1VA5A

Antigen 85c with octylthioglucoside in active site
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
b'MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen 85-C
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity
pubmed doi rcsb
total genus 103
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2004-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1va5A00
1CUJA 2DFPA 4UFPA 5E4TA 3V48A 3DYVA 4F5ZA 5CT5A 3I2JA 3QITA 2VTVA 1T4MA 3D5EA 4LXGA 2XUDA 3D59A 4IO0A 4N5HX 4KEAA 4BCBA 1CRLA 4UBIA 2ZVDA 3STUA 1IUOA 4C87A 2VAVA 3A6ZA 4HZGA 1CUHA 4ZWNA 4UHFA 4BAUA 1EA5A 2ACEA 2I03A 3YASA 1HKHA 1RP1A 5ALRA 1YS1X 3BL8A 3WYDA 4CCYA 3S2ZA 2WG1A 3DS8A 3LIIA 2BFNA 2Z8XA 3BE8A 5A71A 5HZGA 5AM0A 4B84A 1ZJ5A 1VOTA 3R3XA 3G0CA 3FVRA 5AK4A 3QMVA 2WILA 4F0JA 4OUKX 5AKIA 3FWHA 4EY8A 3QMMA 3WWPA 2PX6A 1ZIYA 4F60A 1MNAA 1ODSA 4GEGA 3FLAA 2WIGA 1GXSA 1MX1A 1JKMA 1GKKA 1MO2A 5EGNA 3U1TA 2CUTA 2J3DA 3H2KA 5E4YA 4MQLA 3IURA 3E3AA 4FOLA 2Y2UA 1QIGA 4AZ3A 3JYHA 2VJAA 3O4GA 1DTEA 3PUIA 1XZCA 3AIKA 1EK2A 4DSZA 1CQWA 4AMZA 3C8HA 3W9BA 2OQIA 3WA7A 1GPNA 5K3FB 4Y2YA 3AIMA 3LP5A 2XQIA 2QUAA 1AC5A 3IVMA 3G0BA 3G8YA 4AZ0A 4ZGBA 1BCRA 3OM8A 3C6YA 4Y2PA 4E11A 4U2EA 1QONA 4EZIA 1DWQA 4AO7A 2GZSA 4YK7A 1EH5A 3SWWA 1EK1A 1CUXA 1DQZA 3C5VA 4J3JA 4LHEA 1G5FA 2PKYX 4XWGA 4GDMA 1JU3A 3FYUA 1OCEA 2DHCA 1DWOA 2JGEA 4I4CA 1H23A 1EDBA 3OTQA 4X92A 1LPPA 3VISA 4D9JA 1R4ZA 3PF8A 5D7BA 3WK4A 3ZI7A 1R88A 3G0IA 5HF8A 5F4ZA 5DYTA 4UHHA 1CUVA 4M0FA 4C4YA 2HA2A 2W22A 5CTAA 5CH5A 1EI9A 4UHEA 5IKXA 5JANA 5I7UA 1B41A 2BCEA 1QTIA 4HTAA 2BGRA 2AXEA 5AKZA 3ZWQA 1IZ7A 3FYTA 3O9VA 1TCBA 1GQRA 5EI5A 1KU6A 1K5PA 2C58A 5A2GA 1BRTA 4OD0A 1LZLA 4H0CA 4UUQA 1K6EA 3KOOA 4JUIA 3WKAA 1SOMA 3RARA 3DL7A 3PE6A 4X6YA 4C01A 4H7KA 3Q0TA 4RGYA 3VDXA 2OGZA 3D2AA 1XZLA 1QTRA 5KBYA 2X8BA 4BATA 3D7RA 5DYYA 2WFZA 1YR2A 3HZOA 1Q84A 1LGYA 4Q34A 3D3NA 1MJ5A 5D6OA 3QYJA 3DDUA 1VXRA 4AQDA 2C5GA 4CIAA 2ROQA 2VT6A 3RKSA 3A2NA 3W9UA 1XZBA 3BIWA 4Y2SA 2XUKA 4H7HA 1AGYA 4YPVA 3IUQA 3R41A 4ETWA 2B4KA 3V1NA 4OU4A 1ZI8A 1T2NA 1AKNA 4PV7A 2QTBA 3H2GA 4UFNA 4MJ3A 1UZAA 2BUBA 4KE7A 1F0PA 4JYMA 4KR0A 5AKXA 1DU4A 5ESRA 3F8SA 1GPLA 4BCCA 1YAJA 4Y2VA 1W76A 4H18A 4B0PA 1TCCA 4DYHA 2WIKA 4P92A 2AJLI 1BROA 3C70A 3UMJA 1CUFA 2RI6A 4Y2JA 1LLFA 2VJBA 4FMPA 4XX1A 4ROTA 1F0NA 3VJLA 1SCIA 1WB6A 3TGLA 1LPOA 3WJ2A 1Y7IA 5IH7A 3E4DA 1RWQA 5JIBA 3VXKA 1YB6A 1Z68A 4DNPA 2CZQA 1L7QA 5EHNA 2XQGA 2IX9A 4V2IA 3M3DA 3WK5A 3IBTA 4EY4A 5DJ5A 1S8OA 5AM4A 3HSSA 4PSDA 1QIIA 5J3JA 1A8SA 3TEJA 1EB8A 3BDVA 1GT6A 2ZYHA 3VVLA 1C4XA 1FFBA 2HU7A 5C81A 1RYYA 4DTCA 3HC7A 2XQJA 4PW0A 4BDSA 4W1RA 4M0EA 1A7UA 5A7HA 4YASA 3R3UA 1E89A 1ZD2P 2RIPA 3DJYA 3FOBA 4PF1A 5E4JA 3A70A 3EIOA 3PFCA 1QIKA 4O08A 3FBWA 2HFKA 1ZICA 1W52X 4EY6A 2DQZA 4DMKA 3AUKA 3PUHA 5ALIA 2CB9A 3FCYA 4B6GA 2XLBA 3QVMA 3FYUC 1IUNA 3FNBA 5JAOA 5DWDA 5KREA 1VA4A 3TJMA 2XUOA 4A5SA 1GGVA 5JATA 2IITA 2XUHA 5CT6A 1JFRA 4Y7DA 5LZ4A 4TGLA 1TIBA 5HF9A 4X94A 3WJ1A 1UXOA 3WQHA 3D4LA 2G4LA 2Z3ZA 4Q82A 3H1AA 3R0VA 3HI4A 4BZZA 2OAEA 3D2BA 2QR5A 3QMWA 1VLQA 3DL4A 4W1PA 4G1FA 3A2LA 1PJAA 1ODTC 4RNCA 3ANTA 1DINA 5SYNA 4I19A 3H2JA 1SCQA 1CUEA 2HA0A 2WQZA 1ORVA 5AK6A 4J03A 4ZXFA 5EIAA 4BVKA 4HRYA 1XZFA 2PUJA 4H7EA 2VATA 4K2AA 4CI9A 1E5TA 3EQ8A 1CUWA 3PI6A 2GBGA 1UKAA 3ICVA 1B6GA 1YB7A 4NZZA 4OB6A 1EVQA 2ZJFA 3M81A 2XUGA 1UKBA 2H1IA 1MNQA 1P0PA 1IUPA 5FRDA 2VEOA 3G7NA 4BYMA 4PSUA 5FV4A 5ALEA 3STXA 4L72A 2R8BA 1MU0A 3EBLA 4BE4A 1CVLA 1UT6A 2OAGA 1MTZA 5YASA 3STYA 3GFFA 5HQ3B 1Q0ZA 3IIIA 3RK4A 1CUCA 3S8YA 1Q83A 1XLVA 2C0PA 3H17A 1XRRA 1YAHA 1W1IA 1ZI9A 1PV1A 5LKAA 4E14A 1ZOIA 1WHSA 3HACA 2HA3A 2EEPA 4X85A 5T4BA 2ZYIA 2OXEA 2HM7A 1EHYA 3L1JA 4GLBA 1L7RA 4WCVA 4W9RA 3EQ7A 2LIPA 4LKOA 4K6GA 4MXDA 4DMHA 5LZ5A 4MYSA 1VE6A 4B80A 1E8DA 3PF9A 4W1SA 2J4FA 2WSLA 3WLAA 1SC9A 5EHXA 4ARBA 2HA6A 1XRMA 4KRXA 1XZJA 3R3VA 4AMYA 1ZGBA 4G5XA 1XLUA 3KSRA 4BC0A 3GELA 1NU6A 2DR0A 1XQVA 4U2CA 1XQWA 1XZMA 4FLFA 4GHWA 3C43A 4C6HA 2X76A 1KEZA 5AI0A 3C6XA 4BAZA 2WFLB 5D3ZA 3I6YA 1XLWA 2Y6VA 3WKDA 2QUBA 2G5PA 4Q1VA 4QE3A 2XI4A 4J0HA 2B61A 4Q3OA 2Y2VA 1IVYA 4BCDA 3HLKA 3QPCA 3AZOA 4S0XA 3OC0A 4UPDA 3FYUB 1FFDA 3KXPA 1R3DA 1VA5A 3IUMA 3HEAA 4WY5A 3W04A 3HJUA 3T4UA 5DYWA 3B3QA 2I3DA 3DKKA 2QRUA 2V98A 4Y2TA 1VJ5A 2QXTA 3QZUA 1OILA 2XMGA 5HQ3A 2HA5A 5AKGA 3IUJA 4EY5A 2C0QA 3A2MA 3NWOA 3ZV7A 4H7FA 1CQZA 1XZHA 1QGED 1SCKA 3OG9A 5AICA 3H18A 4MWTA 3VVMA 4J0DA 4BP9A 3ZPXA 5AM5A 4Q3KA 1MAHA 4B9EA 1GKLA 2CJPA 2O7VA 3DD5A 1IZ8A 2H9YA 3M82A 2VJDA 3O4HA 3WK6A 3KD2A 4AO6A 4FBMA 2ECFA 4GI1A 4PNZA 5AK5A 5AKEA 2PSDA 3H19A 1F8UA 5A62A 1QO9A 1DX4A 5K3DA 4BRSA 5AI6A 3H2IA 4CCWA 5JZSA 3FVTA 1UFOA 3DYIA 3TRDA 2QXUA 1JMKC 4GW3A 5HFAA 2VT7A 3V1LA 3G0DA 4Y2XA 4X6XA 2WKWA 3K6KA 1XKTA 3O0DA 4MQMA 4WFIA 2GBIA 2OCLA 3GZJA 3FSGA 5I9IA 4CCYB 4XJVA 2ZJ6A 2H7YA 4LXIA 1ACJA 2QOEA 5EFZA 1ETHA 4B9AA 2XUJA 3WL8A 4BE9A 2WIFA 2B20A 3AZQA 3SK0A 4MEBA 4KE9A 4ZV9A 5ALMA 3MVEA 5LKRA 1LBTA 2WJ4A 2WLSA 4GBGA 2PVSA 2XMBA 1TAHA 2GBFA 3V1KA 3F67A 3ZLVA 3H2HA 4KRYA 5HK8A 2VF2A 5ALQA 2WUEA 4L0CA 3DNMA 1ZJ4A 5FKJA 4Z49A 4LIPD 1BS9A 3STTA 2WM2A 4LXHA 5ALVA 5I8PA 3OOSA 4KE6A 3HABA 1O6FA 5AI4A 1BEEA 2O2HA 4KACA 4OU5A 4N8EA 4HXEB 4G9GA 2C4HA 2OGTA 5DNVA 3VKFA 4FHZA 1CUBA 3G02A 1VKHA 5LZ2A 5IVDA 4EB0A 3SC2A 5ALXA 4U2GA 2PSHA 4HS9A 5AI9A 4K6KA 2ZSIA 5LZ9A 3B5EA 1A88A 4LYDA 5IVKA 5AKLA 1QE3A 1FSSA 4AN0A 2X5XA 3LLCA 1UK7A 3M83A 4X90A 1E8MA 3ZLUA 1G4HA 3V9AA 3H04A 4IH1A 2WTMA 1YA8A 4JNCA 5JALA 4BVLA 1XZAA 4IH9A 1N8SA 4UBOA 4KYVA 1WOMA 4C89A 4PQEA 3GROA 2BKLA 3B12A 5JADA 3IUNA 2QMQA 1THGA 5ALSA 1LZKA 1ZD3A 3T52A 1UOQA 3G9XA 3G0GA 3ESBA 3IULA 5AIAA 2HU5A 5CH8A 1BE0A 1QIMA 1ACLA 1CEXA 1UKCA 5HCUA 2WUGA 5IVHA 2WJ3A 4N8DA 2V97A 4P9NA 1OXMA 2XMDA 3Q8WA 4MYDA 5BWBA 2G63A 3ANSA 4OCZA 5FPQA 4W63A 3WWDA 3HRHA 2XUIA 2WU3A 4Y2UA 2WFMA 5FLKA 2JIDA 5E2IA 4ZI5A 4UFOA 3WKBA 3GUUA 4FDMA 1W75A 5LYYA 5CURA 5C8ZA 4G8BA 5LZ8A 2AJ8A 3AFIA 3BF8A 5K3CA 4BP8A 3KWFA 4J0GA 3QM1A 4DGQA 4UHCA 2NW6A 2DHEA 2I78A 4B83A 1WB5A 3FAKA 4OPMA 4CFSA 4FLEA 2HU8A 3I1YA 1DT3A 3BIXA 5DNWA 2WU4A 1A8UA 2VAXA 2D0DA 2Z5GA 4H7JA 1EVEA 3N0TA 4N8SA 2DHDA 3DOIA 1U65A 1U8EA 2VJCA 5JARA 1HLGA 1BN6A 3ED1A 1XQYA 2QS9A 2AJBA 3MGAA 2GYVA 3WI7A 3E1GA 5K3FA 1ZD5A 4H7DA 2CEKA 5ALUA 1Y7HA 5JASA 1CLEA 3C6ZA 2FX5A 3C87A 4DNOA 2C7BA 5ALLA 2DSNA 3WZMA 3W2TA 1ZIXA 3HYSA 3BF7A 4WDRA 4QZVA 2QM0A 4FBLA 4ZREA 4BZWA 1J1IA 1FJ2A 5A7FA 1AURA 3F98A 1HDEA 1U2EA 4H35A 5JD6A 1XKLA 5T4FA 5JAUA 1W6RA 4U2DA 3V1MA 3WYNA 1ZI6A 1UOOA 5AM2A 1JJBA 1CFJA 1YS2X 1HPLA 5LIPA 3BJRA 3ESAA 3KWJA 1LPBB 4A23A 5ALZA 4HRXA 5EIHA 4JEIA 3STVA 4EY7A 1EINA 2OLEA 2PSEA 4RE5A 2XUQA 2OCIA 1C7JA 3KDAA 2JGMA 1N1MA 1XZKA 4IH4A 7YASA 2FJ0A 1DQYA 1MX5A 1QIJA 1R9MA 3OPMA 3ESCA 4UBNA 5C7YA 5AK3A 3W06A 4Y2QA 3K9BA 4BTVA 2GYUA 1UK9A 1R9NA 3AIOA 2FUKA 4BC1A 5AKHA 4GECA 1JU4A 5ALNA 4B82A 4NVRA 4B0OA 1R1DA 4UBMA 4NS4A 5LP1A 4KAJA 3DKRA 3NUZA 4C88A 2PM8A 4H7IA 1VZ2A 2WUFA 3JW8A 3WWCA 4MWSA 3VJKA 5AM1A 2RONA 2WIDA 1X70A 3I2IA 5T4HA 5ALKA 1H2YA 4OB8A 3BDIA 1BN7A 1FFCA 3C6BA 4BBZA 6YASA 1MX9A 4DM7A 4KAFA 4DIUA 3I1IA 2HRRA 4K6HA 4JYPA 5C8VA 4BAGA 1P0MA 5JD5A 2PUHA 1QIDA 2HIHA 1XZIA 2HFJA 4J0JA 4INZA 1U4NA 5AH0A 4OYYA 1A8QA 3C45A 1J07A 2R11A 5HK9A 1DWPA 4BB0A 2RAUA 3O4JA 5ALOA 1CUSA 1WPXA 1HBJA 1G42A 4W1QA 1TCAA 5CT4A 1K4YA 4J7AA 3DEAA 4DMFA 1E3QA 3AILA 2OCKA 1JI3A 4AX4A 4DLNA 2ONCA 5FPPA 3WMRA 5BWCA 3WL7A 5KWIA 5A7GA 1HQDA 2QKYA 5D3KA 4HVTA 4CIBA 2WFLA 2E3JA 3DCNA 2W6CX 1CUYA 2WHQA 1PFQA 2QT9A 3MUNA 5HF6A 4M0MA 1YSCA 5CW2A 2ACKA 4G8DA 4DNQA 5DTJA 5LZ7A 5C8XA 4B85A 5AOAA 1GPKA 1R50A 2YASA 3R40A 4WJLA 4DMCA 2FJPA 3EF3A 5SYMA 2YH2A 2XQKA 4QDUA 4TVKA 5KWJA 3FSGD 2HDWA 2HA7A 4RE6A 3I2KA 1NX9A 2EDAA 1QLWA 3U0VA 1TQHA 3G9UA 3F96A 1XQXA 4L9AA 3ILSA 3L1IA 5AP9A 3WA6A 3LS2A 4ARAA 3ICWA 4LYEA 3X3HA 5JZ9A 1XZDA 1QIEA 4KJXA 2XUFA 1VE7A 3DOHA 3RM3A 4EBBA 5AKYA 5CT9A 2AJDA 5AKKA 2DQYA 4BRZA 1H22A 4P08A 5CH3A 3N2ZB 1XROA 3I2FA 4QDZA 2V9ZA 2JGIA 1Q0RA 3WL6A 1XZGA 1O6GA 1H2WA 2JBWA 4YX9A 3WIBA 3WIOA 3H0CA 3PDCA 4EHBA 4FNMA 3AINA 1EDDA 2JEYA 2RHTA 4AN1A 1P0QA 3CXUA 4FFVA 4QEKA 3O9MA 5CMLA 3GBSA 1CUAA 2XMRA 1AX9A 1MN6A 2H7XA 2XMSA 1SFRA 3H1BA 3IB3A 1QZ3A 1BCSA 2V96A 3AZPA 1JT2A 1JJFA 4OYLA 4MEAA 5ALTA 4C4ZA 4WDQA 1F6WA 2HHAA 2PSJA 1C7IA 2GZRA 3WK9A 5AI5A 3WK7A 1EX9A 4N5IX 4A16A 1K63A 1TRHA 2EDCA 4J0KA 2PBLA 4ZV7A 1D07A 4UBKA 3F9CA 2WHRA 3IA2A 2ORYA 1MT3A 4RPCA 5A6VA 4EUSA 4OB7A 3I28A 2PL5A 3G9TA 5H3HA 2BGNA 4B7ZA 4Q05A 5AIBA 4Q3LA 5ALHA 2WIJA 4ITVA 5CXXA 5AJHA 2OGSA 2QVBA 1N5RA 4X7BA 4G8CA 4FTWA 3HXKA 4KE8A 2J4CA 4UBLA 1QOZA 1USWA 4PSCA 1QIHA 1X2BA 2OPHA 2YXPX 4WFJA 2HADA 1CPYA 4F21A 2P8SA 2XT0A 4G4IA 4P93A 4U2BA 4XIIA 2OCGA 2WG2A 3QH4A 1UK6A 4C4XA 2Z8ZA 5BV7A 1LPNA 4U2FA 3SX4A 2DCMA 3PICA 4QWWA 5K3EA 2G5TA 1YASA 4FFWA 4KAAA 1YA4A 3DQZA 1GZ7A 2GBCA 1XRNA 2BJHA 1KU0A 3C5WP 3VJMA 3PFBA 4DNFA 5CBKA 2VQ6A 1ZGCA 2JGJA 2JEZA 1WCYA 1QFMA 2XQFA 4QWMA 3WZLA 1UWCA 2QZPA 2Z3WA 5ALJA 4BDTA 2I3ZA 1LPSA 3BJMA 5JYCA 5IVIA 3G9ZA 5ALPA 3GA7A 3D0KA 2CBGA 5CXUA 4L3WA 5HFNA 1VXOA 2XE4A 1UOPA 5EHZA 3I6ZA 2WUDA 1QJ4A 1TK3A 5K3BA 5T4EA 4Y2RA 2OQVA 2IIVA 3WWOA 5AO9A 2BUAA 3C8DA 2VSQA 4FLMA 5AOBA 5AM3A 5CRIA 1TKRA 1E66A 1WPRA 1NU8A 4FWBA 1LBSA 4GWLA 3JWEA 3P2MA 5FOQA 4G9EA 2HL6A 4WY8A 1G66A 5FP0A 2PSFA 3O95A 3CCBA 5ALGA 1CR6A 4AXBA 3QPAA 5JZBA 1WM1A 1K8QA 4CG3A 4X6UA 2B9VA 1CUZA 2O2GA 2ZJ7A 4IHAA 4OSEA 4JH0A 1AZWA 2D5LA 2XMCA 4FKBA 4K5QA 1UK8A 5DNUA 3I2GA 5ISMA 3L1HA 2XLCA 4AO8A 3BWXA 3FCXA 1QIFA 5DLPA 4QDOA 2HRQA 1IMJA 4HXFB 2VA9A 2C5FA 1H2XA 1VZ3A 4HXGA 5LLSA 3WKEA 3WL5A 1JMYA 1THTA 3QBJA 5FDFA 5AHXA 4UHBA 3EQ9A 4QDTA 2XMZA 4AB1A 4QLOA 5CT8A 1DT5A 1X2EA 2JF0A 2Y1KA 2QJRA 3UUEA 3R3ZA 1LNSA 2WHPB 3BXPA 5AKJA 1M33A 5JD4A 5JAHA 5AI8A 4J0CA 1EDEA 4X3CA 4Y9SA 4PO3X 5ALYA 3NGMA 1N5MA 1ORWA 2QJWA 3CN7A 5K3AA 4GXNA 2WHPA 1XZEA 1MAAA 4WFKA 2J3QA 2PU5A 1XRQA 3WK8A 4B81A 2BAGA 3STWA 3NOXA 1J06A 4TPKA 3ZLTA 4J0IA 1XRPA 2CMFA 1CIJA 1FFAA 4UHDA 1CUGA 2O2IA 1CUUA 4UBJA 3RLIA 2WG0A 4BTLA 1QO7A 2YYSA 3MUOA 3AJAA 4X91A 1WB4A 2H7CA 2UZ0A 2BUCA 3CN9A 5HKBA 4X97A 5ALWA 1I6WA 3LIPA 2HA4A 2PU7A 3W05A 3DLTA 4HAIA 4QLAA 4X93A 3OURA 3WWEA 4CG2A 1HL7A 1EB9A 3E0XA 2WTNA 3WKCA 1BU8A 1AUOA 5AOCA 5FXMA 1L7AA 2Q0XA 3R3YA 4IQ4A 4X95A 2ZSHA 4E15A 2O7RA 3LCRA 1CV2A 4NMWA 4BVJA 2RHWA 3I6MA 1H2ZA 4G4GA 5ALFA 3D2CA 1ZD4A 4CG1A 2OG1A 2ZYRA 1ISPA 3I2HA 4I3FA 2ZYSA 2XUPA 5HF5A 3O4IA 5JAPA 2GYWA 1CUDA 3QPDA 2RGUA 1LPAB 5FUMA 5BOVA 4EA6A 1XFDA 1GQSA 5K5EA 3R3WA 1DX6A 4XVCA 4ZRDA 4DSAA 2CKMA 3IDAA 5EIEA 5HKAA 1AQLA 4X00A 3F97A 2JGKA 2K2QB 2JGFA 1EXWA 2XMQA 4G4JA 1YCDA 2XDWA 3CCCA 2Y6UA 2JGLA 1CUIA 4QNNA 1WHTA 1JJIA 1Y37A 1E8NA 3K2IA 1P0IA 1ODCA 2ES4A 4QA9A 3ESDA 2XB6A 1MPXA 5DTIA 5ALDA 1XRLA 1W4LA 1AMNA 1J2EA 1QFSA 2AJCA 4X71A 1FFEA 5EHQA 2PPLA 1LPMA 4FNGA 4E46A 4H77A 1BEZA 2WJ6A 3FLBA 3UUFA 2XUAA 3FLEA 4QDXA
chains in the Genus database with same CATH superfamily
1CUJA 5AVJA 5K09A 4P4GA 1JA9A 2DFPA 2O8VA 2I6SA 3AJRA 5FV7A 4DVJA 3MF4A 3JQDA 3ZXUB 2A1IA 1ZEJA 1Y4AE 4ZAFA 2AFHE 1KI7A 3ISJA 4G07A 2HSZA 5L3RA 1J24A 4AT1A 3WO0A 1Y1RA 3I2JA 2CWWA 5D01A 4N01A 5F78A 4LBVA 1IH8A 3NTXA 1EGAA 4EF6A 2JJ2D 1T4MA 4M9XA 2ZXEA 4Q48A 1MW8X 1MOSA 1N0IA 1I36A 1YFKA 3RUDA 4LNUA 1P9NA 5TF4A 1OX5A 3AI2A 3D59A 5BR1A 4JLDA 4Y6GB 2VPQA 3P9RA 3PWTA 4Z2AA 4BCBA 1DJPA 1P1JA 2H4XA 4NKRA 1T3TA 2IYLD 3KLMX 2CL7X 1KJNA 2JA1A 2ZVDA 1F1BA 3ZWXA 4EG1A 1TW2A 1IUOA 2HH9A 3NTOA 3E7PA 2IZZA 4DEXA 3AOEA 3M4YA 1P77A 1NL3A 3A6ZA 4MHOA 3OX1A 4HZGA 2ZULA 1EA5A 1LC0A 2B5OA 1ZVMA 2B5WA 2I03A 1PBNA 4IIHA 4HLUA 4R2LA 5TQ0A 2IP2A 4XLTA 1IVSA 2P3OA 4HGPA 4AUMA 3ICQB 2DUJA 4DUGD 3LIIA 5HPYB 2BFNA 4TT3A 2Z8XA 5EKDA 4FP9A 3RRNA 3AO0B 3VR2D 4UJ3A 4LZPA 3FPSA 5L3QA 4DR4B 4IIDA 1V96A 1ODLA 2L2QA 5C53B 5FI5A 3G0CA 3PUWA 3A31A 2WILA 1HDGO 4MS1A 1D9XA 1EFRA 1JWLA 2PRYA 4UASA 1VMDA 4LG1A 2PXHA 4GUDA 1Z8NA 4UEQA 4JJIA 4NNJA 1UF9A 3UYLA 3SEFA 2E5LB 1HT3A 5I9NA 5ES4B 4D8TA 2FETA 4LJSA 5EKXA 1CY8A 1ILEA 4GKAA 3H9UA 4F60A 1FRVA 1HLDA 3X1JA 3H13A 3I9JA 4EM6A 2RKOA 3HA3A 4PZLA 1ODSA 4O2BF 2OL4A 4ZYWA 5BW5A 7MDHA 3DSRA 2CF6A 5GZ6A 1OJLA 2OSBA 5ARDA 1X42A 2GUWA 1TQ2A 4AJPA 5AVRA 2VPPA 2P6NA 3V7NA 3H0EA 1PWYE 3OZUA 4YHBA 4L4YA 1E7SA 4ER3A 1G5HA 1OGJA 1L4EA 2YMLA 3G1TA 4E22A 5EL0A 3O9ZA 2FMKA 2CUTA 3HDGA 3H2KA 4K9NA 1H93A 2PK3A 3KT8A 2RGAA 3LX6A 1Z13A 2ZUSA 4WD3A 5BN3A 2HSEA 4JU9A 3SZUA 3MTBA 4AX8A 3KQVA 4OK5A 3VR5H 4HG2A 5I9SA 3O4GA 3UCFA 4FYKA 3DVAB 1X3LA 3C3MA 2IKSA 4UUAA 1XZCA 1QF9A 5F3RA 1QF6A 3PC4A 4LDJA 5JY1A 3VDNB 1VTKA 3GRPA 3UJ3X 3KTAA 5EJIA 4HV4A 4TL6A 5LXTA 3FOZA 1JHMA 1B7GO 1QP8A 3OLZA 1E2PA 1RJGA 3LVQE 1QFJA 2V7QD 4M1KA 4OP1A 3GLGA 2A3NA 1T24A 1DUSA 2F7SA 2FFAA 2WAOA 3N8GA 5THKA 4MVJE 2ZCUA 5DLEA 5DRYA 1Q0UA 4IUBS 3QTTA 3WA7A 1GD1O 1GPNA 1QDEA 2DULA 4FGLA 4Y6PA 4RMIA 3TSAA 5HRCA 1Z6QA 4L7QA 2P27A 4PPQA 4UOEA 3S4YA 3DR5A 1RWBA 2O3TA 2XQIA 3A3NA 3H65A 5ECWA 3UCXA 2QUAA 3DO6A 1I2CA 3JQQA 4RPGA 2NU8B 4A6EA 5LA6F 1PD1A 1OB5A 1F7UA 1F2TA 3RS0A 2G25A 1K7CA 1PNQA 3QELA 3PUKA 1WMDA 2DWCA 1UKVY 5A05A 1G8HA 1N7HA 2I6XA 1NHWA 4LJ4A 4YWJA 2J85A 4L4RA 3ITEA 1IJKA 1MV5A 3RSQA 3M4JA 2F8LA 2IHUA 3PL1A 4IDHA 5J4LA 4EF4A 1SKYB 2HKIA 1E3DA 2R87A 4KR9A 4P1ZA 1DWQA 1K6MA 1QHHB 3KJIA 4DA6A 3A1EA 3OOWA 2XH8A 1GZ3A 3RHZA 4F9EA 4DC1A 2VSXA 1I7DA 4EHAA 5JE8A 2YDYA 2WIAA 2WSIA 3UXHA 4D3XA 1XEFA 3R76A 3KV3O 4BNUA 1QORA 2QG6A 4LHSA 4AKEA 5DVZA 1AV6A 1XVLA 2CUZA 4A73A 3SWWA 5IM4A 2YWHA 3GLIB 1KP9A 2CVOA 1DQZA 2YTZA 3RU9A 3OUZA 3UV6A 3QVWA 3C5VA 2FPIA 4XRRA 1G5FA 4Q01A 3UWSA 4D6XA 3DBVO 3GCZA 4DCJA 1JU3A 3FYUA 2FPSA 1OCEA 4HVCA 1M0EA 3VSDA 3B8EA 4C7OA 2IYSA 4N9WA 2C9DA 1FTGA 1H23A 4CM9D 2Q1UA 5JW6A 4JBGA 5IH7A 1EDBA 4NJEB 1NWCA 1PZFA 4FNOA 4D9JA 1XJWA 2I34A 1RXVA 3PF8A 2EWVA 2FN4A 5D7BA 4ESHA 3WK4A 4RS4A 2W0MA 3OMXA 1JFSA 4PIMA 1Z25A 2YWRA 2EWWA 4OHWA 3ZI7A 3PNBA 2Z56A 4LJ9A 4FOOA 1ZBQA 2NG1A 1GA4A 4HWKA 4ZCPA 1NI4A 4LCEA 1ZU4A 2I4RA 2XYRA 2XTNA 3GEEA 4RZ2A 4W5TA 2JASA 4JOQA 3OJWA 4Z86A 5G4KA 4GFDA 4D8VA 3KKLA 3JQ7A 5A03A 2KBFA 5EQJB 3B1JA 3GOQA 1BXKA 1FNSA 1MTOA 3IAEA 3OC6A 5CH5A 3SZMA 5IKXA 5FLEX 5JNWA 4V24A 3ZXIA 1EVZA 1QTIA 2I1VB 1P2GA 4PAWA 3RTEA 1SXPA 2UVDA 3MJDA 3U7QA 4QXRA 4EVQA 4KWTA 5AVTA 3MT7A 2NU8A 2QMZA 2W6ID 2B8WA 3EWNA 3KUXA 3L8CA 3QHPA 1YRQA 5K9ZA 2AZXA 4BFZA 4HRAA 5E95A 2GPWA 4OFBA 5CPBA 1TCBA 2HNKA 4LNUB 3I32A 4P4SA 4F5DA 2TRSB 1GTMA 2D0PB 4OHMA 2KJQA 1A3CA 2LXNA 4OUDB 2R5FA 1BRTA 2W0SA 4OD0A 1UBGA 2YIVX 4UMEA 2JIBA 4UUQA 4DOMA 4ENQA 4CLOB 1Q15A 1SUDA 1UM8A 5FBWB 5A5EA 5IX8A 2P6MA 1Z7GA 4QYXA 1MPTA 5ESDA 2CJXA 2FSGA 3V2HA 3C6KA 3KKEA 3C7CB 4W5RA 4Q03A 1GAQA 1PR5A 2WFAA 3J7TA 3B1KA 3MMSA 4RXUA 4WZZA 4XSHA 3SEAA 1LQTA 1XTZA 4MVJD 3T3GA 3VDXA 5M2QA 5F1PA 2VHUA 4YIKA 1XRJA 1PJRA 4H08A 5FA8A 5G1NA 5JDIA 4LZAA 1U7OA 4JMLA 1OAOA 1UDAA 4L4ZA 1YDWA 5KBYA 4URWR 3RVQA 1F3LA 2XYQA 5A4AA 3N3AC 4FQ8A 5CXQA 4HQOA 5KQLA 1ULSA 3BE6A 1M54A 3GLVA 4Z54A 1Q6YA 4Y6QA 2A9KA 4EKYA 5K0TA 4OMFG 4YGXB 1Q84A 2GF2A 1GQYA 4HTFB 4JJAA 3AM3A 3I61A 2H1OA 1BE1A 2O57A 4Q34A 3T0IA 3BMQB 4Z3OA 2CD7A 3D3NA 1S8AA 4DBZA 1C1XB 5K6RA 2PUVA 1VIYA 3BUSA 3DAOA 3CF0A 3N39C 4HQNA 1T36A 2HHJA 4XDZA 5EXPA 5DW3A 3NCTA 3ZDYB 1YZHA 3PEWA 5D6OA 2FDRA 3AR4A 2C2YA 3PQ6A 4BNFA 2HMYB 4Y98A 4HDSA 1QR6A 5LQAA 4E33A 2D1SA 3NHFA 4H15A 4AQDA 4B3MB 5SV2A 3VZBA 4XB2A 2ROQA 2QMUA 3AVQA 3A2NA 1QQAA 1IRIA 3W9UA 2ZB4A 3VMFA 1U0FA 3BIWA 4JELA 3QLUC 1M75A 3WGKA 1ZMRA 4XQGA 3WSVA 3SFTA 1M10A 2DBRA 2XUKA 4ZCIA 3ZWOA 1XD2B 3DVRX 3EFBA 5EEGA 4IIYA 4IV0A 1OYVA 3JU3A 5LQUA 3IUQA 4L6IA 2PQ6A 1Y6QA 3EZXA 4LECA 1I80A 1P0FA 3BGSA 5JCXA 4OU4A 4B7CA 2JFGA 4BKRA 2HWXA 2CZCA 2IHTA 4ENRA 3N8IA 5BWMA 3CUTA 4JB0A 3L7YA 3PUYA 4RNDB 2ZIWB 1BWPA 4J6FA 1MV8A 3H2GA 1GUAA 2FQXA 1PT8A 2C2OA 4WLEA 3N28A 4BMPB 4QICA 4GSLA 1I2BA 4E5VA 2Q6KA 5TMPA 4MJ3A 1VL8A 1UZAA 2CBXA 2DUNA 3HU1A 1RMTA 4RADA 1J5XA 4TKUB 2EVWX 2ZB8A 1M2GA 2YIJA 3AG5A 1GG5A 1F20A 2RBKA 3EUWA 4GOND 4WLFA 1TA9A 2AFIA 2R6DA 1U28C 2IODA 3GJTA 5FFMA 1B2LA 5KU7A 4PZCA 2GJAA 1PDVA 2EFHB 4QGBA 1G5TA 5TVGA 4CIYA 1BG6A 2GH1A 2VYFA 4L8WB 5LB2A 2YXLA 4FMCF 1IBRA 4FVTA 4F91B 4Z1MD 4IVPA 1CS0A 2QL7A 1FXWF 4UQLA 2EW1A 1MAUA 1YAJA 2JJ2A 1WE2A 4LTMA 3HCAA 5ITVA 4A36A 4RPKA 3G2PA 4H18A 1TCCA 4UEKA 1FUEA 1KY5A 3WGTA 3IAHA 2MJLA 4MWEA 1E77A 4DYHA 1TK2A 1THMA 1BMQA 1ORRA 2QYSA 2WIKA 4GO1A 4R8SA 3OZ7A 1SK8A 3EOAI 3SICE 5FBZA 4NYMR 4HEA1 3KQTA 2F17A 2N1MA 4TSKA 1JILA 3UMJA 4LVUA 2GRJA 3PHGA 2RI6A 5EJ2A 1LLFA 3F5QA 2CCJA 2P4HX 2XCQA 3AEQB 2VJBA 1NXVA 3KWMA 3NORA 4MGKR 2BFEB 1Q50A 3N2KA 1OBFO 1OWMA 4DDVA 2AXPA 1LXCA 5LBUA 3T3HA 1WB6A 4IZHA 4YT4A 2F48A 4BHTA 1N0UA 4XLLA 3ZXYA 3EVAA 2YV4A 1RYZA 2C2KA 1CJUC 3URMA 3GLFE 2NYVA 1TZMA 1L7QA 4J94A 5K8CA 1VRCA 3KJQA 3MJVA 5AQ1A 5EHNA 3EZLA 3BHNA 2IX9A 5H3LA 3PJFA 3H6GA 4URXR 3ZCQA 3GRKA 5CB8A 1SKBA 3OCVA 5EE3A 1H6BA 5ELXA 1FXSA 2BGTA 1MCZA 1EXVA 1UCFA 1UPUA 5CFPA 1ESZA 3OE4A 1P4AA 2A5JA 2LR0A 1EB8A 2ZBQA 3AGQA 2X77A 3SG0A 2XCSB 4B6OA 3Q7RA 2F9FA 1KYQA 5L4LA 4FN5A 4DQKA 1QQ5A 1W0KD 3HBLA 1FFBA 1ZOLA 1DO2A 1YNSA 3HXPA 3KJXA 2FZEA 2Z9BA 1J8VA 1FOEB 2EZUA 2R62A 3BK7A 3GFRA 3HC7A 3D3WB 3OTIA 4I7EA 3JXEA 4PW0A 5DISB 3USZA 1Y5LA 5DBOA 4BFSA 2HHHB 4FJ0A 3ECSA 4F4CA 3PG5A 2YJNA 1TFRA 1JHAA 5AJZA 2PX8A 4J9VA 4QGHA 4HUJA 4CV1A 2NO7A 1YQXA 1O95A 5A9SB 3AVVA 4D3YA 5JCPA 3HFSA 4L9SA 2C2WA 3DJYA 2PA3A 4NOJA 5FPYA 1B3RA 1ULTA 1Z7BA 1PZHA 3M6MD 2FSIA 3T7CA 4M9RA 3O73A 2FVXA 3UJAA 3FBWA 1ZICA 2PAAA 4KQIA 2P4UA 5EIOA 2TMKA 1YZFA 2P78A 3IODA 2A6PA 4C05A 3NKFA 1DPFA 2DQZA 2XXJA 4NK5A 3ZVRA 3PUHA 1KAGA 3PPWA 5AW4A 3FCYA 1LI7A 3QU5A 2FKNA 2DKFA 1JAIA 5CITA 3FYUC 4TL8A 5KVVA 1IUNA 2VNHA 1KTIA 1IK6A 2H11A 4ASUD 4C04A 1O4WA 3GX1A 3W0LB 4QUDA 3N2EA 3L7BA 3TJMA 4YP0A 1P81A 3NAMA 4HYTA 3TXXA 3EMKA 3ND9A 1EX7A 4Y67A 2R6CA 2QBYA 2QJTA 3FHJA 1CEEA 4AP6A 2DFVA 2ORVA 1QH9A 1CS4C 2XUHA 3MOGA 5CT6A 4DV5B 1H69A 1QVRA 3GT0A 3KR1A 1Y81A 1TIBA 4TGLA 4X94A 5IYZF 4C0SA 1TW3A 3HM9A 3LO8A 1E4OA 4F1JA 1UXOA 3WQHA 3D4LA 4D9BA 5KNDA 2NSLA 2GZMA 2Z3ZA 1GILA 3R0VA 2ILTA 4E31A 1C3XA 4D9CA 2HBYA 1FDTA 2OAEA 2PR2A 3VOAA 1QPZA 1ZJYA 2OO5A 4C5CA 1JSZA 1V16A 5G0VA 1S8FA 5F9HA 4GPIB 2NXEA 4H1TA 4UEWA 2EGGA 3EWSA 1F8GA 5DRTA 4ZVLA 2VOJA 1C7RA 3AQ4A 3GGCA 2OILA 5IJWA 2VHTA 1ZN2A 1XX6A 4Q9JA 4CMEA 1BD3A 3CUSA 3IV6A 4WXHA 3FNGA 4PBSA 4DRYA 4RNCA 2B1JA 2JAOA 4H1UA 4ZODA 1CY2A 4PNHA 1EIWA 1V8DA 3ANTA 4AJ4A 4J07A 3RHFA 2ZJAA 3WLIA 1MRZA 1HC7A 2R7MA 5SYNA 4EKIA 4LXXA 3KELA 1NR5A 1F38A 1KSHA 1VHWA 1JLMA 3CA8A 4KX5A 3ZNPA 3T5PA 2XWPA 4MW4A 1ORVA 1ECPA 1MC4A 4FDUA 4RV9A 2RHOA 3PXXA 4J03A 1EFUA 3JD3A 1TC2A 4HFNA 4TMKA 5EIAA 3UYKA 4D4GA 3D7MA 1H9CA 1JNXX 3OF3A 2EHDA 1R64A 2IL1A 1R4AA 1KBOA 2NTYC 4HRYA 4PHTA 2C7VA 3EVTA 1B0UA 4GP6A 4NCIA 4QG3A 5J2TB 2JZOA 3A6GA 5TPZA 3WWYA 2J5XA 3DVAA 3SZGA 2ZIVB 3SFVA 1XXHA 4K2AA 1AKMA 3SC6A 3MJ4A 4N0QA 1IHYA 1RQ7A 2BEUA 3S44A 5K8TA 1GKIA 2AE1A 3F8WA 1LWOA 5C5EA 4KQCA 2FEKA 4RHFA 4WCFA 4JGBA 1ZD9A 4QQKA 3QRWA 1NPDA 3D2LA 2VYQA 1UKAA 2WC1A 5BUCA 4JQSA 3ICVA 1C9EA 1L7PA 2GZAA 1B6GA 4X3PA 4X84A 4BRUA 4DCSA 3EPLA 1JDBC 1MABB 1YZLA 4OB6A 2A57A 2WAMA 1H0KA 5DN9A 2XUGA 2NPOA 4PIVA 5TF0A 4MRPA 3B9RA 4PHGA 1IHDA 4G84A 2IBSA 1I7LA 1VBKA 4N0MA 3OCJA 4OP3A 4JC0A 3ZUPA 2XZLA 2AUMA 2EP5A 4HKTA 4CDGA 2MR6A 3G7NA 3MK31 4KLAA 1KI6B 4DHWA 3AF2A 4JK3A 2XCOA 3ZYZA 4EITA 2XCLA 5A4MS 5FV4A 2WSMA 1XR3A 3CWQA 5FLYA 1EEXB 2AF4C 4R7GA 3W2EA 3ZJTA 4BNDA 3C3YA 3PQFA 4II7A 4U39A 3TJRA 5H80A 3AHIA 1IK4A 4L72A 1XU7A 3IP6A 5EJ5A 5LNK1 3DNPA 4BE4A 1U8UA 4QVKA 4B76A 3QU4A 3FPGA 1YFLA 4XFKA 1MZVA 4AULA 3MLBA 2LIVA 4WV3A 3HJGA 3SHTA 3NTVA 2G72A 1ZJWA 1OLXB 5EUCA 2HREA 4QOJA 1ECLA 4B7UA 1GTZA 3PJEA 5DP1A 4DAOA 5CNJA 3KBOA 3HI6A 5DKFA 2JZNA 4WBXC 1LD3A 2PYZA 3D3KA 3H17A 3LT4A 4M88A 4F2WA 2WF8A 2Y8EA 4CR7A 1RFGE 4RGVA 4E1BA 4YT8A 1LFAA 2MMGA 4P84A 3MJRA 3E7DA 1AUXA 1M8KA 1NW7A 1LW6E 1PV1A 2JCYA 3BRCA 2PUBA 4N4AA 3ZV6A 1DRKA 2FFRA 5HR5A 4RA6B 2I29A 2OOSA 3M5WA 5KS2A 4L5IA 3QX8A 4DSNA 2B34A 1YS6A 4YT5A 3T0FA 4ZCTA 2DQKA 2CXNA 4UVIA 2EEPA 2PS3A 4OI2A 4OJMX 1K9VF 1Z2CA 4X85A 3ZBUA 5JZMA 3MG9A 5IN5A 2VLIA 2FG6C 2R751 3SX2A 4OQ4A 2QNBA 2OXEA 2PVPA 4O2BA 4XTCS 2KM1A 2NVWA 2ZR0A 2VRNA 3LQ4A 4MOWA 1IAVA 2AFIE 3ZY3A 2TECE 4RJLA 4JZYA 3ESYA 3L1KA 5GV8A 2PN1A 3P52A 3FTNA 4C1BA 2LIPA 1GPDG 2JJYA 2PPVA 1R6BX 1W0KA 2VXOA 3MAJA 4LKOA 4C2UA 2F3SA 2EC5A 1V7PC 1X77A 3FUUA 2GETA 4WQMA 1UPTA 2QAJA 2E4AA 2JB9A 4K6GA 4MXDA 3TPZA 3OEEA 1NONA 2IE8A 3I12A 3TLXA 4DV6B 3FNQA 3IAM6 3EVNA 3I2YX 2QDXA 2VP2A 3OZXA 3VAZA 4EGCB 5BQFA 4QLBA 1FW6A 1EWTA 1XRSB 3CQ9A 1O94A 3JQAD 1H4QA 5K8IA 3ORSA 1E8DA 4KFRA 2I6QA 5G0TA 4XW2A 2J4FA 2QPTA 4M99A 3MS2A 2AZDA 2H2IA 4WOCA 2PZMA 2A84A 3BHJA 4D4HA 4NDZA 3WMGA 3IIJA 3VJRA 4YJ3F 1XRMA 4KRXA 4I4IA 3PPIA 4ZP1A 3R3VA 1V7ZA 2HAEA 3BHMA 1YR3A 1ZOSA 2IY8A 4UTOA 4D9GA 3HUUA 4I81A 1ZWKA 4HN9A 3QP9A 5L3ZA 3I6QA 5KNBH 2QUHA 1VIMA 1TD1A 2GTPA 3DHEA 4XARA 3RF7A 2OZLB 1GN8A 2R6HA 2B36A 4A8JC 3M5PA 2ISCA 2Y1DA 2OO5C 4R1PA 1NU6A 3UANA 3P9SA 1A50B 1X8KA 5G1PA 3IKVA 3GQBA 3WIDA 2FG7C 2FP3A 2I6FA 1XQWA 1XZMA 4GHWA 3U3JA 4MR8B 5TR9A 2X76A 3F78A 2GQ0A 2B7LA 3RO7A 2W2PA 5EIBD 3BCSA 1GDHA 4W5WA 1M6VB 3QJYA 3QWBA 4KWCA 1KMCA 1AZSC 3K8ZA 4O4JF 5KO2A 3EQ2A 1G3RA 4MUHA 1YR1A 4RVUA 3K2EA 5D3ZA 3I6YA 2X0DA 1NI4B 2Y6VA 1FK8A 3LY8A 3W8RA 3FF4A 4F9FA 2V7VA 4PRKA 2WAYA 3WKDA 4D4LA 1ESNA 3DLPX 3OH8A 1T8YA 2A88A 4QE3A 1OLSB 2XI4A 3QLUA 3UWOA 3K1ZA 3IAUA 4E5NA 4WNAA 2C3OA 3KV1A 4KI0A 2HK6A 1DG9A 3QPCA 4DR1B 3K3PA 1NA5A 2JH8A 4C6RA 1N2OA 1VFPA 3DOOA 1FFXB 4TQGA 4WA8A 2EYUA 4RH3A 3VNSA 3FCOA 5DGIA 2OHGA 2DWPA 2JIZA 4UPDA 5B3KA 3FYUB 1FFDA 1NQWA 4V0RA 3BPSA 4ND1A 1C1XA 5CFLA 3L40A 4F4DA 3FMPB 3LF1A 4UTNA 4HT3B 3WGHA 1ONBA 3VKHA 5D5HA 2P7HA 3LUFA 1AS2A 1S2NA 3SSOA 5CVTA 1W0JA 1UKZA 2ZIFA 3K92A 4QYSA 4OGLA 3BH6A 5EE0A 4G0NA 3A3OA 5E3HA 1MIOB 4MR9A 2Q1SA 3DKKA 3P8ZA 4TRMA 3EVZA 1JHZA 4MDYA 4JS0A 1RE1A 1M6NA 3OBBA 1VJCA 4AXXA 2J0UA 1E59A 1NY6A 4Y2TA 4G85A 4RA6A 1RAEA 4KSBA 5KI6A 1F8YA 4RVSA 4TX1A 4CUJA 2VCEA 4E94A 1A9OA 1SZCA 2C54A 4QM7A 4D8UA 2P11A 3JQ7B 1XUOA 3QE3A 3EYWA 2PKQP 3HP7A 3AW8A 1C81A 3A2MA 1NBIA 1LDEA 1M6YA 3SDBA 3DZHA 3VBCA 3WRXA 3ZV7A 3T3PB 1CQZA 1EWQA 1Z26A 4L4UA 5T3UA 5EUBA 1I5OA 3R9KA 1NX6A 1HF3A 4LOAA 3OZCA 4C6SA 2ZUFA 1YR9A 1QQBA 5LB4A 1ULZA 1SUPA 2R47A 4FGKA 4JY7A 4TQAA 5B36A 1TYEB 1YB2A 1INLA 2Q9BA 1B14A 2PZBA 3IP3A 1PW5A 1S5PA 3JZFA 4J0DA 3P9NA 3OIFA 2X5JO 2YXEA 3D6JA 3T8YA 2NV2B 2VH2A 1AO0A 1X7WB 4O2AA 5IKOA 3MD0A 1RFLA 2X2OA 1I3OA 3R24A 4BP9A 3PHLA 2RHBA 3N2GB 1RE0A 1MAHA 4J6EA 2O4UX 3B78A 2EU8A 1GKLA 3GJYA 2CSXA 3OMLA 4TWRA 3SIXA 1I0LA 3E61A 3DZDA 4GBMA 2QM8A 1IZ8A 2H9YA 3ASYA 2VJDA 3E2MA 4U7TB 5DCUA 5GADl 1U63A 1Z18A 2PL9A 2Q21A 3A6DA 3AMVA 3ZKAA 2HJHA 1GYQA 3H0KA 4ER0A 4J29A 1QYVA 1OHHD 4R51A 3S2SA 2CNDA 3VPDA 4HB4A 2W2XA 4JUCA 1H6CA 5A62A 2ODPA 4CIWA 2FA9A 2VJMA 1FS4A 2QRKA 3AVTA 4DCGA 1DAEA 3IKTA 2CKDA 2J87A 3ZQ4A 5K3DA 4K46A 2JLCA 4Y18A 2O06A 4LHVA 1JEYB 1LVUA 2MR5A 3KOYA 4U4AA 4HZUA 3NYQA 4Q00A 3H2YA 3Q7SA 5D3MA 1FNCA 5L7TA 1WL8A 3CX8A 3FVTA 3O82A 1JA1A 1JVNA 2OR3A 3LKDA 3HUTA 3VMMA 1VBFA 5DXJA 4UMVA 1U3GA 4YJHA 2X4LA 4WBNA 2GO1A 4BBJA 3PT9A 4DJAA 4FONA 4ARZA 1U0LA 4M1SA 2E4ZA 2N9UA 3OWHA 4KLCA 5C4IA 3DMHA 1TMGE 1HNNA 2VT7A 3V1LA 1NUUA 1EJ2A 1YJQA 5TS3A 3QYFA 1OX6A 1NVTA 2J0SA 2ZJYA 2HT6A 4Y2XA 2RGGA 4B3BA 3K6KA 1XKTA 3O0DA 3GMSA 4NHEA 2GPJA 2Z2ZA 2AXQA 3GZJA 5TARA 1J1ZA 3QKWA 2JLYA 2W71A 1JSCA 3DUWA 1KK2A 2C2HA 1QZXA 4MW0A 1MGOA 1DRJA 1E94E 3HCOA 2H8KA 4UNSA 1B74A 1VMKA 1ICEA 3BEOA 3UB3A 3CT6A 5AVXA 3GGPA 3NRCA 1JG3A 1M6VA 2ZTLA 2I7DA 3PITA 4GRDA 1ACJA 3AKYA 3CLTC 4M1ZA 4TMZA 2FLWA 1O7JA 4NNOA 5JC8A 1P2FA 1U0SY 1ETHA 1U8FO 2BGLA 5HDQA 2FI1A 3RBXA 4Q1BA 1PO7A 1SWVA 1GCUA 4M9SA 3W5VA 4HGNA 3HS3A 4DUGA 3IUEA 2G09A 4CM4A 2GD2A 4P82A 5BNWA 2FN8A 2JGDB 3D02A 2WIFA 3I9FA 3MCWA 4FMCB 1TUGA 2B20A 3AZQA 1T6XA 3GY0A 2R65A 4P4LA 1FMTA 4FYVA 4MS4B 3FTQA 2JFWA 2FXVA 1R15A 2ACVA 4ZV9A 4F12A 5ALMA 1ACMA 2PT5A 2AWNA 1Q1AA 3MVEA 4GMGA 1YVPA 3NM5A 3P71T 5E3JA 1SHTX 2REOA 4MP8A 1SN7A 4ZCLA 5IBRA 2J9YB 1GPMA 2ATCA 4LCJA 2VUSA 1Y4DE 2A1TS 1FF9A 4UXHA 5AK0A 1FXUA 2H57A 3TRJA 2X7HA 2ZRHA 4KRYA 5JROA 3LCJA 3WV4A 2GFQA 3X1MA 2AH5A 2C20A 5ALQA 4HI0E 4XM1A 3DNMA 4IUDS 2H1WA 1ZJ4A 4OBBA 4N41A 1QGUA 3H8VA 3L01A 4GVXA 3ZBQA 5FHQA 3IESA 4JLVA 4P2GA 1U0RA 3BRWA 4B6PA 1BS9A 5LMCA 1O6CA 4L73A 5G41A 4JV5B 3STTA 2WM2A 2IUYA 2RAPA 3F6PA 3OOHA 1ZM9A 1QMPA 3OOSA 3RU2A 5I8PA 3Q8LA 1MHTA 4M21A 4C43A 1WSBA 1ZDMA 2P4EA 1STOA 4WZBE 1XNJA 4FDAA 2V8OA 1O6FA 2MSDB 2NNWB 1TJ4A 4IM7A 1WBJB 1SM4A 2EG9A 4U00A 5AI4A 4RSGA 5FYQA 4GF5A 2H4YA 3GGGA 2FP4B 1RZ3A 2NU9A 4HPXB 4D9IA 3U61B 4LZLA 3G8DA 1ND5A 2C4HA 3GIWA 3HJRA 1BWRA 4R3UC 4LQ4A 3VC2A 3K7EA 3HUDA 4FHZA 2FSHA 4IFTA 5B6PA 3TZKA 2BHSA 1CUBA 2FPPA 2WBLC 3LP8A 2WYIA 1Y6FA 2VNAA 4FFBB 1XB2A 1B1CA 2VPIA 5LZ2A 3HCBA 2WYVA 1Q0TA 1HNXB 2VWQA 1OXVA 3PWKA 1B8PA 2MTBA 5K03A 2XNCA 4HLNA 1X7GA 1YVEI 5HKKD 3CG0A 4KITB 2IPAB 3LX8A 4IOJA 2ANBA 2PSHA 5AI9A 4KPUA 1T0IA 1MB4A 3T7SA 4K6KA 2FTKE 2O8NA 2VNIA 2ZSIA 5B1EA 1DQSA 1XTSA 4FFLA 1VPTA 2FPWA 2PGIA 3JQ6A 1HEIA 3DMFA 1G38A 3EZ7A 4LHYA 2COEA 5AKLA 3HKEA 1QE3A 2DUUA 3OPNA 5IKEA 3DFFA 2VRWA 4HB2A 3VR5D 1QGOA 3P9KA 3HB7A 3TPFA 3B48A 3ZHZA 2X5XA 2QAGB 4TWJA 5KJEA 2V1UA 3LLCA 1DBPA 5K0GA 3CRMA 4MA4A 5I3CA 4TKVB 3M83A 3U3MA 1C9NA 3OZEA 1PEKE 5IBQA 5IW8A 3PXAA 1E8MA 3S8EA 1I7QB 4E12A 2ZGVA 5DH9A 1M0SA 4CGYA 3HH8A 3BBPA 3MWGA 4NIMA 5JALA 1XZAA 1EA7A 2A58A 5IXSA 3TQCA 4PPYA 3HVKA 2CXHA 4BJ6A 4D45A 2ZTHA 3CIFA 3MZ0A 5CFQA 4C89A 4PQEA 3H05A 1EVIA 1Z3IX 1GPH1 4EKEA 1DDIA 2BKLA 3A9SA 5KMGA 2YWXA 3SSAA 3B12A 3TFQA 2A9JA 1ZINA 1DBWA 1NG1A 1NXQA 1E0JA 1UFVA 3KHKA 5IF9A 1NVFA 1L0BA 2EZ8A 3TZHA 5LQJA 2C9CA 2D5BA 1JLLB 1OQAA 1OGIA 2HRBA 2YY6A 4W5NA 4EFMA 3G0GA 5F2OA 4OXIA 4GUAA 1X74A 4B7AA 5AIAA 3VAAA 4LZZA 1T4GA 1LF0A 3GAFA 1H42A 4UULA 1BE0A 1C80A 1I2DA 2HF7A 1YQGA 2CZGA 4GWGA 1WCV1 5GV7A 4C7BA 3V8BA 1TIPA 3HBMA 4D7AA 3ETGA 4HDKB 3S2YA 4C5AA 1J5EB 3K73O 1OFVA 5ITZB 4RDIA 4OHCA 5COAA 3T35A 3AVUA 5HCUA 1WIWA 2DPMA 4MROA 1G21E 1X7ZB 2I76A 4CLRB 4K9LA 3VNVA 1P72A 2WB4A 3EGDB 5IVHA 2RJOA 4CEIB 1PEYA 3HMKA 4N8DA 3WL4A 2PXAA 4NZNA 4YRKA 3TTXA 1OXMA 1VL6A 1JQAA 2XMDA 2BGMA 4HEJA 4XI9A 5KTNA 3VNUA 4BVEA 1CEQA 1PL8A 4ZIRA 3JZDA 2QLBA 1PWXA 2VSFA 3KUKA 2PUEA 1WVGA 3AP3A 3WWDA 5IAGA 3W78A 3KXDA 2IW3A 1X86B 5JECA 1GVHA 5FNVF 2DUWA 4MDHA 1I24A 1LV7A 1VHJA 2W8BA 1Q20A 2H6EA 4M49A 5LYYA 3I8SA 4X62B 5C8ZA 1Z6GA 3TRKA 1P4RA 4CL8A 1GA6A 4RD2A 4TVSA 4E03A 2PZGA 1J9GA 1HZZC 2JCGA 2AJ8A 3BF8A 2ZYWX 2FG5A 1PUJA 3AERB 4IFBA 4U7WA 4DARA 3T9BA 4Q4JA 4H31A 1J2TA 4OVKA 2G83A 2ZBRA 3DW3X 1EUYA 3W79A 4DGQA 1MDFA 2J59A 3ONVA 2NNLD 4QOEA 3EVBA 4BO8A 2HRDA 3AEQA 4OQFA 5B1IA 2I78A 5A3RA 5I47A 4CEIA 4FFDA 1WB5A 4NCKA 1XP5A 2X86A 3N0WA 3DDHA 2HMSA 5BO5A 4AMGA 3FAKA 1IBKB 5DBFA 5KYUB 4AP9A 4ARCA 1XTPA 4WASA 2PZKA 1G4AE 5CK4A 2VZ8A 2BP7B 3AEUA 1J56A 2CBZA 5FD8A 4XIGS 3BE5A 4ZDWA 2A1TR 1P9WA 3WWZA 3I6IA 4FLEA 1D2AA 5JS7A 1EAYA 3LKVA 3NRBA 3F6BX 4C3UA 5A5FA 4WUVA 3CW8X 5D8DA 1V1JA 1DT3A 3BIXA 3FPBA 2QW0X 1A8UA 4HO1X 5L4SA 2I66A 3QBTA 4PTLA 2RK3A 2W4MA 4UUNA 5DYGA 1NUHA 2NACA 2P9EA 5LA6B 1ESMA 3KE8A 4IGEA 4N8SA 2J7KA 4RK7A 4EGFA 2BFCA 2DHDA 2FYTA 2FWNA 1MO6A 3HTXA 2X3YA 1J9ZA 2BHNA 2QL9A 2VBCA 3IIMA 1X7XA 2UYQA 1UBJS 1U8EA 3E1KA 2QTLA 5DSZA 2IDJA 4CF3A 3BMQA 2IS6A 4TKUA 4BO1A 2V4MA 1P0CA 3U7GA 3UT0A 3QWHA 5ECGC 5K4GA 4AC9A 1RQ2A 1WMFA 3FIUA 2CLOB 1CJCA 2AJBA 2XOKD 2JFNA 3C7TA 4K1LA 1W93A 4PTZA 5K3FA 3M70A 1G19A 2D59A 4HH1A 1J23A 3KNZA 4IF4A 4BRWA 2WWHA 3SMQA 5BVGA 5C3UA 1OH8A 5E8RA 1FFHA 4Q4HB 4JHXA 2QRQA 3A4LA 1G3UA 4CWAA 3KFXA 2Z09A 3RAPR 1SBCA 2HZ7A 1DAOA 2X0EA 2XWSA 1Y34E 2G17A 2NZYA 4LS3A 4N47A 2FX5A 3VO1A 4KK4A 5CJPA 2DSNA 3LP6A 4RWEA 5C7LO 1RTKA 2RGCA 2NU7B 3CF2A 4TSFA 1NFQA 3ROPA 3ABOB 3T7KA 1P9LA 1T5BA 1RBZA 1LDBA 1H94A 4QOFA 5CX4A 1A5ZA 3B89A 5FB3A 3CM0A 2JFQA 2ZIXA 4CLXA 1KJJA 1YUMA 2QZZA 1XAIA 2RHMA 4LRQA 2P6UA 1H3NA 1GTVA 4WOPA 2CLLB 1CD5A 4FYWA 5FLXA 5ECDA 2QSUA 2VDRB 3KAKA 4GMXA 4KC0A 5IYZA 1GPYA 1YZGA 1GUZA 5G40A 1ETUA 4ZREA 3EMDA 4FGWA 3T1YB 4BZWA 1J1IA 1MQSA 4OQZA 1PL0A 1J22A 4HJRA 2BGIA 2CMGA 5A7FA 4L7VA 3HE3A 1Z5GA 4M0PA 2IWHA 3WLJA 1MC8A 2R4TA 3F98A 4YMVA 1XJQA 4KVGA 4Q6WA 2VDMB 5SYAA 3SE7A 4NCBA 3I4FA 1HDEA 4MQ4A 3ULKA 3B6JA 3RT1A 2DB3A 3CISA 4MCHA 3FYSA 1ZQ1A 4D0SA 3V1MA 1TEVA 3N0RA 3EBOA 3GN2A 1T4CA 1T2FA 2C3MA 3KKZA 3ZC3A 2HWKA 2ZI3A 4UXJA 3KKQA 2C8KA 1WO8A 1QX3A 2QVCA 3T4PA 1X1RA 5M04A 4I9FA 4IXNA 4UUOA 5LIPA 2QUIA 2E6KA 1DRUA 2VDJA 1A27A 4MRMA 3ZI4A 3ESAA 2HQ1A 3KWJA 3LY9A 1RXIA 3DEJA 3MPUA 4PYIA 1HNWB 4HATA 4OLAA 3ZGXA 1LPBB 5KWSA 3MFQA 3TCKA 7MHTA 1E1QA 3VPAA 1EYZA 1PSDA 3K2QA 4KIGA 4MRVA 4LY3A 2J3KA 1XCMA 2P2SA 4LBWA 2X6QA 4EY7A 4ZGGA 4LYHA 2OLEA 4PZDA 5IM5A 3KVYA 1U7WA 5KIAA 1QKJA 3BOSA 3L7JA 2NXNA 1C7JA 5FNZA 1FNNA 1E18A 1N1MA 2WJWA 2ZB2A 3CNQS 4IEEA 3KTFA 3MRXA 4U5QA 4XWTA 4D6PA 1QRSA 4IH4A 4KWHA 5EEHA 2FMIA 2XVAA 1J4AA 3DBHB 1SKUA 3EQZA 3NJ8A 1EBUA 2II6A 3ES9A 3QKIA 5T3YA 1QVVA 3BFVA 2GD6A 4ABYA 4CV3A 3HPQA 4OOEA 2GK7A 3CVVA 5EC8A 3AOGA 5HKLA 1PDOA 1Z0DA 4BTVA 5IAAA 1O4VA 4KXMA 3DDWA 1F9EA 1AGRA 2A5YB 2PZFA 1UK9A 4GMKA 4R8LA 4G24A 4G4SO 3A3KA 4O4LF 4DC0A 1LRJA 4I1IA 2QBYB 4UPVA 1LTKA 3AIOA 3C97A 4EHIA 4XUDA 3H1GA 1MX3A 1XCOA 1URPA 4LJ6A 2FUKA 3KB1A 5AKHA 4GP9A 3RUEA 4QJ3A 1X7WA 2I33A 4O2AB 4EW2A 1SXIA 3CRZA 4ZT2A 3BB1A 3PUZA 3BYZA 1H2RS 1R1DA 5EN4A 2GM4A 4UBMA 1L5LA 1VLJA 2WVHA 5JFGA 4AZTA 3AQIA 3HNRA 1C8VB 4MVJI 3DE3X 4C88A 4C0WA 2Y1WA 4QYIA 3V6MA 4AY4A 5ULLA 3TW8B 4O63O 5KOHB 2YRWA 1G16A 3NBXX 3CVXA 3U81A 3OCWA 1H2EA 2CFTA 1ZCZA 3OFNA 3W6NA 4CM6A 2HMVA 1PX2A 1UZNA 4YAFA 3ROGA 4ZAXA 3PVSA 3FFXA 2XNDD 2Z83A 3TQIA 3EGXB 2JD0A 2J7PD 2WIDA 1SCNE 1DEXA 3N7UA 3LKBA 2DQ4A 8ATCA 1YIOA 2CMHA 4GOJA 2VAPA 3O2JA 4H4DA 5SZJA 3TB6A 1N57A 2ZQ5A 2ECQA 5DNDA 2C7QA 3B7PA 2Z4RA 4LVOA 1A77A 3LW7A 3VC3A 1GTL1 2PT9A 2BGGA 2FHPA 4IJVA 4K88A 5CLGA 4BV2A 2XBUA 4E6EA 3Q9NA 4LV6A 1CDOA 2A5FA 5DHUA 3HDJA 2MCFA 5F4BA 3SLKA 2R6GA 2GVZC 4C7XA 5HIIA 5CM2Z 6YASA 1ZSYA 5EJ9A 2XRFA 3ZX4A 2FUG6 1YDFA 2I3AA 1P8JA 3AM1A 2FJUA 4IVQA 2B99A 4DIUA 5LR6A 2SICE 3ZDBA 4K6HA 4JYPA 3U7QB 2GLUA 2H1CA 4YP7A 2ZRMA 4I9UA 2Q6LA 1M1YB 1OV4A 3VSBA 4Z0HO 1UIMA 1X80A 1P17A 5DN6A 3ZHTA 1Z8DA 3KEFA 2HIHA 3L3BA 2F43A 3AGPA 1R74A 4NQRA 1KPIA 1XZIA 2CLDX 4G5FA 2GOYA 3V33A 4TS3A 4CDMA 1FPMA 1Y1TA 1Z82A 2GHTA 1RLOA 1ZGAA 4NV0A 4FC6A 2E4VA 4FW8A 4XLZA 4D4MA 2ARKA 3KJZA 3PQEA 4XWWA 1U99A 5GAJA 3I58A 4HQLA 1SD2A 5CJJA 1DWPA 5CM9C 2HF8A 2E89A 1EZ1A 3CUEF 1AJEA 2N46A 1S2IA 4RWZA 1ZOPA 1SU7A 4HBZA 2RAUA 2CJYA 3IV9A 1WVIA 1A04A 1CUSA 3CTMA 1X8LA 5EA2A 3R9WA 1M6WA 3HJBA 1AK1A 3GR6A 4H3KB 4B4DA 3J81k 4IIBA 1E2IA 2PRSA 5JS1A 3BAFA 4RZHA 1YU9A 3CPJB 4G1BA 4F06A 5GOTA 4TV9F 3OHPA 1F4LA 3ORHA 2H52A 5LQDA 2GF0A 3G8AA 5E1DA 1KVSA 2Y1GA 4R01A 4CEHB 5KJ1A 4TT3D 3COYA 4IOKA 4PRZA 2NU6B 4X5OA 3IT2A 3V7UA 4N7BA 2Z5LA 3ID6C 2X2PA 3E9RA 4LDZA 2JFHA 1T36B 3F7NA 1L7VC 3N5KA 4IHKA 1U8XX 4W5HA 4XVHA 3IJ5A 1H2AS 4Q1AA 5CVCA 1EFCA 1KEEB 4D79A 3DV0A 3R0XA 1W44A 2A33A 1L3BA 2M1ZA 2VP3A 1Z0AA 3DZ8A 4L75A 5FPPA 4KV7A 3R7BA 4JYAB 1LJUA 1CG6A 2QT1A 4I9HA 4V0KA 1XDWA 2R8ZA 3TNLA 3WL7A 5BWCA 1Y9ZA 1HDXA 1W5TA 3B1XA 1ISIA 1NVEA 1FU8A 5F7OA 5BQ3A 1HQDA 4XOIA 3HB0A 4IMPA 1JJ7A 3GGOA 1IE3A 2F2TA 2ZBDA 3KYIB 1K4MA 1FLNA 2ZU6A 3P97A 5D3KA 3NH9A 3R23A 1COZA 5AYVA 4CQJA 4EB3A 4C0BA 4Y0NA 4YYEA 4ARIA 2ZI5A 1YRHA 2FKAA 1N9GA 2HTFA 3GDFA 4TN1A 3SF8B 4E2WA 3U4DA 4O2BB 4BNTA 4D43A 1L1RA 2E3JA 3TECE 3DCNA 3EZFA 3RNOA 3MCZA 4XR9A 5I7SA 1BRMA 4FMDF 3EXHA 3JQ8B 2DLNA 2VP5A 2ZIAA 4JL8A 3VTAA 3KC2A 4OQDA 4YAEA 4CFZA 2WHQA 3RSGA 3GWZA 1NASA 4HNRA 2BFDA 5HIJA 4Q7EA 2P41A 1A96A 4IRXA 3TRHA 4CU5A 4H6VA 1GSIA 1YSCA 4F71A 1JFFA 2VXCA 3GARA 4YA6A 2IGBA 5HZKA 4RSHA 1YFZA 3TCXB 1KFBB 2VYCA 1KQOA 1I5EA 5LZ7A 1Y42X 4GP7A 5C8XA 2WHYA 4RH0A 5IDWA 1Z45A 2JANA 2D2FA 1SQ6A 4A0RA 1GPKA 2XCIA 3A27A 4LMRA 3AVWA 3K0CC 1RKQA 1WUTA 1VCIA 3HZHA 4JSYA 4O59O 3DBHA 1E7RA 2ZJ3A 3H7IA 3EF3A 1GL7A 1OXSC 1SA0B 2YH2A 3Q3JB 4MQFA 4BUCA 3DH0A 2NADA 1XNGA 2AVDA 2XQKA 3A1VA 2WPNA 4QDUA 4RD4A 1JKXA 4ZYTA 3LT5A 2ZUEA 1P4HA 1ODJA 3MTAA 2NAPA 3KP1A 2HDWA 5IT0A 2J32A 3EGIA 5JCOA 1F60A 4RHTA 1RAHA 1YBFA 4ZJYA 3DG9A 1FX0A 4N39A 4OIMA 4R2HA 3I2KA 5EY5B 2BD0A 5H59A 3ENWA 1L1EA 1A9RA 1M6EX 2AMJA 3D8NA 3DBLB 3EGCA 3D4BA 3MJCA 3PGJA 1TO1E 4IS2A 5HG0A 1BIFA 5TRTA 3EC1A 5IVPA 2OBFA 3ZG6A 4E13A 3ILSA 4E5YA 3JALA 1X9HA 4HHEA 1CX9B 3GLHB 5GONB 2RH8A 3PT5A 3T5MA 3UG6A 2D0IA 3VTZA 4ZVMA 4C6TA 3IFSA 3WBBA 5HX7A 4IOMA 4B32A 1RWMA 4RS3A 4V02A 3THXA 4NYJQ 2AZ4A 5CBPB 1UBRS 1L4YA 5IABA 4ZDJA 5JZ9A 5F9FA 4UARA 3RFCA 1MZPA 2OLJA 4A0FA 1GWNA 1U0TA 1M2NA 3DZJA 3FI9A 1OZGA 1SVIA 2FUG1 4GMHA 3ZHYA 2VZ0A 2A14A 1QG0A 4EPYA 2HY7A 2O1EA 4GOMD 2YS7A 1PYOA 4KJXA 2EYQA 2AR7A 2QGNA 3FMFA 3HBAA 4Q3EA 1AKTA 3DONA 3I5XA 2ZVPX 3EGEA 4CKBA 2Z95A 1SRRA 1OI3A 3BD7A 4IXTA 3LFUA 5AKYA 5B64A 2WA1A 3C3AA 3LA6A 5GGYA 3BFPA 4X7MA 4QBKA 4X8MA 3SXUA 3K8QA 4BQQA 5KNLA 1ZISA 4P08A 3PJGA 4GDFA 2P9HA 2J3EA 2YW2A 3PNVA 2JGAA 2IE0A 5KYKA 3IE1A 2C2MA 2V9ZA 2B98A 1XZGA 1I13A 1O6GA 3GP5A 2D54A 2YYZA 3O1JC 4OLJA 1QSGA 2JBWA 1DLIA 3A32A 4WIAA 4AUKA 4D9NA 4EF5A 1GEEA 1BH6A 4YALA 3WIBA 2IH5A 1JIKA 4DSOA 5DNYB 2BWJA 3WIOA 2ZIEA 3HCFA 3PDCA 2GRUA 3OQPA 2GR9A 2XWJI 1CP3A 1HRDA 2V54A 4KCGA 2JEYA 5L95A 2EKQA 5EP1A 3DBIA 4KFCA 5FPKA 3BFXA 1QNLA 4D9HA 4PCAA 3COVA 1PFYA 3ML1A 4R1QA 1TT5A 2V3VA 4MGIR 1RHMA 4YRBA 2DOKA 5GINE 1GAJA 4UE3S 4RO0A 3U3RA 1E9SA 3TE6A 1T3ZA 3W6ZA 3AL2A 1DEHA 1PT5A 3BXZA 4FFVA 5K8LA 1QV9A 4A8JA 1QHXA 1CEYA 1Z2OX 1TM4E 4ZDKA 3RWBA 1CUAA 4I4TB 3R77A 1AX9A 4JQZA 1VMAA 1E6MA 3KEQA 1MN6A 4JYBA 1S2GA 3CF4A 3R7LA 3EPJA 4DR3B 3JQFA 4UEJA 1V11A 4RTLA 1SFRA 3H1BA 3IB3A 1E20A 4KP7A 2IEDA 3SYNA 2X22A 3H7AA 2JFVA 3IALA 3AB3A 3UAZA 2AMLA 4DLBA 1W7AA 1VLMA 4OYLA 4Q4LA 1LSSA 2FRDA 1KAHA 2HPZA 5ALTA 2HMAA 4TWIA 3D4NA 3R3JA 4MCIA 4WDQA 5IEBA 1OT3A 1JPVA 4UXIA 1S7GA 2HHAA 4ZO8A 3LYAA 4L15A 1BGVA 4XSVA 3AI3A 3ZCRA 1M2HA 1TMOA 1EM6A 3A7EA 2G4VA 1DC7A 5AW9A 4YXWD 1NFFA 3R6WA 2JVKA 5DYNA 1N7GA 1LLUA 1X7DA 1G8SA 1XWIA 3NOQA 3A9CA 4LY0A 4WXYB 5FAKA 5K3OA 2H0QA 1N9KA 4DPKA 3DAHA 5A2QA 1CJKC 4A10A 2EDCA 4JFAA 4QDJA 2OV1A 2Q8NA 2ZXUA 2CLCX 3F9CA 1BDHA 4L28A 5B58C 2ZRPA 4HLQB 3CR8A 2ORYA 3Q0IA 3LTNC 1WCIB 1ZFNA 4U6SA 1NN0A 4OB7A 4EUSA 3H5LA 3BICA 3WADA 5IZCA 1X14A 1AG9A 3GUZA 3ZZNA 2E18A 2IPOA 3FVVA 3G9TA 2JRCA 4XYBA 1T5TA 1ORIA 2WYOA 2BGNA 2Y1CA 4Q66C 3KB8A 3RSCA 3P9QA 3RIMA 2YBDA 4ZJUA 3Q3CA 4RYDA 1GNPA 4B7ZA 1C0IA 3MMXA 3QLVA 2ZYUX 5DWQA 5HS6A 1UJBA 3HU3A 3QVSA 4LOIA 4PBTA 2Z0MA 3BB3A 1DRWA 1V4NA 2WIJA 1V8OA 3P0JA 4ITVA 4GOXA 5ALHA 5BQOA 3DXYA 4RC9A 2XOXA 3F1KA 4BKOA 1JDJA 4ZFNA 5GZ1A 5CXXA 1Q21A 2QVBA 1E64A 4F5EA 4LDAA 4UOQA 1X9IA 1M8GA 4I3HA 1W581 1QB7A 4RIIA 2ISSD 1AUPA 3EISA 4X1KB 1U81A 2WJAA 4UAVA 4S24A 2LBPA 3RRJA 1KEKA 1IZZA 2GPNA 2YXBA 1RWKA 3FPKA 2LVBA 4FEGA 3T1OA 3KYJB 3JVDA 3CLVA 1X15A 4CKEA 2HV8A 3S8MA 2QLNA 1QS0A 3NH6A 1M66A 3LHSA 3NWBA 5ENVA 1VLHA 2XNSA 3RYIB 2HU2A 4I1YA 1NJSA 3AR3A 4I1UA 2IEBA 2OPHA 1GTSA 3CZ9A 4WFJA 2PV0A 5DV9A 4ZZIA 2HADA 1YF3A 4EMBA 1N6PA 4CM3A 3GMTA 3SLRA 1AQ6A 3A7DA 2IH4A 1PJCA 4C08A 2O3QA 1J00A 2FMUA 4IF6A 4LW8A 3AG6A 6CHYA 4F21A 3IOYA 2JFXA 4BEJA 5FWDA 4N0PA 3B6ZA 2XT0A 4AKGA 3GH1A 5JFOA 5E7QA 2ENWA 1NIJA 2EJVA 5KKNB 1EBFA 2WD8A 4FGJA 4ODIA 3PLAE 3BH7A 4NBRA 1FNDA 2VF5X 2OCGA 3PX3A 3ZWNA 2WG2A 3DDCA 5KVSA 4UDXX 3QEBZ 4PANA 5HWSA 2RGWA 3MILA 1TVMA 4F96A 4MX8A 2Z8ZA 5BV7A 1LPNA 1TUEA 5FL3A 4IIJB 4H3HB 1KI6A 1PHPA 3LHFA 1LU9A 4TLDA 1EFHA 4FFWA 1XMOB 2E9SA 1YA4A 3E9MA 2GBCA 1N0HA 1BDMA 2X8JA 1XRNA 4NCXA 1K3FA 2BJHA 4WI1A 4NCHA 1KU0A 4YQFA 1WUIS 4ZT7A 5FIUA 3C5HA 4TT8A 1G55A 2BM0A 1ATIA 3ANXA 3MWEB 2GWHA 3PXBA 4ZI7A 3DWGA 4PC6A 5BVGB 5CBKA 3UAVA 4BNZA 3AY3A 3PQ3A 4RKFA 1QHIA 1JDSA 3GJ6A 4DILA 1WCYA 1RYNA 1D1TA 3EEIA 3SKVA 5TEVA 4V0QA 1E32A 4DM3A 4HX9A 4M2LA 4YB8A 2V6FA 1QHFA 3PFFA 1PQPA 1K97A 1R4NA 2OCAA 2I3ZA 3ZE6A 2H59A 4BVAA 2CYCA 3UT5A 3W5IA 1A8IA 2R8PA 2MYNA 1EGVB 2Z08A 2ZSAA 4FDVA 2WT9A 5IVIA 3DPSA 3OQMA 4QM6A 5BN4B 2CXRA 2AQKA 2GMWA 1KMHB 4OAOA 3ZDXB 1XEWY 2CBGA 3CT4A 1OXBB 4ENVA 2HMTA 1JHRA 1VXOA 2E5WA 3QF4A 3RFUA 4XUCA 4C30A 3CKLA 4XE5A 1MO5A 3RV3A 1QJ4A 3EHEA 3OQVA 1KAEA 4DCTA 5T4EA 4I99A 4IJ6A 4BLTA 3UB2A 4OQXA 1JN0A 2H2DA 2QRNA 2XVYA 3C8DA 4PHHA 3C3EA 1P7CA 4OJKA 3DQQA 3S6JA 4ZC1A 4YR9A 1X8XA 3UMYA 1KI2A 2WPDD 3TR6A 4BEWA 3KZCA 4BN4A 4M83A 4TLCA 1E66A 4P58A 3HCRA 5KYNA 3D8SA 3AUYA 3NBAA 3LFTA 5TQ2A 4MUKA 2PH7A 2EP7A 2YC4C 2SCUB 3CNLA 3IQXA 2OHIA 3AVYA 4WKCA 4OHPA 4LY6A 3ORQA 4IYJA 3OEWA 4FSDA 4I1VA 2PG3A 3F8TA 5JBIA 1FZTA 1RHRA 1E5VA 2RKBA 1GUFA 2R8EA 5FP0A 2BMVA 5GIPE 1TEHA 1T4DA 1C3LA 3GPCA 4BXOA 1A4UA 4YCBA 1YL6A 4KI7A 4NBSA 1CR6A 4I36A 2JJQA 3Q5EA 4DV0B 3HY4A 4WNYA 2CYBA 3DE7X 1KI1A 1Z62A 1P2VA 1ZKDA 2D2IA 2IOYA 5EHGA 4YP1A 3ZIAD 5JZBA 4JT9A 4CKEB 4ZZ1A 3CYFA 1Z7YA 4WK0B 1UJNA 2LW7A 4CG3A 1P45A 3V34A 1B93A 1JEOA 2QTWB 4DQXA 2A86A 3WDSA 4ZAVA 2B1RA 3Q5GA 3NX4A 1VL2A 1YQUA 4OSEA 3FHTA 3V4RA 4K5QA 2XMCA 3INRA 3P94A 1UK8A 4YLEA 1OFGA 4WZBA 4EA9A 5C7OO 3L4KA 4LYFA 2JFBA 4GQAA 1G0OA 2EJWA 2GCNA 1TLFA 3UQZA 5CUQA 2R6ZA 5F51A 2P8JA 4KQJA 1QDLB 2ZLBA 1FDVA 3FCXA 2P5SA 4KG7A 3BULA 4ME6A 2XKJE 5DLPA 2ZWPA 4MP6A 4OAPA 5CCDA 4IJMA 1LX6A 4IGIA 1ZP6A 1MMFB 1ZN9A 4QT4A 5JSZB 3H16A 1T5DX 2HCFA 3P9CA 1JEEA 1T1EA 2BKEA 4HMOA 4JI4B 5JFTA 1VZ3A 5BSEA 4X66B 1B6SA 4N7JA 5LLSA 3PDJA 4HQ0A 2FMTA 5CIYA 1LTQA 1FUIA 2A5LA 2WP8J 2K7ZA 3PENA 3WL5A 4E08A 4ZZ0A 2HK8A 3C1AA 1THTA 1R10A 5H4HA 4MW9A 5HJ5A 3OFKA 2Y71A 4LSGA 1WXHA 4EFDA 4ESVA 5AHXA 5C5CA 1NXXA 4H17A 3ORFA 1A4IA 5DNAA 1VSQA 2LPMA 3EQ9A 2LNDA 3PNKA 2OUKA 3FDXA 3ZKWB 4AB1A 2PUTA 1QS0B 5CA0F 1CS0B 1DJQA 2BI7A 5JG7A 4YMGA 2JBAB 1S9HA 2V0CA 4B74A 3OO0A 1DKRA 3ZZ0A 2QN8A 2HWWA 3QYAA 2FMFA 2PLWA 2PZEA 3G5UA 3LQ1A 4OQPA 1OMOA 3O74A 4PX3A 1SC6A 4Y7CA 4BASA 4JJ6A 3W8NA 3H2SA 3LJKA 1VE1A 3RU7A 1JT9A 1SPXA 4RCZA 4TLAA 3SJCA 1JW9B 1RNLA 1RVDA 1VLVA 5B4VA 1AS0A 4RHEA 2I4MA 4KGDA 1KI8A 3PCTA 1BA3A 2WHPB 2OCDA 4K3UA 4N3GA 1WZUA 2KS6A 2QN1A 1EFTA 2Q4TA 1K0UA 3FWKA 1IB0A 3KEOA 3NM4A 4FYHA 2K4MA 4GWKA 4KU4A 4LZWA 4Q4AA 3EDRA 4AJJA 1M7BA 1M33A 4UNIA 3V1TC 1O94D 3JQAA 1LY1A 3WGYA 2KPOA 3G8BA 3X1XA 4YMHA 2HIMA 2UAGA 5AI8A 3AH8A 3THOA 4E4RA 2W8ZA 5E7JA 1VLZA 4B1FA 3N6VA 3KT3A 3QFFA 3EMBA 4GMFA 4IMJB 4X3CA 3SQXA 1BVRA 4Y9SA 2DFLA 3O90A 2XHZA 1RCFA 4GOKA 4TUYA 1TCVA 4B17A 1RC8A 4PZZA 4C4TA 4HAWA 5FQOA 5IAEA 1LW7A 3A9TA 5UKDA 4JR1A 3UBTA 3S7TA 4NEGA 3C1UA 1ZMTA 4K6OA 1KMMA 4KK3A 2UZ3A 3OTWA 2HXYA 5L7WA 3B2NA 3GLKA 4ZVOA 3CV3A 1D1SA 3IKMB 5T5QA 4B81A 1YDMA 4H27A 1EKXA 4OX9B 1J06A 3L7KA 3DV0B 3ZLTA 4S12A 4J0IA 4RPJA 5KDLA 3ZWAA 1XN1A 1DKUA 5AVQA 3BGDA 2RBGA 3K72B 1REQB 3KUCA 3QFTA 1PG0A 2CMFA 3Q9LA 4RGBA 5GVRA 5B2ZA 3TB4A 1CIJA 5JSKA 1MJFA 1FFAA 1Y5RA 4ZAGA 2WHEA 3V5NA 4XWOA 1WSAA 3TEMA 5TLSA 4G5GA 4YV7A 1GZDA 4BJ1A 3Q2IA 1ZONA 3A58B 1BC5A 1YBVA 3IBGA 4O2LA 5F3WB 3A9UA 4GPZA 2XAUA 2SECE 4Y6LA 4DWOA 5KC9A 2BISA 3S1LA 1CUUA 4UBJA 3N2GA 5CB4B 1CZOA 1KK1A 3RLIA 1SHKA 1UBHS 3P45A 4Y9RA 4BTLA 2O20A 2YYSA 2ID8A 3KXIA 2JG3A 1LS6A 1Q77A 1WB4A 3CMMA 1IOWA 1JKFA 2G04A 4EEXA 1W29A 2F62A 2LKDA 1NR1A 4PZUA 5CB0A 2ETVA 1RWNA 2IUTA 4N54A 4YXWA 4CIXA 2PO7A 2C77A 1DKPA 1MUUA 2CFIA 3ZIAA 4G97A 4LE0A 4AQ7A 3LV8A 3T5BA 1ONOA 1TZKA 1P75A 2ZI9A 1VJRA 3RRZA 3JAWA 1SKAA 2BRUA 4W8OA 1CDDA 1I33A 4BGUA 1WW3A 2WYHA 4INAA 4HAIA 2FSUA 3LW8A 3PVCA 4GGPA 1IBLB 1IN8A 4QLAA 3TQOA 5HBRA 3U4HA 1NBME 2BONA 3ELYA 3TM4A 3DCIA 4PICA 4DG8A 1YI8A 1X1QA 4FFRA 2SHKA 3PEUA 4QUHA 4ER7A 2I6TA 3T7EA 2FZKA 4NTZA 3MEQA 4YGYA 1VBNA 1T3LA 4CV2A 3A10A 3E5MA 3CR3C 2ZEJA 3FN4A 1XYYA 3TK1A 2FOLA 1DJLA 1A2BA 3KJFA 5EMJA 3R3YA 2HGZA 1KP3A 1Z9BA 1AF7A 2ADMA 3KTOA 1K8YB 5ECYA 2DT5A 3BXXA 2X40A 2GDZA 1A8PA 1L3CA 1MA0A 1OWNA 3NC1C 2QN2A 3IMGA 3IR5A 1W30A 4G3XA 2O7RA 1NMZA 2WUWE 1E2QA 1E7MA 1CV2A 3COSA 4BVJA 3RVKA 1CJVC 2ZAMA 3I6MA 4G4GA 1U2QA 1Z8HA 3KQWA 1ZCJA 1IN7A 3CLUD 2D13A 5ALFA 4CG1A 5FEUA 1J42A 1T2VA 4ZOLA 1KO4A 4RQBA 3NEAA 1AOXA 5HF5A 2R9VA 4K2HA 3WHPA 2C83A 2ZSEA 3AUXA 2UZ1A 4WZAB 2IYAA 3QSYA 2ODWA 1DMRA 1CE8A 2QTNA 2PYDA 4ZA2A 3QPDA 3BD9A 4EJFA 2HC9A 1NYRA 1R5JA 1QE5A 1SMKA 2B7CA 1RXYA 3JQEA 4LVNA 4M0LA 4NFHA 3AKZA 5KNCA 2GK6A 2VDWB 2FEMA 3UK0A 1AGNA 5I7FA 4U8HA 3ODGA 1XNHA 3B1WA 4GX5A 5BW6B 5C0OE 3R9IA 2HEGA 1G1AA 1Z15A 5AJXA 4DSAA 4BO6A 1LLCA 4XVCA 4BNNA 1ZS9A 4TTPA 2PRJA 4B35A 2CXTA 5IXJA 2C7OA 5AR1A 1VYUA 1L5SA 4ZAZA 1L9XA 1MG0A 3VOTA 3WAJA 2ZZNA 4BWFB 4JYZA 1FMFA