 2Y6VA 1XQVA 1VLQA 1P0QA 1WB5A 2VT6A 2WJ3A 4EA6A 2ZYHA 2DHDA 2WKWA 2JEZA 4CG2A 3HI4A 3F96A 2XQJA 1GPLA 2WTMA 4BAZA 1E8DA 5AH0A 3G8YA 5CMLA 3WQHA 1LNSA 5AI8A 6YASA 1WOMA 1YB6A 1LBTA 4GEGA 5D7BA 5AO9A 4PW0A 1RWQA 3BF7A 2WG2A 5ESRA 2VT7A 1QIFA 2XUDA 2I78A 2HA6A 1R9NA 1GPKA 4Q1VA 4LXHA 2XMGA 4BVKA 5EIHA 3PUHA 5ISMA 1XLUA 2WFLA 4AZ3A 4Y2YA 7YASA 1WCYA 2XI4A 3G0DA 1A8UA 3WWDA 1BN7A 2XUKA 3BJMA 2V96A 4L9AA 3LCRA 3DCNA 5CRIA 3V9AA 4FHZA 1XQYA 1ZICA 4J0DA 5AIAA 3PF8A 2HRQA 4KACA 2VJAA 3ILSA 3R41A 1QFSA 1YR2A 4QDOA 1JJBA 3DOHA 1XKTA 3HLKA 4P92A 4ZV9A 5EHQA 4G4GA 5IVDA 5HFAA 1X2BA 1VOTA 3PFBA 3SX4A 3I1YA 2J4FA 3FWHA 2XMCA 1WHSA 1VA4A 3A2NA 1AGYA 3C5WP 3QYJA 2VF2A 1XLWA 4DTCA 4FLMA 2DR0A 2XDWA 4H7DA 2CBGA 1XRPA 2V97A 3WA6A 3OOSA 5K3FA 3W9BA 1UKBA 2ZSIA 1SC9A 3O95A 4H77A 1ODSA 4ITVA 4OB8A 3WWEA 4HS9A 2Z5GA 3VISA 1XRNA 4AX4A 3H2KA 1BN6A 1VZ2A 5HZGA 3WIBA 4B85A 4PF1A 1R1DA 2JGFA 4H7IA 2CMFA 4N8EA 3GFFA 1J07A 3H1AA 4TVKA 4U2GA 4LXGA 1E8MA 5ALNA 3YASA 2ACKA 3D2BA 2Y2VA 3HZOA 2XUJA 4BDTA 5KBYA 5A7HA 4UHBA 2VJDA 1WB4A 1X70A 3G9UA 1CUSA 3DQZA 1H2XA 4QWMA 2WIFA 4D9JA
chains in the Genus database with same CATH superfamily
4DS3A 1L4LA 3AWDA 3PNKA 4K03A 1TA0A 4JA0A 3RVDA 3A4VA 5FO0A 4P5EA 2CFTA 5CB4F 5BN3B 4UTVA 3HVIA 2F1IA 2WU3A 2YCLA 1JR2A 3DTTA 2RH4A 4ODIA 4Q4LA 5LJIA 2X23A 2XRFA 3D3NA 4UZEA 2FWBA 4GYWA 2MR6A 1S2IA 2XGSA 5AWFC 3HBMA 1P1JA 5C4GB 1TAUA 4BFXA 2C88A 3ZYZA 4R16A 1YDGA 3I6YA 1TW3A 4D3ZA 3DMGA 2ZVDA 3C70A 2C5GA 4H1TA 1U1GA 3CEJA 4O0MA 5JFOA 4MH0R 3MIZA 4QRDA 2QRLA 2WHEA 1XQ6A 2OCLA 4LPKA 3RW9A 1JFSA 1Z68A 4D82A 4PZUA 3NZEA 3OTOB 4B31A 3AGQA 2PJZA 2HDOA 4G2NA 1R5JA 2ZTUA 4C14A 4IZIA 1THGA 4CGZA 4AULA 1L4KA 1AUPA 1HT2E 1U80A 4E21A 1J9EA 1YDMA 1B93A 1SQ0A 1W0KD 5TXGA 3A36A 1J00A 1KJYA 1E0KA 4XUCA 5BR1A 3ED1A 1PFQA 2CWWA 2DQKA 4PQGA 1M1UA 2NYUA 4Q4HA 4EO9A 3AVYA 1GARA 4WVFA 4HP8A 1ECFA 4B71A 4W9RA 1YACA 3MWGA 1CDZA 2XMRA 3DLIA 2IX9A 4KQXA 4PLFA 4RZIA 3UAOA 1X87A 3MTQA 1V7CA 3RK4A 1SXJE 1Z0KA 2YXPX 3G5LA 4D3DA 4B6JA 2ZCJA 4HXEB 3O0DA 2QX4A 1Q92A 2ZRIA 4XYGA 1XHFA 5E3HA 4CCSA 1RAIA 3LVFO 4WXEA 3ORSA 1VBMA 1FLNA 2N47A 3VUEA 2DKNA 2GFHA 1KVRA 3ZJ5A 1WG8A 2JHPA 3QE2A 3LRTA 2HR1A 1J2TA 5A5GA 1X74A 1RAGA 3QSYA 4ALNA 3OTGA 4FBGA 1HT1E 3AKEA 3AF6A 2ZRNA 3A1UA 3ZHXA 5CLLA 4WADA 4NSNA 3BICA 2WNHA 4DQDA 4B3SB 5ALRA 4W8OA 3ZDFA 2CK3D 5FWXB 5JS8A 3R3WA 5K3AA 3VRHA 1Z5OA 1YQWA 3IMGA 3SG0A 5JZOA 1DXQA 4O4JF 1F2TB 1Z82A 1A7UA 3VZPA 1N5LA 1G20A 4RF2A 4TXLA 4EUKA 3H2YA 2FJ0A 3LPMA 4XX0A 1JAYA 4C7MA 5L4NA 3FJYA 1YZGA 5CCDA 2IWRA 2BIFA 2A9OA 2HA4A 5DHFA 3IRVA 1XZIA 2FUCA 3B8HA 4OD0A 3WXBA 2HLPA 1DHRA 1U1DA 3KDSE 4HX9A 1DQZA 2IDMA 4DGQA 3CEPB 4WNAA 1CEEA 3WK8A 3AF4A 5IT5A 4E11A 3H3FA 4RSRA 4HTFA 3TO5A 1SQ6A 2ILTA 1YS9A 4EI9A 3GT7A 4ZTUB 2PQ0A 1T91A 2Z6AA 5CVTA 2VFAA 4JENA 3DMTC 5G4KB 5TGTA 1N78A 3R7DA 1W1UA 2QUKA 2W0SA 5WRFA 4KRYA 3PTZA 4FDTA 3GJQA 4LXYA 3VMFA 2ENUA 1T35A 3A7EA 1Y80A 4YBZA 1T8UA 1EK6A 4RD0A 4XDYA 1G2PA 2BDEA 3TEMA 1EFDN 1GCOA 3QKUA 4UAVA 3CYFA 1MFPA 5TPZA 4YCCA 4BYGA 2Q1XA 1DEXA 3GF4A 4PVCA 1EA7A 1OC4A 2N46A 3WGVA 1XTKA 4EB6A 4WA8A 3ZU6A 3ULKA 2XCIA 4G0YA 2VBIA 1QQ5A 1IQPA 2QT9A 1GNPA 3HVRA 3A05A 1N9ZA 1NV9A 1GKLA 3SC4A 3C7TA 3O73A 1EEXB 4ZVNA 5AP9A 4DSZA 2EBFX 5E4TA 3WFZA 1DAHA 4Q1BA 1LNZA 1EVKA 1DWOA 2FKNA 2IELA 3AP1A 5AI4A 5KIAA 4NBLA 4R2MA 2PMEA 1W8DA 4XLTA 3BZWA 4YR9A 1IAQA 5I7RA 1EFCA 4Z7QB 2VZLA 4JLAA 5J2UA 1T8TA 2QAGC 4C0AC 4S1WA 4MW2A 5DVZA 2PBLA 4FUTA 1E94E 3AUSA 3B6KA 3K6JA 3KYBA 3UH0A 4HRAA 1HYQA 4W5NA 2WAXA 4KNVA 2ZE6A 1E1QD 3OEED 1SBNE 1G291 4MAAA 4ENTA 5EJ7A 3MM4A 2PGAA 1A5SB 1JA1A 2LWIA 4QU9A 2R2GA 4FYHA 2AKEA 5ARBA 2ETVA 3HB4X 5DIZA 3ZKAA 3QF7A 1Z8NA 3HU5A 4ZVTA 4Z7JA 1SXJA 3I61A 4B9EA 3BJRA 1KDRA 5FPYA 3RC7A 3RHSA 4LOJA 2VK2A 1MIOB 2C4WA 4TV9B 4QARA 5TQVA 3UJBA 3Q9UA 1TJYA 1B73A 4JITA 4XIYA 1RI3A 5EQFA 2W7TA 1UP7A 2BGUA 1H9AA 3MQFA 2AQHA 3CLUD 2B98A 4J1TC 1EZ4A 1I7NA 2ODTX 3KKLA 2A35A 1PQPA 2GM9A 1U5CA 3PQ2A 4I8DA 4EJ0A 1J0DA 3AINA 3V7WA 4F5YA 5A9SB 3H65A 1ACJA 5KJ1A 3PJEA 1CJSA 1FS5A 2A14A 4K40A 4Y2RA 1IH8A 4MJXA 2IGBA 1QGED 3ROPA 1XAIA 1W34A 2AOTA 3TR5A 3ZI0A 1W2HA 4QYSA 5KTTA 5K5EA 2R8RA 5EXEA 1XMPA 5ANRB 3T1NA 1O6CA 1Z62A 2RGUA 3N3AC 1OIXA 3NOXA 3QKRA 1DBVO 5H4HA 4GLLA 3V8MA 4RETA 5I3ZA 1EDDA 2G1AA 2C7PA 2E82A 3EODA 3V8QA 4RY2A 2HPZA 4WVLA 4Z0TA 1SAYA 2J59A 4S2EA 4B4UA 4RD6A 3KELA 1ZRNA 1N2OA 1PW5A 4I4LA 4EM6A 4V24A 2FZLA 4G5FA 5MHTA 4WOKA 1NQAO 1SZJG 5DFAA 1QH9A 3KXDA 4UNNA 4D9EA 1MO5A 4TMVA 1U0LA 4H59A 4REQA 4WQMA 5T67A 1UMDB 3RRBA 2MYUA 4KIWA 1UT5A 2ZB2A 4KI0A 4C7BA 1Q14A 3LQKA 3WLEA 2PT6A 2H4YA 3LL4A 4Q01A 2WD7A 4TLDA 1YZHA 2ST1A 4U8GA 2VHEA 1UBNA 4H2DA 4LYYA 1EBUA 2GAAA 3HP1A 3KE9A 3QU2A 5EGNA 5FBWB 4QPJC 2G09A 1TF7A 4PE5B 3TJRA 5LLDA 4MUHA 4R8MA 1V1JA 1C9DB 3ZNQA 2OCXA 5ICGA 2H9YA 1TKRA 3GMDA 5FT9A 3WL6A 2GCNA 2Q4BA 3R5SA 3R7WA 5FV7A 2FSUA 4CUJA 3HYCA 2QNIA 3OHMA 3VNRA 2PAFA 1D1TA 5KNDH 1T5DX 3AL3A 4M9SA 5K0JA 3TLYA 2ZRLA 1BH6A 3ND6A 4LJAA 1JNYA 3L6UA 3OEYA 4NRDA 5IUJC 1Y1SA 4AKTA 5BUCA 1WUJS 1JP7A 3ZZUA 1UOQA 4TLMB 5FA5A 5I48A 1AT1A 3BYZA 4G9BA 4J7CA 2FPKA 5CXXA 4ZO8A 3TIIA 1S3FA 4PSUA 3K70C 2IZ5A 1TIBA 3G02A 1PJTA 4W9NA 4EQ6B 4NCJA 1NL3A 2B5OA 4EO4A 1LF0A 3RM3A 3THWA 2QBYA 4ZVVA 5AKYA 1SOVA 1SUFA 4RTRA 4X1IB 3WKBA 4DRXA 1QORA 3KQTA 2XYHA 4JI6B 4JUIA 4B9AA 3TIXB 4DIFA 5CCBA 3PKJA 3AF3A 1JXAA 2G06A 3RUCA 1N3IA 4NE9A 1E62A 5JXHA 1M8PA 2IYSA 2YWJA 3S68A 2C7GA 2AR0A 3CR7A 3ZQJA 1DVRA 3LP5A 4O4LB 4YQZA 3TI9A 1EVEA 3ZWCA 4WZAE 2E4YA 3D0QA 3MLEA 3O8OB 4UUPA 2MSNA 3GP8A 3E2IA 4DUYB 1TUGA 3EIWA 3AVOA 4MUIA 3T8YA 3V4ZA 1ZCAA 1LX7A 3P2JA 4ZAWA 1RFGE 1TUIA 1M2OB 3G13A 5LCXA 3U0BA 1ULHA 4RTKA 3RVQA 3TJZA 1UP4A 4RK1A 2ODEA 4NZPA 3TCNA 3W79A 1MVOA 1DGQA 4L1KA 1BFDA 2CMGA 1HOXA 1HE1C 1QPBA 1HDCA 2Z8YA 4FHFA 4GX2A 3CO0S 3LPDA 2VL7A 4ND4A 4EVRA 6ABPA 4DFDA 3O4GA 4RTQA 4YYEA 4O4HB 2X5NA 1ISSA 1G3MA 4PZEA 4AF7A 1LA2A 5AM5A 3UVEA 4C4PA 2Z3VA 5C5IA 1E2BA 4MHTA 3BXOA 1BW9A 1WQ1R 4ETWA 2GAIA 1B43A 1DUSA 5JCJA 5CA1F 4J4TA 3W5BA 2NPIA 1KOFA 3PFKA 4BU1A 1O8CA 4HYYA 2HQ1A 3PPVA 4HLDA 4DMGA 3EXFB 3ISJA 4K9PA 1USIA 4XTCS 1XNRB 1XA0A 1PCXA 5HF5A 1N0UA 3P2MA 2DULA 1XWWA 3GDOA 5DI3A 1T9GS 2DF8A 5KYXB 3D8HA 4ESOA 3IELA 5J2TB 3NBXX 3NJ8A 2XOEA 3LKZA 2BYTA 4ZK2A 4B2YA 3I6ZA 4B3GA 4RABA 3T9BA 5CIYA 3LYLA 2VO1A 1O54A 2C9YA 3DO8A 4GVLA 3K6SA 3OQOA 3WRYC 1U5BA 5TE9A 2MSEB 2NO6A 2JD0A 1FTNA 5D3MB 5EJAA 4K81B 1AS0A 1YCDA 3PU6A 3SHFA 1RKUA 4FNMA 1E7RA 5EJ5A 1WZEA 2BPOA 3IOMA 4BXOB 3JWGA 2CLIB 2P77A 1SJ9A 1XZQA 2HQOA 4EI8A 1NVTA 2GK3A 4MNTA 2KHZA 1PTKA 4NJEA 1KNXA 3K1JA 3QE9Y 4N9QA 3EFOA 1KSGA 3H4MA 1X0XA 4I66A 5LBTA 2OBBA 4Z0PA 2VYQA 5JAHA 3V1MA 2GESA 2GYWA 2NUBA 4DLRA 5DNCA 2CHUA 3FF4A 3HJNA 2CXUA 1ZDMA 3KR1A 2IODA 4DL9A 4YJFB 4AL4A 3DAFA 4ES6A 3OE7A 2QDKA 3OPXA 4H08A 4A9AA 1U0GA 4H0NA 4ZC8A 3FFTA 2OO5A 4PCAA 4WERA 2CXNA 1K63A 4EHAA 5EHZA 5ES4B 1SO8A 2QX7A 4DZZA 2O3TA 2ZYWX 4JC5A 1DX6A 1GVHA 3O8BA 4W82A 3DHYA 2FSIA 3QQPA 4L5CA 4NOJA 4P2GA 1GM5A 2FW9A 5A9TA 4BNVA 3LPAA 2RI1A 4XH9B 1D2NA 2V7VA 1UOEA 2LRHA 2Q5OA 3I9FA 4FBLA 5FFMA 2GERA 4A27A 2D00A 5CNIA 4BQPA 1PL7A 4CG0A 4HCJA 4CLOB 2ORVA 1ZVQA 2PIAA 2V6JA 5IM4A 4MV1A 2V5UA 2UAGA 2B1GA 3OC0A 1HDOA 4K9OA 4KN5A 4DR7B 3AVUA 3IAHA 2VWGA 1QO7A 3R77A 1VMDA 1JHQA 1T8WA 1PKXA 1E58A 4M1QA 3MRXA 4L5YA 4QTTB 3S2EA 3RHZA 3UWMA 2H5EA 1WV1A 3SZ3A 1TQ2A 1ZUIA 5TEWA 2ZYUX 4FZJA 4B8YA 3UENA 1P8AA 5AVYA 4DIDA 1WTAA 3I30X 1FYFA 3FSGA 2I2WA 4LQDA 1NF8A 2Q2WA 4WZAB 3SHOA 2IITA 4X1YA 3VI3B 5A1JA 4POAA 2XB8A 1N7HA 4KQ2A 3QYAA 2QPTA 2SCUA 1PQWA 2ZDQA 5EERA 3NHRA 5IKEA 3RSOA 4WBNA 1U8YA 1I5OA 1TC2A 2VPIA 2GCPA 3KJNA 2H5IA 3I12A 4N0DA 1K3UB 2FFAA 2X5OA 1XZHA 3ESXA 2AE2A 4U02A 5BYJA 1JTVA 1O5OA 1KI1A 3UTCA 1Z5NA 2HJVA 2A0WA 3GJXC 1EK2A 4JNKA 4RFSA 1G8YA 4XVQA 4CM4A 2D1RA 5IDQA 1U7TA 3HXOA 3OOYA 1EE9A 4D9IA 1OZHA 4H3HB 3RFXA 3T3HA 3WZLA 1X2EA 2B6HA 3I04M 4BQNA 3TRDA 2BUBA 4JGBA 3D8RA 4YJDA 1DKPA 4FR0A 4YQFA 5LVAA 3WGIA 4Q47A 1NG1A 4D0RA 3GJTA 1T0IA 5BT8A 2IXGA 1OFGA 3BMOB 1X7DA 3JATB 4XOIA 2I1VB 3OTQA 3A3KA 1BZYA 1L5MA 2VLBA 2NMVA 4HSGA 2Z8XA 1CP2A 2C9BA 1OSNA 4J8PA 4UOZA 2B78A 2BGMA 5JAOA 3ZE0B 1ZK1A 3D2AA 1JIVA 3H17A 4JVLA 1WU7A 2EJCA 4G07A 4KW7A 1JBKA 3FKJA 1UKCA 1ZG3A 4YMVA 1QKIA 4YK7A 1KQGA 1OLOA 2ZBFA 3RS4A 1LVHA 2OBYA 3ZDBA 4U9IS 1QE0A 3NJRA 3UMJA 2EATA 5I7WA 3CJRA 4MVJI 4HRVA 1IVYA 8AT1A 2FSHA 4F56A 2NUTB 1B42A 1LSUA 1I30A 1PK9A 3IDQA 3DONA 2X58A 3GEMA 3OX2A 3EUWA 1WOYA 3NTRA 5EZQA 1C7ZA 3GD5A 4KN9S 2RE8A 1OIVA 1ZN2A 4J3JA 5KYNA 2YFQA 4HEA6 5KYTA 1QTQA 2BT4A 1CD5A 3IVCA 4BVBA 2HDWA 3AJAA 4QYTA 2Y67A 3LQFA 4E2WA 4K86A 2XRZA 1Q1NA 1M8GA 3PHLA 3QBDA 3OHSX 5JCZA 1JJAA 2AFRA 1IZ7A 4ZU6X 1ULAA 3IT1A 3T5TA 1ZW1A 3U1VA 1VXOA 3PUIA 4FYWA 3NDPA 3AFMA 1OVGA 1MAHA 3UPTA 1SY7A 1QVWA 1Y7TA 4B3BA 3L8ZA 2YZGA 4Z1MA 2CXRA 4BKRA 2XGOA 3NO4A 3B82A 1RABA 1ZH0A 4GL2A 4H7EA 2B37A 4Y9DA 1SBTA 2ZYIA 5FB3A 3W34A 1OY1A 4MS3A 5DBHX 2YIMA 3OUZA 4GLOA 4CKBA 2YJZA 1ZH4A 1XZFA 3F47A 4IIJF 1R4MA 1F51E 1XK6A 5FEUA 1LSOA 3M5DA 3RTAA 8OHMA 2H63A 3ETHA 2IY8A 1QLJA 3WISA 3QLUC 3VV3A 1KS9A 1J9GA 4AK9A 5A4IS 3LQYA 3IR6A 4EUEA 2B8JA 4PAQA 1L4BA 4R1UA 1HL7A 2QM3A 5KAMA 4Z7NB 1VSVA 3M4YA 4HMOA 4BRSA 1DQSA 2AEFA 3ENQA 3NIFB 1P81A 4B40A 4KVZA 1KY2A 4ZQGA 1DEKA 3R0ZA 4AY4A 2QUZA 3AUUA 4Y2JA 1TVCA 4BMPB 4KE7A 3C41J 3ML1A 1Z6ZA 3HSKA 3HDQA 1XMQB 2CHFA 4ME6A 1FVOA 4RDXA 4PHTA 4FOOA 2XVMA 3I2KA 3CRMA 3UWKA 1I01A 4EW3A 2VSNA 4TRRA 4HFJA 1NUTA 3LYUA 5KQGA 3GJ4A 1HE4A 4Q6WA 1JQLB 3N58A 4U00A 1BROA 1X38A 5H4GA 2VP9A 1A5ZA 2Y92A 4MINA 3TTTA 2A57A 2QVGA 3ASUA 1BC5A 1CULC 1LCIA 4EZEA 1YGYA 3PHHA 5L7YA 4JYZA 1GILA 5IC5A 3DBHB 1GQSA 2XWPA 1ODKA 3L5OA 4MS4A 5KNCA 1XNJA 4GR4A 4XWKA 1L4EA 1IE3A 5CX1B 5ECGC 3RWMB 1E9SA 4CMKA 1AZTA 4MV9A 2ONCA 5TF0A 2ESRA 4X85A 3VU9A 5KVSA 4F3TA 4B6SA 1O95C 3U6BA 3ZE9A 1ZD1A 2JIPA 3OM0A 3VZCA 3N6RA 4HS4A 4OL0A 2B36A 2PWPA 4H3KB 5HDQA 2HF9A 4BP3A 3OCUA 1ZWLA 1JHYA 1PT5A 5JD6A 2XCQA 4Q37A 4IDQA 2HYIC 2DUUA 4WASA 4YI5A 1B00A 1I1NA 2OGTA 4A6XA 1S8OA 2RHLA 4J7UA 2MMGA 2PR7A 2QXYA 3FHLA 4X24A 4WZAA 1PR6A 5DXJA 2QZZA 3UW3A 2GJ8A 4ND2A 3IOCA 4ND8A 2EV9A 3LCCA 3C97A 2YV1A 2OBNA 3DBIA 2OKCA 5IYZF 5AW2A 2VEDA 1PGPA 3S2YA 3G79A 1NMSA 1TJPB 2QP3A 1AK2A 3F6SA 5IABA 1YUMA 5KOJA 1YFLA 3CVOA 5C8YA 1AGPA 2XZDA 3D0RA 2H1HA 4L4RA 1E5LA 2C29D 2NADA 4TL8A 2E4UA 5JPIA 2CSXA 3C43A 3H7IA 1RI4A 4QOHA 1QK3A 3D4OA 4YMLA 3LQ1A 3TMKA 3UKJA 4ZI3A 4YIKA 1WKBA 4XWGA 2V59A 4MK4A 3WAKA 2FEAA 3HA2A 3OOJA 4XZ3A 1ZI9A 1LBSA 2D1FA 2CXQA 3WKAA 1Y8QB 1PGOA 4OFWA 4W5OA 4EDFA 4KH1A 2EKZA 1Y5IA 4CIDA 2Z8YM 3RADC 4TTQA 5EKXA 1QTIA 1PTJC 3A6LA 4B3RB 5BSKA 5CBPA 1KY3A 3D6TB 2XWBF 4ENPA 1J33A 3R6DA 2PRKA 4JJAA 1RPAA 4OL9A 2PUCA 3LJKA 4TXNA 2X9NA 1K92A 2RGNA 3WK4A 4CM5A 1ZUD1 5SY9A 1FMLA 3QTBA 4AXXA 4LEIA 4I3GA 3RYIB 3RS9A 1DOHA 3IA2A 4PV7A 2EKLA 3HZHA 4MUMA 1C81A 5HGXA 2HW8A 4QOFA 4LDRA 1AUQA 3RF6A 3LW7A 3X1YA 2P4HX 3A58B 2CDNA 1KEZA 2BV3A 1VLJA 4AWAA 1X9GA 2XDQA 4KAAA 3P1JA 2IEAA 1FLAA 2PU5A 4K1XA 1XP5A 3C3AA 4LJSA 1WL8A 5IW8A 4AI6A 2PG3A 3MTDA 2PK3A 3SZLA 5K3DA 2SCUB 1BU8A 1E3QA 4QUHA 3HDYA 4E2FA 3OIUA 3GJYA 5FUQA 1CETA 1N25A 2BFFB 2C2HA 2V7UA 2ZITA 3IDAA 3UK1A 4D1YA 4YRMA 4HX5A 5ESWA 3HTXA 2HJSA 4CL2A 3NEYA 3TW8A 2H0AA 3C4QA 3WDLA 4PSDA 1UEXC 4OX9Y 5ALYA 4KC0A 2H17A 3GN2A 1N5KA 4IDBA 4M8NE 2AWNA 2VF5X 4FWIB 2ISQA 4MIKA 4TTTS 3ONNA 4LGYA 1DKLA 3AUXA 2G88A 2W8BB 2OC9A 4UQOA 1R5NA 4RH3A 2F7SA 2E1PA 3I5YA 1AHNA 4FGUA 4WY5A 1MW8X 1BOFA 1YBFA 4TKLA 2YJGA 2XOKA 4DT1A 4OK6A 1R6AA 3M6VA 3NBQA 4FINA 3EH2A 2NQ8A 3E82A 3KOYA 5CHYA 3UJDA 1E7YA 1H4VB 4BVFA 1OJLA 3J81A 3ABIA 3WQRA 3CY6A 1NOJA 1QLWA 3PYMA 4IEFB 5EXXA 4TYNA 3C5VA 2HSJA 1RXYA 2WFZA 3FNHA 3KQPA 3MG9A 3D02A 5LKAA 5FOVA 1IY1A 3UUEA 1KZ9A 3IPYA 4X8MA 4Y1FA 1OW3B 3AF0A 3GGOA 1GVNB 2HK9A 4K5QA 2Z9BA 4C03A 3RF7A 4MX8A 4D6PA 2VJCA 2PGNA 1QRAA 5IHPA 1PS8A 5KYYA 1SVWA 1CUXA 2FU5C 2WYUA 1SCJA 4II3A 4B2PA 2J48A 4WT7A 3GHYA 2Z09A 3PEVA 1KMIY 3OJOA 3PX2A 4R0NA 3V9PA 3BPSA 3VR3D 1IN8A 1ISPA 2AMJA 4M37A 2BSXA 1XTJA 4UNIA 5KTNA 4D6YA 5D87A 4EEKA 3KJZA 5J5VA 3RFVA 1Z7WA 3I5MA 3HGMA 1BKYA 3QM1A 2C4VA 5TC4A 1QGDA 3TLGB 3GRUA 3V00A 2W11A 4QYIA 4UUNA 4WKBA 1ORWA 2A7QA 1HE2A 1VJDA 3SU8A 3CLTD 1ZONA 2WFLB 5B7NA 5CYPA 3ABRB 1TECE 3G5AA 3ID6C 5L8VA 2UXCB 4A0SA 1YCHA 2FV8A 3L3BA 4HFNA 1SBZA 2UUBB 4BN4A 3O8LA 1OE0A 2XTJA 1N36B 4PYOA 2V4UA 2O8NA 1H1LA 1D5CA 1G59A 2HK6A 3QENA 3NHWA 1L5QA 4WCFA 2QMZA 1NAIA 2IEDA 3TTVA 4DLNA 4WN3A 2GPJA 3FBWA 5K3SA 4ABTA 1P9LA 3BBLA 2QRNA 3LX4A 3PC3A 3SSOA 5EJ9A 2GTPA 3A1VA 3QI7A 2JI7A 5AW8A 3VKWA 5FCDA 2V74B 3QOXA 1GHTA 2QS9A 3VFDA 1CEQA 4BC0A 4BIMA 1JDNA 2E4WA 2ONZA 2OXRA 4N18A 2QJWA 4B6QA 2FG7C 2G70A 2ZVPX 3RDPA 2AOUB 1PDVA 1XTPA 3GLQA 3IODA 2HO5A 2GBLA 4HMQA 1S5PA 3X44A 4KREA 3A27A 1NZFA 3S5JA 1UWCA 4QODA 3O4RA 3WNDA 3C48A 2Q2NA 1UXJA 3ENWA 4HZUB 4BQSA 4M6WA 1RC0A 3ZTWA 4RKFA 3N8DA 4PPFA 2DQYA 3MZ0A 2H1VA 3PITA 3QH4A 3N05A 3ZWPA 1Q0TA 1BS1A 1RJ9B 3G6WA 3HH8A 4C6RA 1R8JA 2C0QA 3QX3A 1DX4A 3PEWA 4MV8A 4FIZA 1KC3A 1E9CA 2EFYA 4MV0A 1GXSB 1HYHA 2R00C 4YRAA 3RC1A 2I2AA 1SVOA 4UEKA 2Q5IA 3GUYA 2GD0A 1OAOC 2O23A 3QPUA 1ZIDA 3AYXB 4JWKA 3CZMA 4JLNA 2IYXA 4F1KA 1OXUA 4O1MA 4QGBA 1SIUA 2OP1A 5JSZA 4XOUA 3FRIA 1U3UA 2CHVA 2PWAA 2ZJFA 4OOEA 3SHWA 2Q5QA 3K70D 1NVUQ 1YQDA 2LIVA 4O08A 4EYEA 5JDIC 1OWNA 3GJZA 4FD2A 1R4AA 4D43A 4NJMA 1ESCA 4U9HS 5H3HA 3NT5A 2RHGB 3GFTA 3LGXA 4G5GA 4UDYX 3ROKA 3TNYA 4NLLA 1DJLA 4LYHA 2OGWA 4O2AB 1YV9A 2R68A 1NLZA 1JG3A 1G9SA 3MS7A 4D3SA 1U0BB 5FI5A 1H23A 2Q4DA 4L4YA 3RSHA 4A2PA 3KSBC 3KOZA 5TLSA 3BRQA 1RCFA 1Z13A 3EVAA 3NGMA 3LC2O 4A0FA 1Z6AA 1EI9A 1JLSA 1NJSA 1FB5A 1CUDA 1ZC3A 2W2OA 5IU6A 4RF5A 3ZDDA 1SIWA 3K9NA 4RVCA 1NW5A 1I6KA 3UHFA 2Z1DA 5CH8A 4YAIA 1C1DA 1Z6QA 4UPDA 1C7RA 2FH5B 3NFRA 3PJGA 5J4YA 2JLWA 2L42A 2GZSA 4O2LA 4I2NA 3CLRD 1OZGA 2OV2A 1KVSA 2PU7A 3KT0A 1XMVA 5DX8A 2VTBB 4JWTA 5I9BA 2J4DA 4DBVO 1LVGA 4CKXA 1B6RA 2J41A 5AOVA 3VR4H 3WGZA 2AFIE 4LI3X 3VHRA 5JS6A 2DWPA 3MJTA 5FTNA 3O92A 4C29A 4QKQA 4EI7A 1YA4A 3JSAA 4J91A 3AWIA 3SJUA 3E9RA 4BCDA 5LDGA 3E5MA 3IVAA 4Q12A 1T9DA 3SFZA 1H0KA 1WMFA 1Q7CA 1NJ8A 2Q4RA 4HQLA 2AKYA 1A5AB 1IEXA 2WKRA 3UOAB 1ZM2A 5TS2A 5I4IA 3LQRA 1P31A 3B2NA 4CM1A 3UTDA 4HH0A 3ZW8A 4G26A 3K8ZA 4Q34A 2RGRA 2VYFA 4WZ6A 4PC6A 2V8OA 4XWOA 3MT8A 5AJZA 1T2CA 3FCYA 1XAHA 2P9BA 4LY6A 4GKKB 3KBBA 1VXRA 1YE8A 3WRVA 1NVDA 5TQ0B 3P20A 4R54A 1M34B 1ZHFA 3UBMA 3WRXC 1U9IC 4V0NA 2NXWA 3WSTA 5BXQC 5FTMA 3RIXA 1V7ZA 2DR2A 1IZYA 3DHVA 4Q9DA 2CCGA 1YS2X 2ILVA 2BFOA 4LOLA 2VHWA 4M9CA 4P93A 4RF3A 1TA9A 2GN6A 2XCSB 2O1SA 4F06A 2B21A 3BGIA 4XCVA 4EHBA 3CRW1 2VDWA 1CZHA 2IHUA 4MIOA 2O50A 3FROA 4MTLA 2FOIA 2R96A 3DV0B 1Q7RA 2H1RA 2X1VA 5D5PA 5GADl 3KOWA 1HL3A 2GNOA 3K0AB 1VHJA 1YDHA 1EFAA 1H1LB 1RW4A 1P29A 2XKJE 5AYVA 3CXUA 3ZTYA 2RCYA 4RIGA 4NCNA 1BXGA 1BXGB 2MWMA 4RHTA 1H6BA 3KO8A 4FMDB 3DFIA 1GNTA 4PSKA 1GQYA 2IVZA 1KORA 5KWSA 5E7MA 2JNWA 1QYXA 1EXNA 2GRJA 5EINA 4CKYA 1PVOA 1DRVA 4IYRA 4CF3A 2NZJA 4NAHA 8ABPA 1VBNA 3I1IA 4F4IA 5A03A 3HZZA 3R6WA 3W9YA 5EG5A 3S2ZA 2G9RA 1Z88A 4MV7A 4ZAZA 4JC8A 2IX3A 5KTMA 1LY1A 1QVAA 1XDWA 1YR1A 3HKEA 3Q2IA 4MAMA 5IAJA 2FQXA 3TZBA 3BMNA 1DFGA 3FNRA 3RAEC 4URFA 5I4BA 3PR2B 1IBRA 1KI3A 2OMKA 2YHSA 4HLNA 2W2MA 4CMJA 4F93B 4MRSA 2VUHB 1XUOA 3BQNB 1SB9A 1PYGA 2JEYA 2BFNA 2B1JA 2YFHA 1NJGA 3GN1A 5IAOA 4KR7A 3BD8A 3ELDA 2C2XA 2WJHA 4RX1A 1NNUA 1J06A 2QUAA 1C0PA 2IYVA 2DX7A 3EGDB 1E1LA 3HLTA 2ZJBA 3UJ6A 4EHFA 2HPVA 1X8XA 2I67A 4RFSB 3SQNA 3EVDA 1MO3A 2OV6A 1QS0A 2AG6A 5ALFA 1PNRA 1N8KA 2WDZA 1OWLA 3FVQA 3ZVMA 1KFJB 2IZOA 1I33A 3G1WA 4HGRA 3NH9A 2YNMD 3WHPA 5L3RA 3C7DB 2GARA 1A8SA 3CW2A 4DMRA 5KQRA 4FR2A 3TB4A 5KX5F 1FFSA 1KJJA 3OZWA 2JCGA 1W75A 2VZ8A 1S02A 2H2DA 4JB8A 1NG9A 1C8VB 2RJ3A 1MFZA 4O2BF 2I8LA 4MWCA 2JGIA 4Y9TA 4KO2S 1KOGA 1M76A 1PNTA 5E4JA 2QUIA 3U3DA 4LISA 5JMWA 2ZVJA 5E1MA 5IUKC 1RQRA 3JRXA 1QDLB 4EFMA 1XTZA 1X7GA 2CUZA 3GIDA 4C6TA 1WB9A 5IT9A 5AVUA 6PFKA 2HH9A 1ZISA 1FLVA 2R8XA 4DMLA 3PSAA 1T8PA 2D2VA 1M8KA 4FKZA 3EC7A 3PGXA 2C4TA 3LFUA 1E1RD 2HSWA 4HDMA 5A3RA 1XHEA 3EH1A 2HXSA 4QFCA 5K0LA 5FLYA 3TZQA 4X6UA 1WO8A 8LDHA 1X6VA 2CNWA 2W6IA 4OHVA 1LV8A 4XX1A 1X80B 1V4NA 2GPBA 5GWXA 1SZCA 1V1MB 1WMEA 1V1MA 2VUSA 3UK7A 3WRYA 3GEDA 2FPGB 1SB8A 2HA2A 3EHDA 3N0VA 1PFYA 5EQJB 4EAAA 1RWKA 4JQSA 4LVNA 4MW4A 3HYSA 5H5JA 4JP3A 3IBFA 4OGGA 4QQNA 4XIFA 5EMHA 3SC2A 1FP4B 4KU4A 4TM7A 2XZTA 4EDHA 3TVDA 2E89A 1C9JA 2BJWA 2A5GA 3G2KA 1LLFA 3FH0A 3FMIA 4P3XA 3EMVA 4H7PA 1ONNA 3NBYC 1EMDA 4DEVA 3BBPA 2B61A 1X1EA 3FYUB 5BQXA 2YC2C 1ZNXA 1NX9A 1HV8A 2AA3A 3KT6A 4E30A 5LWHA 4BBJA 3GIWA 3LXMA 3U7QB 5IXYA 5CNKA 1AXRA 4AJOA 1PJ4A 3VDMA 3C6YA 3M3PA 1GTVA 3QVMA 1N2CB 2IHBA 4M88A 3ZHYA 2OUIA 3ILYA 1LWNA 3AYZB 4LVUA 4M99A 4W1SA 3G9XA 1M7GA 3KBOA 1NPTO 1QC5A 3MWFA 3KEGA 4FOLA 5KYKA 2H3HA 3HJRA 4ARZA 3EIOA 2P9JA 4O59O 1NMYA 1MW9X 1KJZA 2XZPA 4ZCSA 2CKMA 5IUNC 4ZT3A 4WLEA 121PA 2J46A 1WCIA 5JCOC 3L4KA 3AFOA 3RASA 1SBQA 2WM9B 5DCLA 3P5SA 3UUWA 2VAWA 4LCJA 3PS9A 2M6SA 3KPVA 4UCXA 3AV3A 1VCNA 5A9SA 2P6PA 5KS2A 2OK7A 3IUJA 1QHYA 1K2WA 1OHHA 1TUBA 4LXXA 3O8RA 2M6RA 4LYGA 3CZRA 3G0OA 1ZOOA 4QDJA 5BSMA 4DBLE 1CVIA 4B1FA 5CFRA 3GBPA 3FN4A 4Q6BA 3UHJA 1HPLA 3C3DA 3MCZA 4NPCA 2FDCA 3BWCA 1NVFA 1SC4A 3FJOA 5E9WA 5K3FB 1D3AA 1E89A 1TRKA 3OSUA 4EFDA 1V5WA 2R8OA 3MHTA 2AFIA 2PEYA 2WFMA 2QLJA 3P0EA 3EQ2A 3IE1A 2OPHA 4JEHA 1AK1A 3SZUA 2TYSB 4FDVA 5ICFA 2B25A 1VI2A 5FORA 1E2DA 5E7IA 1MD9A 4X97A 3ZV4A 3D1LA 4AECA 5EE5B 1GP2A 2I03A 2X77A 3GRAA 4DCGA 3UF0A 1AV6A 5LYYA 4NZNA 1GGHA 3ZYCA 1KGDA 3EPKA 1T25A 1JU3A 1TAHA 4YV2A 5MN5A 1GPNA 2ECOA 3ITKA 3KXIA 4ZMBA 5L3SA 2A5LA 4KXWA 4LRTB 4LFAB 2O7RA 1G6HA 4CV2A 3WSWA 4MGZR 2A78A 2K7ZA 1C9KA 4X91A 3VYSB 1W93A 2JH8A 3NNSA 1E2JA 1E0AA 1Z8FA 3UC5A 1IZ9A 4LRYA 3M6LA 4BQQA 2PSDA 1Z4PX 1FCJA 1Z45A 2B4YA 2FW6A 2NSDA 2P2LA 3PWKA 4EY4A 1XRLA 3L0CA 3RS8A 3A2LA 2BFEA 3T4EA 3TB6A 1H2BA 1G5TA 1KYZA 4YBRA 2X2FA 5EJIA 1QU2A 3U0VA 4CMGA 3OI7A 2JIZA 4OAPA 3VKUA 2F1KA 2D0IA 4HDQB 4UHCA 3HUFA 4ZVOA 3VAZA 5K1ZA 2Q5CA 2DAPA 4I19A 1F14A 5B6PA 1M2GA 2ECPA 2HEIA 2RH9B 3GJ6A 5GQSA 5I9IA 4DLBA 4P84A 4UDOA 2BUAA 2JAPA 1V26A 3VU8A 3SOZA 2FRDC 4FT4A 1AS2A 1VQ1A 4EO7A 2PO5A 2AD1A 2XVZA 2YN4A 2CVQA 5CPFA 1L5OA 1CJMA 3ETLA 3ER6A 1Q19A 4RJIA 3LTNC 3RVOA 1EWKA 4W8GA 3SF8A 4DR3B 1Y1QA 2AI2A 3IDOA 3EDYA 1L8OA 3N7AA 4HVTA 4NG5A 5JCOA 1PR2A 5I8ZA 4JJGA 4L72A 3ZDEA 4MWDA 5ELXA 1JR4A 1WBBA 4WLUA 1UKAA 4W7SA 2C2ZA 4CKWA 3CH7A 1EG2A 4KIGA 3MTIA 1HFWA 1D0VA 3MLBA 4IGFA 4UNQA 4QQKA 3BXXA 1XCJA 2IV2X 2PGOA 1Y1PA 1K8RA 1G7TA 2BFWA 3B5IA 1J2EA 3MCVA 3PVSA 5LBIA 1TEVA 2B83A 1LRLA 1NULA 2BMEA 4BZXA 1PAUA 3KKKA 1U8XX 4G9EA 2J6HA 3ROFA 4LF8B 4B35A 4N9WA 4PG7A 5I51A 2Q07A 2X4DA 1AMUA 1E6EA 1G3QA 1PGNA 4GBGA 3FKSA 4HMPA 3CNEA 4I50A 3RUEA 4EL5A 5JD5A 2C7RA 5KSZA 5E9JA 4N6OA 3W5JA 3B5EA 4J3FA 1P2VA 2C07A 4PQEA 2F3UA 4ZRDA 2LCIA 3WL3A 1O6GA 3QPAA 4G1VA 1GTJ1 1WB6A 2COUA 4A2WA 1CKEA 3ZW9A 1FX1A 1NF9A 4NMXB 2P5TB 3S1AB 3AG5A 2V7TA 2B2NA 3PJFA 1GUDA 5ALUA 4EJFA 2F8TA 4RTMA 1PQ4A 2ZS9A 4RW0A 1ZA1A 1XPUA 4F3KA 3I9JA 4DCVA 1N8TA 1P1RA 2YC4C 4MYSA 4WLOA 1VL2A 2WJAA 3WO0A 2Z2KA 2ZPAA 5TX7A 5BWNA 4IHKA 4ZVKA 4DLZA 1LD3A 1SELA 2Q1UA 4M0FA 4OKSA 1QYIA 4IGIA 2Y0EA 3NONA 1T4DA 5JBIA 3MTJA 1I1OA 3S2SA 2K2WA 1NVAA 3FD8A 2PWBA 1EGMB 1ZLXA 5EN4A 1AS3A 3UYLA 2XQKA 1PHRA 4ZRNA 4YHBA 3KLOA 3OZXA 2VNJA 5AHRA 2PZ8A 1Y42X 4YIHA 2Q5HA 1DWPA 1WKVA 1JI3A 2PJUA 1JMYA 3O1IC 4OP1A 3F8WA 3V8BA 1P91A 4P4UA 3U7JA 3UNXA 2MIIA 1DI0A 1SCUA 3JQFA 1IWBB 2O57A 3FUCA 4ZO9A 4C3VA 1IK4A 3ZH2A 3DD5A 2LPMA 4J4BA 4OQYA 4TTSA 1PYDA 4Q21A 4HN9A 4WI1A 1FSPA 4OBWA 3RIEA 5DE3A 3T4PA 5HE9A 2FRDA 5C7YA 1HT3A 4IF4A 2R8EA 4XJVA 5CG1A 1SN7A 2WHPB 1Q57A 4PG8A 3HV0A 1GL9B 4AMGA 3PTAA 1L4HA 5H70A 1SUBA 1VPEA 1CRPA 1FNNA 2JHFA 4XQCA 1W36B 4HNVA 4IBOA 2REXB 3CM0A 4R81A 4BB5A 4RULA 3OFJA 1J1UA 3HPRA 3GRKA 2CNBA 1U8AA 2O2ZA 1JU9A 4MGIR 1O58A 2EQAA 1M67A 4H6PA 1ZD8A 2CUKA 3T3DA 1L1QA 2FW8A 5FBKA 2DJ5A 3DB1A 1PJBA 1PP4A 2I2DA 2C7OA 5L3ZA 5GV8A 1MIHA 3A1FA 5A6SA 1KSFX 1PD1A 5TS3A 3I5UA 3Q87B 2FPIB 4I4TF 5HM6A 5KU7A 2B99A 1ZIPA 1DIGA 2MJLA 4DCCA 4O02B 1RBZA 1R4NA 2FKAA 2IYLD 3TG8A 1NNI1 1TU3A 3RIMA 2E4VA 2BLLA 3N7TA 4OQLA 4L3WA 2XMZA 2IKSA 1P17A 1E1RA 1Z3IX 1NGSA 3DPUA 1XALA 5KYUA 4Y1EA 2J6CA 3E7PA 1KAHA 1DE0A 3M1IA 4YFYA 2D5IA 2JGDB 3WYAA 5AM2A 4AIRA 4Y6GB 1SVNA 1HO3A 5CEJA 2VJMB 1U28A 3FWKA 1F8GA 1PTJA 3QFHA 4EFNA 4ETNA 3EWSA 4QXRA 2HU7A 1HKUA 3PD1A 4IQ4A 1LC0A 3N6XA 3IP1A 3L7JA 1A9XA 3JSXA 5DXAA 4BMZA 4U63A 3AIIA 1XZNA 2WIKA 4HD8A 4L50A 3K94A 5IDWA 1JA9A 1H8HA 2I6SA 1A2KC 3KQMA 3GCGA 1OJ7A 2VVTA 5LQUA 3K8YA 3WDMA 2Z5LA 3RIYA 3U3XA 4ZU3A 4B7AA 3NP9A 1W0KA 3U7RA 4ZIRA 3BXPA 1ADGA 3K1AB 1P4GA 4RHEA 4Y2PA 5DP2A 5JE8A 4GOXA 5FI0B 1GJRA 4YA6A 4YO8A 1IYZA 2GLXA 4U7TB 4XX0B 2JFYA 1G8KA 1HR0B 3TLAA 1TA4A 1CEXA 5G0WA 2WQ7A 2E37A 1GCUA 4XKJA 4AJJA 1ZVVA 5BQ5A 4MPJA 5CNJA 1YUBA 1GSHA 2QSUA 5A4DA 1GY8A 4F86A 1N4DA 3PDHA 2MSCB 3B3JA 1Z0ZA 3SZGA 1K7EB 3RJ5A 4NMLA 3C3YA 2GZ1A 2OENG 3WDKA 4NK5A 1ORDA 2HLDA 3VKFA 1STOA 3BULA 3WAJA 4BTLA 2N3ZA 4WOPA 3DQPA 3GFPA 4NECA 4QGHA 4ZPJA 4RJKA 3LDHA 3AO0B 1NE7A 3HG7A 3QKTA 2AXQA 2MSWA 4K28A 4DC1A 3KLPX 3IIIA 3UHPA 4YP6A 1J0AA 2OZLB 2IVFA 2ZT6A 3I04A 5G3ZA 4ONEA 1MTOA 5AM4A 4EW1A 1DC3A 1CK4A 1D2RA 1SMKA 4KQFA 3IQDB 1TUBB 1F1BA 2EP5A 1EXVA 3HJTA 3AI2A 3AI1A 3I1FA 1D03A 3C7AA 3NLLA 4LSZA 2FN4A 3KVYA 1D9ZA 1XCGB 5IBRA 2QPAA 2WICA 1P2GA 2D54A 5C3MA 4WFQA 2C2WA 1THZA 1RQNA 1RLJA 4ZIRB 2X14A 4E2ZA 3NHPA 1NVGA 4LSWA 3QLEA 4PS1A 5HCNA 1HT0A 3UMVA 1GL3A 3W6ZA 3Q5EA 3WJAA 4B2LA 2F55A 2ATEA 4XB1A 2OYCA 2GWHA 4XQEA 4JP2A 4Q3LA 3T5CA 2ASVA 1Z29A 4UREA 5JCJD 4KR3A 3GQBB 1LK0A 3IAAA 1YNOA 1JA0A 3MILA 5H3CA 5F5LA 4Z4HA 3TOVA 3OQPA 3QNWA 4L4ZA 1USKA 2GGSA 3E3MA 1RCTE 3R5HA 4IUBS 5ALVA 3WO1A 2QG4A 1B6TA 3PGA1 1TDJA 1DC8A 5LOVA 4YAKA 1AGNA 4LUCA 3D4BA 1R0KA 1BDJA 1M8JA 1Z5VA 2WSIA 3I6QA 5JAZA 1L7RA 1TXGA 4MDFA 2B2XA 4MQ6A 4FCCA 1B8UA 3WWPA 3ZHVA 2H5JA 4BEBA 1AUXA 4D9KA 2TECE 3FFBA 1UBLS 1SEPA 3EUEA 2CLMB 3GYGA 3QX9A 5E2IA 5B1YA 1JPNA 2FTKE 1I5RA 4GXQA 4JZKA 3RGWS 4CIXA 4K26A 2D5AA 3OPYI 2WM2A 4NH0A 4CRWB 2G4VA 1PL6A 2NNWB 5FTWA 4GPTA 1T1RA 4AJHA 3O3MB 5CH5A 5BOVA 1U3WA 4J90A 5B3JA 3STVA 1OUMA 4JT4A 4G0OA 5SZIA 2WTUA 1YWGO 1GRQA 4FXPA 4H3VA 2I2BA 2YYSA 3OIGA 1XI2A 1YHNA 2AV6A 3SN6A 4CDRA 1AMOA 1BHO1 2H31A 3EWNA 4AJKA 1L7MA 2GPWA 4FFBA 4LNUA 5HMLA 2H29A 3O75A 2VYVD 4XAQA 3TSWA 1D6SA 2IH4A 1QONA 4RVDA 3DLTA 3KSRA 3ZVNA 3KM0A 1YZLA 3GUZA 3WKEA 4EMUA 3M1AA 1R0RE 2CVZA 3K2EA 3O6VA 4AT1A 2POCA 1XMXA 2Q5FA 4QXOA 1MP0A 1F2VA 3C85A 1IB6A 1SUPA 2FMUA 1D7AA 3G82C 4E3WA 1YQXA 3LY5A 1ZN9A 3UMBA 1P33A 4EG4A 1RXEA 1PWXA 5D6NA 1JQDA 3OM1A 1CUFA 3LWZA 3ZE6A 4AP6A 3GB9A 2P9CA 2ZZKA 4RHCA 3DAGA 5K0NA 3V1YA 3GDWA 2ARKA 1SCKA 1ZJ4A 4KPGA 2VDUE 3O2SB 2BCEA 4HRYA 5AT1A 3FCSB 3ZDRA 2EKPA 3OCXA 5IJAA 2RH5A 3LOPA 4UPVA 3I0ZA 5FOUA 3OZIA 4D4IA 1FUYB 1XVIA 3C16C 3MC1A 4N54A 2XYPA 3REGA 2C4KA 3S0JA 3SOPA 4N41A 1Z17A 4TQUS 2CF5A 3WYDA 3WLNA 4COOA 1LSSA 1G1AA 3K9HA 3LLSA 1N5IA 1RBMA 4LKRA 4M55A 1E2KA 3GQBA 1UMBB 4PZAA 1RM3A 2EX1A 4LYDA 3URKA 2VYND 1Y5MA 3PNMA 4Y3UA 3KJQA 4JH0A 2XTZA 1MIOA 3GCWA 3IAEA 1QG6A 2IV3A 3EPJA 5I45A 1V7QA 2MINB 4HVLA 1O77A 1RADA 4FI3C 4RZQA 5B30A 3ONVA 4Y2SA 2LGJA 1Z56C 4P22A 3PA6A 2HMVA 2YHAA 1YT5A 2CLDX 3DV9A 1TK2A 1YJBA 4QU5A 2HDHA 4BE9A 4DIBA 2XWQA 1II0A 1IDOA 4WNYA 5FJJA 3MVEA 1VPWA 4R2WA 2BEVB 1G1MA 4ZD6A 4DQVA 4KMMA 1I51A 1A95A 3B2QA 3TFOA 1S01A 1V2GA 4UMFA 5HE8A 2JBWA 2JIQA 4M22A 1KAMA 1S4QA 3WK7A 2ZUEA 3HDGA 1OGYA 4B5LA 1Z25A 3C8DA 2A4KA 2HFJA 2IEYA 2VCEA 4M9ZA 2JJQA 4QC2A 4DA4A 1JYSA 3C6KA 4MS3B 5AK5A 4XFDA 2GK6A 4WACA 1NC3A 1T24A 2HWWA 3DDHA 1QF7A 2DTEA 3KR0A 4I55A 4OQ4A 1WMDA 2YWGA 4NFHA 1XJ5A 3COSA 4WMLA 3RVBA 2WWFA 2H08A 4P82A 5JI2E 3OT1B 4I8XA 3LA6A 3QUBA 3JQBA 4FLFA 1AQJA 1GIAA 2QE7D 3L8MA 3MGGA 4XE5A 1JH9A 4FQ7A 4A8HA 1A9QA 2CZCA 4PSAA 2XODA 2OBFA 4GUDA 4JLMA 4LTNA 3WV5A 4MWGA 2OMEA 5FJIA 3OU6A 3I23A 4WK2B 1TCBA 1U4NA 3TR6A 2O4CA 4C7OB 2VA9A 2XUHA 2ZQZA 3IR7A 3ROZA 4Q19A 4D97A 4TWJA 5AM3A 2GXUA 5JNSA 5JD3A 2C4HA 3B13B 2BEWA 4DNXA 1XXLA 2MT9A 3IAS1 3L07A 4G5OA 3GG9A 3GFSA 3CGWA 4A2CA 1DJOA 4JS0A 1T5HX 1UMKA 1VJ1A 1LJUA 2CHEA 3KAJA 4OYRA 4EHJA 5L7TA 1LK7A 3WB1A 3ETNA 3DEHA 1IJEA 4YN3A 3GLUA 4BVLA 3E7XA 1NNEA 5BOSB 1G5RA 1EXDA 4H16A 1YTLA 3A3PA 1ABBA 3CEAA 2OZEA 1E4OA 1ZU5A 3DKRA 3ISTA 4R1TA 3PCXA 5KKAA 3GLIE 4AP9A 3EQ7A 1EDZA 2AJDA 1G2IA 3HCEA 1H8EA 4FIDA 3HCDA 3HBAA 1PDOA 4D79A 5C9ZA 2GXAA 4V0KA 2VRNA 1AIPA 1L5GB 2PJDA 2P91A 2JDIA 3EGEA 2NX2A 1T9BA 4FFRA 1VI5A 5JJCA 4HG2A 3T12A 4QJIA 3ROEA 4AKEA 1UP6A 2PUGA 3I72A 3M34A 3ICPA 1RVV1 1TYCA 3R5JA 1JHXA 3E3LA 4RZUA 3MJEA 3W1EA 4EL0A 5HIKA 2X9GA 3ORFA 4YT8A 1QVVA 1NU8A 3AZQA 2PS9A 4MS1B 3BE6A 4DLUA 3T5MA 1E1CA 3NDRA 4G89A 2QOEA 2UVDA 1TQ4A 4LZAA 4PCUA 4XI9A 4BUCA 1CY6A 1E66A 4F92B 1UXIA 4F1JA 3ETEA 1FU7A 2FFJA 1CUGA 4DYDA 2XYGA 1JXOA 5DULA 2VDQB 3FAKA 4YRBA 1SNYA 1HLGA 2VSFA 4LCBA 3FYUC 2R4UA 3MT0A 2VDOB 3MSXA 5HZKA 3R4CA 3LCUA 5EFZA 3SJAA 3TGWA 3VDQA 2PT5A 1X8JA 1VB3A 3WTCA 1YIDA 3DNMA 4JB3A 1IRIA 1QPGA 3TIFA 1IBSA 5IULC 1FDSA 1QRDA 1VL1A 2XY4A 4J6EA 1A2QA 2G8NA 4FJ1A 5FRDA 3VSEA 4OQXA 3VR5D 3LCVB 3F5SA 5E6SA 2P5YA 5ENZA 3V1UA 4CUKA 4REQB 3SVTA 1D4ZA 2QF7A 3W2FA 1RXCA 4EYSA 4ZCTA 1YU9A 4DLSA 4N6GA 1E59A 3A4YA 3ILHA 1OU4A 4MICA 1NP7A 2C5LA 3FCXA 4X41A 1VC2A 3CKYA 4BZWA 5DW3A 1QQAA 2Y2UA 4QUGA 2DT5A 3DTNA 1DT3A 1RWXA 1BE6A 3IQIX 4KNWA 3RC8A 1TYDE 3NAGA 5IJ0B 2UZ0A 2IIVA 4RQBA 3QWIA 1E92A 2Q0XA 3WYBA 2ZR0A 1FQWA 1JHUA 3UMYA 1UBTS 3O4FA 1BHQ1 2Y9PB 2H52A 2WC1A 1XMJA 4FGLA 1D5WA 2QRUA 3AIKA 4DYHA 5K0BA 3NB0A 3G5UA 3CC8A 1Q91A 5CGQB 1QX3A 5BNTA 4BO1A 1IPHA 3L7CA 2CXTA 2ZTHA 1ZZEA 2JFUA 2X0JA 3MWEA 5FKJA 3VO9A 4G09A 2JLXA 2VC2B 4X92A 1JDZA 1FNMA 1JDSA 1RHUA 1I7DA 2FZWA 3CUVA 1KYYA 5ERYA 4BFSA 1CUWA 4C6HA 3IVMA 1T9ZA 1PZEA 4QTZA 1JIXA 2Q3FA 3UAWA 5C37A 3BMQB 5FNVF 3L7DA 4I36A 1SXQA 2O3SA 4KXQA 2EP8A 5E6SB 3MMPA 3SQMA 4RGYA 1U0JA 3ZDQA 1XKQA 3ELBA 2XT6A 4OHBA 4LMPA 4OV6B 4TLEA 1N3BA 4C3UA 1W4AA 1K7SN 2HWXA 1CY1A 4LGVA 3L7YA 4N8SA 3ROGA 2IOHA 3AERB 3EE6A 4EFLA 4NULA 1V96A 4YLEA 3THXA 2C82A 2D1QA 2WSBA 2IL1A 4NYJQ 3U56A 1HNZB 2PZLA 3HO8A 5CT9A 2IHNA 2ERXA 5CX4A 1KHTA 2XOXA 2D3TA 3H2BA 3RU7A 2CCKA 5J47A 1KTVA 2HCTA 2WWTA 4TUYF 3UK6A 3D8TA 1C8LA 3V8EA 1EJ6A 3K31A 4BNKA 3GZJA 5JRDS 1UJ2A 3FPEA 1GGEA 3KOXA 2IZ7A 1K5HA 1Q50A 2ZYSA 5KWIA 2XE4A 2DCUA 3PYLA 4AY2A 2IYQA 3RLFA 3RS5A 5IMSA 3GDHA 1ZRMA 4Z4QA 4P5PA 4TSFD 3JQDA 5LZ8A 1DQPA 1JG4A 1NY5A 3CNBA 3OX4A 2Z5VA 3HB7A 3F4KA 1JDTA 1KEPA 3OY2A 4KO4S 3BRSA 4QBKA 1XZ8A 2NO4A 5F7XA 3IJ5A 1OZFA 5IVIA 4B34A 2GDJA 2AD5A 2P7IA 3MXTA 4BNWA 3R9KA 1S8AA 4EG5A 1AHPA 5ILOA 1RI2A 1N75A 1OBHA 1JHRA 3R3JA 4Z5XA 4OCZA 5FH9A 2YV5A 1EUDB 1KIFA 1KP2A 2ZI6A 3CNQS 5IP5A 4YP0A 4ZAGA 2L0XA 1KXZA 2FZ5A 3B70A 4RFLA 3DEAA 3RHFA 1X7XA 1TD1A 2JIOA 2PKQP 3UW1A 1CSEE 3KB1A 2H6EA 1IL0A 1NW6A 3HUTA 5IVHA 1SU6A 1GZUA 1SKYB 5JVDB 1ESNA 2HB6A 3GEHA 2R6CA 1F2UA 2Z5FA 3EXIA 1JB1A 4DRXB 3WADA 5GONB 4TYWA 3N39C 4B7XA 3D2CA 4Q4CA 2VWHA 5FBVB 1A9YA 1XP8A 1FDUA 4HXYA 1ZRSA 2VOEA 1CXZA 1XMOB 2IYRA 3ICEA 1DDOA 2IU0A 3GLHA 5HIAA 2QD5A 2QT1A 1JHMA 1ESZA 4X6YA 3LBYA 1PW7A 4RZ2A 4NBTA 3E4DA 1V3QE 4IFBA 1I3LA 2YNMC 4E70A 4M21A 2P9HA 1EEHA 1OAAA 1BMFD 2BFFA 4YONB 5A4KA 1MJHA 2YICA 2BKVA 3L4BC 4YQYA 4O4JA 4OLBA 4ZARA 2CVHA 3FLMA 2ZIGA 3B1YA 4JJFA 4DYVA 1A2OA 3MJCA 5E2BA 1JLKA 1FDOA 2BP7A 4LWPA 4Q1AA 4OKNA 1LW7A 2I3ZA 4Y0NA 4ZKEA 3U3KA 2EAUA 3CLHA 2GX6A 4BC1A 1M66A 1CF9A 2R5FA 1QIMA 2QENA 3ILVA 4WZBE 2WMNB 3W2GA 2A92A 2OBMA 4I9UA 3P2KA 4NOMA 3SZMA 1DL5A 4ETMA 4H0CA 4I14A 2NW6A 3A2MA 3K0CA 5CB0A 2EJTA 1HURA 4UQLA 1UF9A 3AEYA 4PANA 1O5TA 1TK9A 2IYOA 2W83A 3HRIA 3RVLA 2K87A 2BEVA 2Y6VA 3K1ZA 4PLYA 5CVDA 2I3AA 4CKEA 2ZS8A 1B2LA 2VT6A 5K6AA 2AMLA 2BGTA 2P78A 3DWIA 3N2GB 1PEYA 2WJ3A 2Y0PA 4MW9A 4HJXA 5E4FA 4AICA 4BECA 3DAHA 4V2UA 3N86A 4MR8B 4Q9KA 1QB8A 1CJCA 3WQQA 5GJBA 3R7LA 1SCBA 1U7OA 1IXKA 2KW5A 2FOLA 1KA9H 2XQJA 2ZB8A 1ODFA 3DM5A 2DY1A 2ERYA 1IY2A 4BAZA 4EQ6A 5LMCA 1E8DA 4YUYA 4RDHA 4UVDA 3QE3A 5TQ2B 4P58A 1B15A 1OFHA 3PFFA 1IOLA 3WQHA 4DWVA 1YMQA 3KAQA 1A04A 1QO0A 4MYCA 4QGAA 3A0RB 4L2IA 2DFTA 2X41A 5JBNA 1WOMA 1M5TA 2ZJ1A 3DL0A 4IGEA 1YB6A 4IINA 3H0EA 3TQCA 4CMAA 2QR2A 2Q21A 5FOWA 1C0KA 3AY7A 1UWVA 1G21B 3KKNA 2O20A 1K75A 4NFYA 4WSOA 2F8MA 1DFHA 2GR9A 5DO9A 3VYVA 1B74A 1U02A 4RSMA 1EFUA 2WVAA 4EGJA 1A9SA 1GV0A 3KJIA 3ENZA 5AO9A 1KRWA 1O9BA 3BF7A 3GW8A 2JIMA 3C1TA 4LG1A 4EPWA 1C0EA 1M6VA 1ZXXA 1P75A 2WMYA 2WTEA 4A8TA 1NUPA 4GDFA 1JR6A 2YHIA 4L51A 2VT7A 2VRBA 5K4GA 3GFVA 2PYZA 2I78A 2EFEB 1Q20A 2I29A 3H6KA 3KV1A 1CF4A 3O91A 3KL2A 2XE8A 2ZSKA 3O2QB 4JGGA 4Q1VA 3TGPA 3MRTA 2XWJI 2CHGA 3GLRA 3PXXA 4JP8A 4JJ4A 5AW5A 5JZMA 1Q21A 1QP0A 3ADDA 4LXHA 4BJ3A 4HV4A 1E69A 2XMGA 2GTHA 2E85A 2OL4A 3ZY4A 3CLKA 4Y9RA 5DHAA 1MQSA 4Y2YA 6GPBA 1WCYA 2ZGVA 3PKZA 5AVRA 5LQAA 1N2JA 1XL1A 3NGLA 2AI3A 4Q1FA 1GNRA 3TW6A 2UZ4A 4MDYA 4Z0HO 3WWDA 1U0OC 1RZ3A 2G9ZA 2X8JA 4MI3A 1IWPB 1Z6YA 2CNNA 4L9AA 2H2GA 4Z9FA 2Q1SA 1MVLA 2Z95A 3Q98A 4QUBA 3A1TA 5CRIA 4H9GA 4C7OA 4WCDA 2J5BA 3IAS6 1SXHA 5LYJB 3WY9A 3B3AA 2R7KA 3PF8A 1G8GA 2QUJA 2QVYX 4DCNA 1ZUNA 2VJAA 3BFVA 4ZEVA 3ILSA 3EGDA 3R41A 4FYYA 2ZPUA 2ZBGA 3OKAA 1E3WA 1JJBA 1XTVA 4JKIA 2Q28A 3SJCA 4RS4A 1Z6GA 1XKTA 3E9YA 5CLIA 1ZMOA 2NSHA 3NUQA 4TRJA 3N28A 1L1EA 2RHHA 2A1UA 1G5QA 5GY7A 1GLGA 1GZHB 1F1JA 2VHYA 2IHTA 1B16A 3BD7A 5G3YA 2ON6A 4MVJF 4EZBA 3AV0B 3ZI4A 1TAQA 4IOKA 2GHQA 2YCBA 3ESQA 3F1KA 3MINB 1S1CA 4C07A 1U2QA 2D1SA 2OOSA 3NKVA 2XVYA 4OBEA 1PZHA 3A1DA 4ZQEA 1WCWA 3HWSA 3M6AA 5DN6A 1ZVMA 2NO1A 1QX4A 2YXBA 4B7CA 5CEEA 2J4FA 3FTNA 1KH3A 4E03A 2ECQA 2FCRA 3JCZA 1Y5RA 4YXWD 5K0SA 3KQNA 1N9KA 3NTQA 3W0LB 3N2EA 4W5WA 1REQA 2C1ZA 3C5WP 3HCWA 3MWDA 3P97A 5DK4A 4GGPA 4AC9A 1R6UA 3QYJA 5ECWA 2OAP1 4DTCA 3ET4A 4H15A 5JXGA 4PHFA 4M7WA 3LZCA 4MUAA 2ZJAA 2CBGA 2AK3A 2PEZA 3EEBA 1Q1BA 2XIQA 4TQAA 3VH3A 3JD0A 3OKFA 4LV8B 3E84A 2ACWA 3SLKA 5DM60 4DLXA 5KYVA 5AW6A 1GKYA 2DUMA 5B7PA 3RYCA 2HQRA 3U60B 1A4RA 2PX4A 1NJFA 5K3FA 3GUHA 1WXGA 2ZI7A 3H2SA 4K7JA 4XB2A 4C9BA 3KSDO 3CG0A 1SC9A 3O95A 4FYMA 4X3PA 2MMCA 1E79D 2Q3EA 4WEQA 1Y98A 2XUZA 2ZSUA 3OFND 5EWLB 5FL3A 1XDZA 2XQVA 4YUAA 2FHSA 3FFXA 2CGEA 2IHVA 3EXEA 4HS9A 1YIAA 1GFSA 2HJ9A 3GCZA 4D9NA 2QAGB 2AN3A 4Z99A 3VISA 1XRNA 3GOQA 1G18A 1VZ2A 3D3KA 1KPGA 3U7GA 1LBHA 4Z3DA 4QQFA 1YJCA 3WIBA 5CA1B 4PF1A 1M6EX 1M34A 3QV1A 1N1EA 2A94A 3W5IA 4G85A 4GT1A 3L7LA 2V9CA 4OP2A 4R1LA 4XUEA 5BQPA 2ASEA 1P7VA 4H7IA 1KJQA 3A7DA 5DNEA 1C41A 4OXYA 1GU7A 1NMQA 2CL6X 5AXCA 1A8PA 4TSKA 3VR4D 5IJ0A 1A1VA 3N6VA 2CN1A 1TMOA 4BRWA 2JASA 4JXKA 1E2LA 1W5FA 5IWCA 1Y33E 1ICIA 1LLCA 3YASA 3U16A 1JF8A 4D42A 1HNWB 2YJ4A 4HB4A 4DXAA 1NXVA 4Y0AA 2FWMX 5T64A 1KP3A