1VADB

Mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and yeast alpha-glucosidase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2KB HEAVY CHAIN
publication title Crystal structure of an H-2Kb-ovalbumin peptide complex reveals the interplay of primary and secondary anchor positions in the major histocompatibility complex binding groove.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1994-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vadB00
1DE4B 2W0PA 2MWCA 4D0DA 1YPZA 4F7EB 2OS7A 5D9SB 1BAFH 1UJ3B 3BRGC 4YGVA 3G9AB 3M17B 4F80A 4ALAL 3EOTL 5GRVL 2Z8RA 1K8IB 3HZMA 5CCKL 2GFBA 2HRPH 4PGCB 4X4ME 3L3KA 4Z78A 1ZA6A 2DOCA 5IFHH 4OUUB 1JWUA 3HMWL 5DK3A 5K9QI 5GJSL 3IDIA 4ZTOH 3QZWG 3WDHA 1FFNA 2W1NA 5D7IB 3MCKB 2CLRA 1ORQA 1FGNL 2HFFB 5DJXB 5F9AC 1ACZA 1KJMB 2VL4A 2W60B 1TZHB 1GGUA 5C0IB 4WFFD 3AY4A 3BEVA 3RPKA 3GGWA 4BA8A 5DJYA 2VDRL 4POZD 3VXSD 4Z7OF 4P23B 8CGTA 2HG5A 4MXVF 5C0RH 2ZG3A 3DMMC 3IFNH 3Q0HA 4LAJH 1UH2A 1T83C 5MENB 1GGBL 4W81A 3U0PA 1JN6B 3HAEH 3QXAA 2EDHA 4JHBA 1MCLA 1NFDF 5D2NE 1LO2H 5L9DH 2F54B 5IJVA 4X5LA 3CLEH 2P44B 3V79C 2WK2A 5T1DL 5TQ0L 3RWHB 3WIFA 3GMLA 4AIZB 1Z0MA 1RZKC 3BE1H 5DSCA 2BRQA 3IJSB 1G7MA 1S5HA 3DI2B 3TFKC 4Q2ZA 5GGRA 2GTWA 1A64A 4G8IA 4WW2C 1A5FH 5CMAB 5B4MD 5C6TH 4NQVA 5IFHL 3VD3A 4NOBA 3IDGA 3CH1B 1BFSA 2EDKA 2Z93B 4ZTOL 3SGEI 1G0XA 1O5DT 4UDTA 3TBTA 1Q9OB 2LTQC 4YC2C 3ULVE 5FA3A 4I0PB 3QO0B 1PY4A 1MUJB 3T3PF 1CN4A 3DX8B 3M1BA 4IDJL 1QP1A 1YY9D 4PY7A 1DUZB 5C0RL 3IFNL 4OZIA 3MUGA 1RQ5A 4HX1A 1U8JA 3RFZC 1VADA 3BYTA 2F9BT 5CWSA 3GBNL 3LH2L 4PJHF 3S98A 3EYUL 1I7ZB 4NHCH 3ARFA 1NGZA 4P57A 1E4XH 4JZJC 3CLEL 4UV7H 3OAZK 3I6LE 1OGTA 1WIOA 1RMFL 4MGXA 5DD6A 5JXAL 5KANI 4U6TA 3A6OA 1G7JA 1UT9A 1N6VA 3ZL4L 3TJEH 1A5FL 1EEUA 3C2AH 4V2BA 5GRJL 3W0WE 1CXHA 5KSVB 2WV3A 4YEFA 4MD4B 1Y0LB 4O2EB 1WCBB 5E99H 5GJTL 1HWHB 1T3FB 5IIEA 1T20A 5D8JL 1U95A 4R3SA 4GMTH 4QLRA 4RISH 1Q38A 5H35A 4P46B 2AJZB 4OQTA 1JZ2A 4JO2H 1NCTA 4PBVC 4DAGL 3JXAA 5IB1A 3T4AB 1DSFH 3EO0A 2B0SH 4KHXH 3LIZL 1JZ8A 3IJHB 1D5BA 3STLB 4D2NA 1AO7A 3CPLA 1ERNA 4RZCA 4AZ8A 1JI2A 3OXSB 4ZSOE 3W9DA 4ZPVA 2PYFB 4MB3A 3PL6C 4PJAB 1Q0YH 3BP7A 1UM4H 2AXGA 4ONHB 4RDQG 1JHKL 5HYJB 3I75B 2XZQH 3UP1A 1E4XL 4XH2A 4FP8L 3K81A 3PF2A 5GXBB 1DE4A 4WFFE 4J23A 5HYQB 5D1QC 3VXSE 1T4KA 3OHXA 3VXQB 5KAQF 3QHFL 1HHGA 1XZ0A 3ARBA 1LEKB 1YEJH 3AROA 1T89C 5FDWA 2E7CA 1CFNB 3MLPA 2DWDB 1FNSL 4Q6YA 4OFYA 4BK4A 4XMKH 4ELMA 4PGCA 1YZZA 5TDOB 5E99L 4K7PX 1TXKA 5ALBL 4XZUA 3V95A 2HVJB 4OZFB 4BFIB 3SDYH 2YD9A 4MDJA 4D8PA 4GMTL 1XGUB 4JKWA 5CJ8A 4CN4A 3ULVC 1TCMA 4U1KA 3MCKA 3U7YL 1Q0XL 3WE6A 5CP7B 2V2TA 4I8DA 1A6WL 3VFRB 1KJMA 2B2XL 3MUHL 4ZXBD 4U7KA 4HKJA 1U3HD 3VMNA 3GMMB 1H8SA 1TZHA 1URLA 3SGKC 1EHXA 4QRUA 1NLBH 2R4RH 2OK0L 2DQUH 3LKPB 4GRLD 3GHEL 4N1CA 4XXDB 1ZVYA 3LSOA 1Q0YL 5MENA 4JGJA 3DRQB 4Z0BH 5ACMA 2VZ3A 4JPWL 4K9EH 2EIBA 1IC4L 1TIUA 4PJXE 1MVUB 4LGPB 3C5ZB 3P4NB 3NACH 1W72A 5D6CA 4KZEL 1G0DA 3GSXB 1QSVA 2IAMC 3BKMH 1FVCB 1UB5B 1FZMA 3EDEA 4YDIL 3SDYL 4AK1A 3EO1A 2J2ZA 3VMPA 5AD0A 3D69A 3O3BA 1U36A 1C08B 4OB5L 4LRIC 3ZKMD 1QFHA 4HIEB 4P2QD 4KKBD 4PJIE 1DDHB 3QRFM 1JNHB 4XNZC 3VI3E 4I0PA 1NLBL 2R4RL 4L8SB 4LGRB 3L3DA 4UB0H 3GMRB 2ID5A 3QIBD 2F5BH 2QKIB 1A0QL 4JFDE 3QDMB 1JZ5A 4QGTA 4Y1AA 1SEQL 2UZYB 4U7SA 4GAYA 1G7LA 3IAQA 1F3DH 4GH7B 1KACB 1RZKH 4YXHH 3QUZD 1HHKB 2AEWA 2DD8L 2NW3A 4Z0BL 4Y8AA 4MJIB 1BD2D 4KDVA 4LF3A 3P11H 3TYFA 2HAZA 4POZC 1FYTD 1VFBB 5KSAB 3H9ZA 3WD5L 2SEBA 1IRAY 2C3WA 3HFMH 5DDHB 3VGGA 4C57C 5IEHB 3SGJC 3VRLE 3HLAB 4WHYH 2PETA 2JCCA 1EEYB 3BKML 4Y2OA 3Q5OA 5BOPA 1U8PB 2Z92B 3AS0A 1QG3A 4M7KL 3ZTJG 5IVXE 2YPLA 1Q1JH 3SE8H 4L4VB 5FECA 5MERA 2EE3A 2P4AB 5E6ID 4HIIB 3B9KA 2BSSA 2Y25A 4L4TA 4PJ9D 5GIRA 4JHWL 3IU3B 3BSZH 1MFEL 2WP3O 3RVVD 2ZPKH 4OKVB 4ODSH 2BVQB 3RU8H 4PB9L 4R96A 2WM0A 3LMJL 2N4IA 4LARH 5E0QA 2VLLB 1T5WB 2AJZA 5DVKA 5JW5A 3RJDA 5B4MC 3MCLH 1A3QA 4IJ3C 3LS5L 4Y5XC 5CINH 4I77H 4LEXL 3PHQB 3UAJD 1J86A 3S4SA 4WI2A 5C7XH 1F42A 3HRZB 3IJHA 4JM2A 3GUTB 1S7SB 1NGQH 4M5ZH 1QBAA 2QHRL 5CGMA 1ZLVH 1RZKL 2NY5L 3O3AA 5EPMA 1YNLL 2EDNA 1XF1A 5GS0D 3W9EB 2EYSB 4F7CB 4TPRH 3D0VA 3VDBA 1D5XB 4KMLB 1AXSA 1ZHLB 2Y07L 4ONHA 1WBZA 4R4BA 3I75A 3TA3A 1YY9C 3UJIH 4YHZH 2HN7B 5IWLC 2X4NB 4X6EA 1WVZA 1IL1B 4AL8H 3B5GA 4HWUA 1GVIA 5C0AB 3L3GB 1EHNA 4P2RB 3OSKA 3TZVA 1QQDA 1CT8B 1LEKA 1Q1JL 2E6QA 4ZOCA 4BKLB 5C71A 1RUQH 2EDRA 2DWDA 5DWUH 3NIGE 3MRPA 2LFGA 1FIGH 2W65B 1JGDA 1MLCB 2X4UA 3FO9A 2XRAH 4K71B 1AHWA 1CGUA 4UILH 1CGXA 4ODSL 4HIXH 3P77A 1HOCA 4OZFA 3N9GH 4NN7C 3VFGL 1P84J 1I85A 1HIMH 1J0YA 3HMXA 4LARL 3PP3K 4KC3B 5C0CD 2OTPA 1MFDL 3MCLL 3G5ZB 4QNPF 3KNBA 3VG9B 1KT2B 4KJYB 2ORBH 2OYPA 5CINL 4I77L 3VFRA 4NQEE 5C7XL 2D7TH 5D1XD 3BZEB 4M00A 3E2HC 1NANI 3RPIB 4HFWB 4A6YH 1C5CL 4HCRH 5HYSG 4P4KC 2C3VA 4YE4L 4E0RB 4LP4A 2WBJA 3D0LB 4GKNB 3CD4A 1DP0A 2H1PH 1B0WA 4P2QE 1MRCL 3QIUD 4GUPA 3QXUA 5IB5B 4FXGA 3UJIL 5E5MB 3N1GC 4NO2A 4HZLA 3C08H 1UXSB 2NXYB 3WN5B 4BFBD 3BGFB 2PW2B 3F12B 4KQ4L 3OWEA 3GSXA 3ULVH 4RNRA 4HBQA 1SJEB 1GIGH 3JSSA 5DWUL 3T09A 1C5BH 5J13B 4HUVB 2XRAL 4UILL 2UUDK 4QHNB 4HAGA 4XBEH 5KOMC 5C0DB 1FYTE 5F96H 2ZUYA 1BM3L 4HIXL 3N9GL 3DX7B 2IBBA 1HIML 1K4DA 2MHAB 4WNQB 3SBWA 3B6SB 1WIPA 1AD0B 3EYOB 3C09C 2XTLA 4MA3B 5F6HI 1WT5A 1DZBA 4U05A 3GI8H 1RZJC 3MYJB 2OMBA 4HIEA 4DN3L 4YPGA 1UFUA 4YJZL 1IQWH 4HBCL 5JLZB 1NUFA 4KMTL 5ITFA 4GXVH 2G9HA 5F6HJ 3V9FA 1U8KB 3GSOA 4WTZG 5KVFL 3HE6D 1OY3B 1FV1B 2GHWB 3QUMH 1TZIB 2X89D 4H25A 4ZXBC 2H1PL 4RGMC 1DQMH 1U3HC 1FG2B 1HHKA 5CJOL 4O9HH 3GRWH 1QEWA 3S5LG 4GBXA 5KTEH 2R9HD 5DFVD 1KB5B 2NQCA 1M05A 1WEJH 4GRLC 2V6HA 4JO3H 5T1KD 2GITA 1AGDB 4C4KT 1A7NH 4K3JL 1ULVA 4MCZB 5E2JA 3GSNA 1EEYA 1GIGL 1CD8A 1EIBA 4TUKH 2CDEA 2Z92A 1W0WB 5L2KA 4OFKA 2ATPA 1NCAL 3CDGB 3E6HB 4HIIA 4W68A 4WHTA 3MPCA 1KJVB 5I73B 1BFOB 4HIHB 4HXBH 3UROR 1PY9A 5ETUB 4JFEB 4KU1A 4PGDA 5FYKE 2FLBT 3BPCB 5TE6H 3NIFE 3D85D 1X5LA 2VLLA 1KCVH 1J18A 1NBVH 1IGIL 3FT2B 4NCDA 5FA4B 1N5YH 1IQWL 4IHOA 4MWFB 2UY6A 12E8L 1F90H 4PGZA 1DQJB 3W39A 3K8LA 3ZKMC 2AXHA 2A73B 3HPJA 1R3LB 4E41E 4KKBC 4NWUH 5C0CE 1F45A 1SJHA 2VERN 4R0LC 4O9HL 4R8WH 1VFAB 5HHNB 5EUKB 3NH7H 5KTEL 1I1FA 1WWAX 3K0WA 3QIBC 4U1LB 1JUFA 4JO3L 3ULUF 1T7ZA 4KTDL 5HGDA 3FZUD 1PZUB 4NQCE 1YN6B 2XWJA 1IAKB 5A2LH 3GSQB 3QUZC 1OAUH 3I9GL 4JVPA 1YPZF 1F11A 1XF2B 4TUKL 3GSWB 5I6XB 3D25B 4IEFB 5E9DD 3HI1A 3T0AA 3VXRD 2BNQB 3MROB 25C8L 3LN5B 4DKFH 1CGWA 2JJVA 3K8MA 3RRQA 4UMGA 5BS0E 2HA1A 4PJCE 3AFLA 3BIKA 5C0ND 3MFGB 3NIDF 5GZOD 4PS4H 3FO2A 1T1XB 4O5LL 2IH1B 3OXRB 1T21B 1BGXL 1IKNC 3RTQA 3EDDA 4JAMB 4K55A 4YR6B 4QTHB 1KCVL 2HJKB 5E6IC 1NBVL 4PJ9C 1HI6A 3UBXI 3MREA 2AV1A 1CG9A 1N5YL 2Z0BA 1FAIH 5I8CB 2ADJB 1CFTA 4JCLA 5TPWH 1KIRB 3WDJA 3RL1B 1BZ7A 5KVDH 1T6WA 5CBEA 4OLYH 2EDEA 4HH8A 4AM0B 2N7AA 4HH9A 3SY0A 1N7MH 4PJDB 2R0ZH 3STZA 3C5SA 1IQDA 4Q7DA 1YDPA 32C2B 4UIKH 3D0LA 2X4SB 3Q6GL 1J8HD 4X9HA 2PCPA 1OD9A 2PXYD 5EO0A 3VA6A 4PJ7A 2QR0A 1P7QB 5LXGH 1YEIH 1MF2H 4OFDA 4M43H 1OAUL 1S7TA 5GS0C 2RHEA 1UQSB 3GMOA 4U6HB 1NEZB 1F8TH 5F88B 4OQ1A 2ZJSL 3HAEB 2DMBA 1U8NB 1T2QH 1YEDA 1TVBB 4DKEH 1H3VA 4ODBD 1SJEA 1KULA 3MRDB 4FTVD 1CF8L 3AS3A 4E9LA 1NC4B 2LABA 4HUVA 5ACZA 4HKBB 4N1EA 3KPPB 4PS4L 4U4BA 4EVNB 3V7AE 2IF7A 3DX7A 4Z7UB 4NZRH 3QCUL 4Z7VB 2DWEB 2MPAH 1SJXA 2HKFL 4GRWE 4DJMA 2NMSA 3B6SA 5JHLH 1AD0A 3EYOA 4YHML 2ZUVA 4Q6IB 1EFXD 3O6FB 1QBMH 4JJ5B 3MSPA 4H0IA 4XP9H 4X80H 5TPWL 5KVDL 3O2DL 1A4KA 4CRPA 4KI5E 3VW3H 2FHFA 1PGRB 5FOBA 4QHUA 4CW1B 1EEZB 3QUYB 1U8KA 4M93C 4NM8H 4UIKL 4WUKH 2VUOA 1QA9B 5D1XC 3U46B 4OZIF 3Q5YA 4ORGB 3ZT5A 4U1NB 1RFDH 1U92A 4U49A 3DO7B 4RWYH 4HF5H 1D9KD 1YEIL 1MF2L 3HNTH 4J6RH 4K07A 4M43L 4P0DA 2EE9A 3BH9A 3QDJA 3RGVD 2QQKL 1F8TL 2GTZB 4MCZA 1T2QL 4ZNEA 2HLAA 2JJSA 5F3BB 3QIUC 5D7JB 1MCPH 4XNQB 3WKNA 2FHCA 1DN2A 2Q87A 3L9RB 3TLRA 1RZJH 3C87A 4BH8A 4LASL 4CBPA 3UTTB 3E6HA 2HH0H 4RIRA 1AC0A 2MPAL 4F57H 1KYOJ 4HIHA 4HK0A 4X4YA 1IJ9A 2DQTH 4OFPA 4KVNL 5JHLL 3GJFA 1FZJB 3I6KA 4JFEA 4L1DA 3KPNA 4LDEB 4M62L 1KPVA 5DEGA 5E9DE 5DQJA 4XP9L 3VXRE 3HC3L 4WHDA 1ETZB 3OJVC 1NMAH 4YDVA 3MLSH 1SVZA 3PWJB 3GKWH 3T04D 3TIDA 5IFJB 4IIQB 1RJYA 3BP6A 3JV5A 1UVQA 3VD4A 4NUGL 1A8JH 2X4RA 1OHQA 4RX4D 2A73A 3MLYH 4WUKL 3QJHA 4ETQA 2BVEA 1PEWA 3EYSL 4JHZA 3AB0C 5CGYD 3HC0B 4JN1L 1HQRB 3KLSA 4CJ0A 3G6AA 4CGTA 4J3VA 5LAXA 1QSFB 3HNTL 4J6RL 1NUDA 1NAMH 1VGEH 4WRLA 1CIDA 1MWAL 1MAJA 3HE6C 3ZTJH 3RI5F 2QQQA 3P0VH 1MCPL 4WUUA 2VL5A 2E9BA 4PTTA 1RZJL 2OJEB 3O4LB 5B21A 3LN5A 5DRXA 4Z7NF 2HH0L 3S3PA 4F8QA 3LKOB 2AJ3B 1LEIA 1MPAL 4JAMA 2GSIB 5DHVB 3VXOB 2NX5E 5EBGA 2VKXA 3B8YA 4Y5YC 4OD3L 5FGCB 3DIFA 4FTVE 5DMIL 1F4XH 4MZ3A 1NMAL 3WSQL 3MLSL 4GW5A 2GCYA 3RL1A 2R0KL 1FFQA 4XCYB 3MLYL 2VLKB 5GS1A 5ESVA 4PJDA 1NKOA 2YK1L 3MLTA 1HNGA 5E8NA 4PRPA 3V5HA 1ZHNB 3VH8G 3O4OB 4EN3D 4WJ5B 5B8CC 1NAML 3VFSB 4WENB 5DJ0A 1XFPA 4HFUH 5BZDA 4R2GD 4JRXB 5JW3L 2EEBA 3QWOB 1P7QA 1REIA 1LE5A 2XWBB 4LPXA 2F8XC 1UKQA 1N0XH 4ZOBA 4UBDD 4U6HA 4N8CH 3V2AR 4XVJH 5I19H 1MHEA 2XY1A 2JLLA 4H20L 3MRDA 5AZEH 3FZUC 4OFVA 3QXDA 1Z2KA 1AGCB 4K7PH 3KPPA 5HDLA 3HNVH 4EVNA 1YNTB 4UOW0 5ESAA 4EQ3A 1KPUB 2UYLB 2BDNH 3SQOL 1NCCH 1BOYA 2EIZA 4PG9A 4KTYA 15C8L 3KYNA 3VFTB 1TCRA 1YEHH 5C0NC 4OLWL 3O6FA 3NABL 5T1LD 5GZOC 4PJEB 4WO4D 1DQLH 5D5MB 2WANA 3CXDH 5EIIB 4X5XB 4WI4A 4YBHA 4RSVA 4CW1A 3CVHB 3K8KA 5GS0H 4HLZH 1BEYH 5DHYA 3ALPA 1JRHL 1X7QB 3FHQA 2V2XA 2CLVB 1WZ1H 3O8XD 5EOCJ 4U1NA 4HFUL 4PRNB 2DL9A 3KHQA 4ZAKB 5CEXB 4XX1E 3QFJD 5DJDA 4JFPA 3T2QA 2OR9H 5JPMB 1VKXA 3SKMA 4HUUA 1RUAL 4UT9H 2XN9B 3PUCA 3S88H 1MEXH 4N8CL 4XVJL 3MA7A 5I19L 2GJ6B 3VFNB 5C07D 5I1CH 2J4WL 4RAUB 4H1LA 1MAML 3U6RB 2JCCF 5HXMA 1R5IB 3CFBA 4K7PL 4NO0B 2XA8H 3HNVL 1ZGLP 3QPQD 7CGTA 3MR9A 1ROWA 3UTTA 3N85L 5KS9E 1KCKA 3ORJA 4OZ4A 3TBSB 3OAZH 1NCCL 1LO5A 4JO4L 2YBRB 4QRPA 1FN4B 4Z7WB 5F7KC 3F7QA 3S3SA 1JPSL 2F19H 4IOFC 5EBMB 1RZGA 1KEGH 3BWUC 4JR9H 3V5DA 3DNKA 4IIQA 5C0EB 3W11D 1A1NA 3MBEA 3ARSA 1RK1A 4POYA 4QHMB 3AXLA 1BEYL 4YDKL 4PJ8B 2CJUH 4XCEA 3TT1L 5D7LE 5A2KH 2AEQH 8FABB 4O2FA 2Q7YB 5IBUG 2YSSA 1R3HB 2X41A 4JZJB 1OCWH 2I5YH 3LRSA 2VXTL 1DLHA 4LLAA 2IWGA 3QXVA 3MRMB 3BO8B 3KPRE 4UT9L 2YHGA 1PSKH 4NZJA 3MO1B 4ZPTA 4EI6A 2JJWA 1H15B 3ISWA 4M48H 3V6OE 5C09E 5D71L 2ZOLB 5DD5H 5AUMB 5CJXA 1JWMB 4LLVA 5I1CL 5IBTH 2XWTB 1D9KC 1BVLA 2QQLH 4LBEB 1I8MB 2HMID 4LAQH 3RGVC 1K9TA 5AAMA 1IAIH 3LEXA 3LKOA 1BX2B 1YMMA 1NFDE 4Q0XL 2GSIA 4U1JB 4WFHD 4QRQB 1KLGB 1OQXA 4PGEB 4OGAC 2X7LA 4EI5A 1Q9LA 4JR9L 3WKMH 3GBML 4G42B 5BVJB 3UC0L 4N0YH 2PR4L 2J8UB 1AGEB 5HD8D 3HKFA 4LCWD 4TSAH 3HI6H 1FL5A 3MRCB 3BHBB 5D2NB 2AEQL 2CLZB 1AXIB 3ILPA 3MLVH 1AJ7L 5MEPA 2W0LA 2Z31D 5C9JB 4U1MB 4A6YB 1CICB 4JHAL 2CMRL 1VHPA 2W9EH 3MJ7A 1RHHB 4JDVB 4M48L 4G8FB 3PHOB 4S1SH 2EICA 3IDJB 3T8XA 4D9RE 5KJRH 1LE9A 2P5EA 2YWZA 4AENA 4WEMB 2QQLL 3ES6A 4GS7C 4LAQL 3L95B 5CGTA 2OMNA 4JKKA 2E6JA 3FTGA 3EAKA 2BY2A 3MXWL 5FEBA 1TJHL 3FRUB 1HINL 2IANA 3SJVB 1N5AB 2YUXA 3HA0A 1UADC 4KJQD 5C07E 2P8LA 4OAWB 4N8VB 3RWJA 3SOBL 1KIPA 2BK8A 4L4JA 3G5YB 2A6DA 4PJEA 3MJ9H 4N0YL 3HHRB 2VE6B 4HPYH 3QRGL 3BYYA 4X5XA 2VB5A 5INDA 4TSAL 3HI6L 3CVHA 4F58H 5F44A 3RDTD 5IB4A 3QG7L 2BNRA 2QL1A 3MLVL 5ISZD 4JQVA 4FXKB 4XCNA 3SCMD 3CXHK 1GC1C 2VDML 4G9FA 4PRNA 4YZFE 5KG9B 1I3RB 5EC1A 3V6OC 4YQXL 3T2OA 5I1LB 2Q20A 3EDFA 3QUMB 4XP1H 5DK2A 5CZVH 5KJRL 5F7LB 3W0WB 3FKUS 2DTMH 5FB8B 4EN3C 2DI9A 4U6XB 3U1SH 4JB9H 4YO0B 4QXGH 4R2GC 5J1AA 4FMKA 1ZT7B 1R5IA 4LCIH 2C1PB 2CGRH 5BW7A 3ARDD 1T80A 4EDXB 2VIRB 4UBDC 4MJ4A 5I1GH 1QFWI 4L29A 1F6LL 4LHQB 1XGTA 3D18B 1FN4A 3V6FA 3HR5B 4XWGH 2GJJA 3P4MB 3C6SB 4ZSOB 4HPYL 1AQDA 4JN2B 1A1MB 2Q76B 4MXQD 4R97B 3FRPG 1PZ5A 4Y4KD 3A67H 4XPAH 4QHMA 5CBAA 5J6GA 1OM3H 4J8RB 1FJ1A 2OI9B 4WFHE 4JVUA 5SV4A 2RBLA 4WO4C 1KJ2H 4NJAH 3SDDA 3VD9A 1MCHA 4FQJH 3VXSB 2BY0A 4P9ML 3KYMB 3A6CL 1N64H 1JHTA 3RIAF 4XP1L 2VDKH 3HUJA 5CZVL 3WFDH 3L3JB 1JGUL 5EU7C 3IDYC 3FO0L 3RNKB 2DTML 1NBQA 4P2OD 3DVGB 4LOUD 2AS5M 3O8XC 4JO1L 4JB9L 5BRZB 3W5NA 3MFFB 2CGRL 1OPGL 3PWPD 4AT6B 5I1GL 1CLCA 4YXLL 4I18A 1BHGA 1RIHL 2BXZA 5CIPA 4MA7H 5I9QC 2ESVD 1M1SA 4XWGL 2BOCB 3QPQC 1U8IA 3P73A 2A0LD 3BKCL 4X7CC 2X9XA 1IT9L 2P48B 5HGBB 1SBSL 2B5IB 1OGAA 2EDBA 2GT9A 2HT3D 2I9TA 4QY8A 2ARJQ 2J8UA 2YKLH 4UT6H 4XPAL 3BH8B 3RWGA 3LV3B 4AEEA 1SYVA 5F7WC 3S96A 3G04A 5BXFB 1P53A 4OV6F 5DR5H 4DGVH 3PP3H 2F58H 2IPKA 3BKJH 2YOCA 2VITB 4FQJL 1CICA 1N64L 3W11C 3C5JA 4U1GB 4Y0GA 2C1OA 1KFAH 1UA6L 4J3OC 4MD5B 5E2UH 1UZ8B 3RVXD 4PJ7F 5HY9B 2Z91B 3UPRB 1DUYA 4BSJA 4EEEA 5C8JB 3P30L 3WL9A 1NUGA 5ISZE 5GGQH 1XF3A 2A77H 3P4OA 1P4BL 5DQ9B 1QPPA 4UTAH 4HLJA 3O41A 3HE7A 4R90L 4Z8FH 4S2SA 1G84A 5HI5D 4AQOA 1X3DA 4Z77A 1MRFH 4OM1H 2F15A 4NGHH 1KG0B 1ZT4B 4MA7L 1OAYL 1UGNA 2ZP0T 3SJVA 1YUHB 2HMIC 3E1F1 4XAKD 1A47A 1XR9B 4G6FD 3D3VE 2H32A 1MHCA 3D87B 4JFDB 2B7DT 3WXWL 2UUDH 3DHMA 1LMKA 1I1AD 4G43A 2J5LB 3OGCB 1BVZA 4U6YA 4OM0H 4KAQL 4NRYA 4DGVL 1CD9B 4CL7A 5ADPH 5B39A 3RI5K 4FXKA 3GEWB 4RAHA 4ZQKB 2X1WL 2DS4A 5IGXL 4M1CD 5EO9B 1EO5A 4NZTH 4U3CA 5J1TC 4M5YH 4YHYC 5GZNC 3Q6FB 4BQ8A 5IVXB 3H9HB 5DRZB 1QO3B 3W0WA 4OF5A 2Z31C 2V9TA 3WNLA 1JZ6A 1YNKL 4O2CB 4UQ2A 3HG1E 2X1PA 4UTAL 5L2JA 2RAMA 1E6OL 4I5BA 1MOEA 5DRWB 3PWLB 1NSNL 2NY6B 1JMZA 4HKZA 4B53A 3PGFL 4D0CA 4WWKD 1A9BB 3HS0B 5TE4L 3BT2H 1ZAGA 1CDGA 2ZKHL 4MAYA 3U7WH 4HWBL 3SE3A 1A1MA 3C6LD 3PWPE 4OJFH 4OM0L 3IDNB 1N8ZA 4MS8D 4KJQC 2DQGL 2DLGA 3RVUD 1A14L 3BIBX 4BELD 3DGGB 2I07B 1DQDH 2JIXA 4D9LL 4HWEH 3O6MH 4NZTL 4I48B 1UZ6F 1I8KA 3KYMA 5C3TA 4QNPE 3LVEA 3C8KB 3OKEB 3VFOA 2A2QT 3VGHA 4LSTH 4OZHE 1FNFA 4Z5RA 3ULUD 3SCMC 4Y2DB 2Z8SA 4ZFOL 3S3JA 4JY4A 5BRZA 3UCRA 2IQ9H 3T0BA 5IW6B 3TH2T 1IAOA 5ENWB 3ULSA 4G6AD 5I74C 4M4PA 3AUVA 4EUPA 3JWDL 3IAPA 5J12B 4NQEB 4N90D 3WS6C 3QSKB 3GSRB 1MHHA 5FHAH 2BOCA 1G6RH 1L4IA 5DQDH 3WFHA 3RWDB 5KVMC 1WV7T 3U7WL 3F65A 1GC1L 2EO9A 3U36A 5I1AA 4BSWB 3TN0A 1NDMB 3DUSA 3WXVH 3TBYB 2B20A 5FO8A 1UYWH 2VO5A 4P2QB 5IQ7H 3LV3A 1MI5D 1QVOA 5JNYB 3TYGH 4R0LB 3SKOA 5DS8B 5BXFA 5LG1A 4N8PA 2H26B 1YEKH 1GGYA 4PJ5A 4JFYA 3FFCE 4HWEL 2VLJA 2VITA 3OAUL 4NFDA 3UTZA 5CEZL 4G8GA 4PJDF 4JKPL 4E42B 4RGND 3FAXA 3CSYA 4Y4KC 3RWIB 3MRKB 3ROOB 1G7PB 3OBAA 3EGSB 4OIAA 5J8OA 1GAFH 4XCCL 3DRTA 2VQTA 4JPIA 4HPOL 2Z91A 4R7DB 3UPRA 5D93B 4LK4A 5DJZB 2IPTH 4Y19D 4R7NA 1FYTB 4ELKB 5HHOE 5DGRA 4PB0H 4KJPD 2Y4SA 2NTSP 2P43B 4KKLD 5T5FH 3VGAB 4Y5VC 5D96B 4V1DD 5F8RC 2E7MA 3QISA 4LOUC 1AI1L 1WZLA 4ODHH 1KG0A 1ZT4A 1YEEH 5HDBF 3OG6B 1YUHA 4X6CE 3KYOB 1HKLH 5DQDL 2ZCLH 5BJTB 3TBWB 5TQ2H 2CKBL 3L3OA 3BQUA 2MCPL 2PO6B 1JL8A 5DJAB 1FZKB 4M6OH 1T66D 3ZHKA 5FO9B 4D3CH 4LEOB 5C0BA 1UYWL 2F74B 3MRLA 5IQ7L 3E8UL 5FO7A 1OAKH 1QLRA 3TYGL 3FJTA 2NY1D 3IXAB 1YYLH 3CZFA 2A0LC 4I4WA 2GKIA 4J4PC 4HV8B 1UWXK 2YMXH 4NNYA 2FDBP 3KYKH 4JE4B 3AS1A 4CU8A 1IE5A 3LN9A 4RRPA 3SDCA 5BMFH 1INEL 3VG0L 3F7YB 4M1GH 2KQNA 3WJJA 5JXEA 4PRBB 1X4ZA 3EFDH 4HS8H 3ARZA 4ZUTA 5I17B 5JIPA 3PABA 3UTSA 4JFXB 3RY4A 5IHUH 1Y18A 5I1HH 3TPUB 3X13B 1JFQH 4GMSH 4O02H 5IFAL 3ARFD 5CLWA 3TNNB 1D5ZA 5LGHH 2FL5B 3QB7C 4M03A 3ZKXC 3RVXC 3LDBC 2A9NH 1R5WB 2XKNB 3S36L 5IJKA 2XNAA 1H5BC 2J88L 2FX7H 4ODHL 3IRPX 1HKLL 4JLRB 4LPTA 5E94B 4PRHE 1NAKL 3HS0A 4UNVA 5TQ2L 5DJCA 4L3EE 3NFNB 3OV6A 1BLNB 3BI9X 3FN9A 5L8LB 4D3CL 1PAMA 4E41B 5HI5C 2QSQA 5C0CB 5JMRA 3RX5A 4FQCL 3VA2C 4KTEH 3MRBB 1QSEA 4ZO8A 4N90E 2BNUA 3JVGC 1S7WA 3NIDE 1GPOH 4FQIH 5IMOA 3QUKA 4BZ2H 3DGGA 4NQCB 3RZCB 1I1AC 4C56D 3LD8B 1QTYT 1T03H 1AO7D 2IH3B 4QYOA 1CLOL 3VWJA 3U2SB 3PV6A 3DV4A 5EC2A 5BCAA 2RB8A 3ESUF 4YUEH 3J7HA 3QIUB 3OKEA 5BS0B 5LCVH 2GSGB 4PJCB 5IHUL 5ID0A 3QEGH 2ZSWB 1KXVC 1K5NB 4FFWC 4OF6A 3FONA 4Y2DA 5DHXB 5AAWA 3KXFA 1KTDB 4GMSL 4M1CC 4O02L 4NCC2 3QNZA 3BPOC 1ZSDB 1KC5H 5LGHL 4RGNE 1DBKH 2WAHA 4XMLH 1MLBA 5IW6A 1C16B 1I9EA 1EUTA 2ED9A 4JGMA 5LQBL 4M6MH 1A9EA 1SY6A 4HKXB 1CFBA 3ARBD 3T0EA 4HGKC 2VMFA 5EWIL 3MNVB 3F58L 1B3JA 4OFYD 5C2BH 3RX8A 4H5SB 5HGAB 4LDLB 1KXTB 3VE0A 2ZNWA 3MRNA 2NY4B 5F21B 3ZYIA 4BJLA 3SE9H 1NDMA 1H8NA 5FCSH 3ZHLA 4BZ1L 1RUPL 3ZTNL 4WWKC 1BIHA 1P2CA 3C2SA 3TCLA 3BN9D 1GPOL 1D5IH 4BZ2L 2CIIB 4MNQA 5EBLA 2F53A 2UZXB 2UY7A 3UDWC 2XQYK 1T03L 2QSVA 2YA0A 3C6LC 3EHBD 3REWB 2HFEB 3FO1B 1FYHB 3VWKC 3EGSA 5K9OB 1N26A 4U6VH 5LCVL 4Y89A 4NN6B 1QR1A 1FC1A 4N9GA 5MEND 4OF8A 5D7KE 2DF3A 5T1KB 4ELKA 2VDPH 3N1MC 4NC1C 1KC5L 3BRFA 4M8VA 4GRWB 3QDGA 5HHVH 1EZVX 4DTGH 2F54D 3W2DL 1A6VH 1A4JA 1QFUH 4M6ML 3ULUC 2YPKA 3L5WA 4PV9B 4OZIE 3EO9H 4HS6A 5CJQL 1OT1A 1B0RB 1Y6KR 4P5KB 2IMNA 3QI9A 1U0QA 5IQ9B 4YBLC 3K3QA 4I2XB 1U3ZA 4G6AC 2PO6A 3SE9L 5DJAA 5HHQB 4WEBL 4YDJA 2FJHA 3BUTA 4LEOA 1NCWL 2CXGA 3LHPL 2NNAA 4PJEF 5KZCB 4CMHC 5D70L 4NRXA 4BUHA 1WTGT 1RULL 1U8HA 3RIAK 3ZKND 4JDTL 5E2VH 3PXHA 4GKSB 4GSDH 4Y4FB 4GW4A 1MFBL 1UCTA 3DBXB 4ZUUB 4I0KA 5B8CB 4S1RH 2L7JA 4I0PD 4PLOB 3Q1SH 1S7QA 3MX0A 4MJ6B 4LVEA 3LKRB 5E4EB 3TNMB 2DQFB 4MXWH 3V6BR 1N6QH 5KSUB 2VDLH 3MC0A 1YY8B 4IMLB 1FL6B 4RAVB 4RGNC 5EZOH 3HN3A 3RZWA 2R29H 1WWBX 3AY4C 5EIQA 3UYPA 4UINH 5HHVL 1I1YA 4GG6A 4NO3A 1YECH 1AO7E 3T0XA 4D0BA 1QFUL 4LCCA 2ICWI 1R5WA 3EO9L 5E9DB 2AEPH 1NLDL 5IVZB 2P5WB 3VXRB 2IGFH 1KUMA 3RKDD 3Q3GA 4MNHB 1S9XB 1MJUH 3O2WH 1G1CA 2YPLD 4KJPC 4KUZH 4KKLC 5GGTH 3BP4B 2D7QA 1KN4L 2ICWJ 2QQNH 3B9KD 3NFNA 4RMTA 2XZAL 4Z7WF 4OBSA 3ZZ1A 4D94A 2BC4B 4RMQA 3VFVB 3G5VB 3KPSA 1IILE 4HWZA 1R0AH 2B4CC 1F2QA 4N0FB 3OAYK 4N1HB 1E0OB 1H0DB 2R0WL 3QPXH 4BH7B 3OJDA 4OLXL 4KROB 4F3FA 5I75C 1KNOA 2OZ4H 3BAEL 4ELME 3MOQA 1T66C 4PJGA 4FQXB 3WIIL 4IS6A 4KY1H 4XTRD 3TO2A 1UM5H 3FB8A 1ES0B 1UEYA 4BQCA 2GK0B 4MX7B 4MXWL 3U2SA 1FP5A 5E8EB 1YEFL 2V2WA 1N6QL 2R2BB 2PXYB 4JQXA 4LHUA 5BS0A 3QCVH 2R29L 5GISL 4UU9A 5IB3B 5FKAB 3B4NA 4K94C 4UINL 5HYJD 3TA3D 2IFGA 4KWUA 1YECL 4ODVH 3JV0A 4X4XB 4JFFB 2KKQA 4XNYH 4IRJB 2NX5B 3MRQA 4X4ZA 3WIHA 2QEJA 5TDNA 3FQTB 5D1ZA 2IGFL 3L1OL 4FTVB 4GXUN 3IJYB 4HKXA 3TZVD 3HR6A 3ALXA 3X17A 4KUZL 5MENE 4YHNA 1ZANL 1IGTB 2QQNL 3MNVA 1EAJA 2FB4L 2PYEA 3K4AA 4WWID 5TFSH 5M95B 1NBYB 1R0AL 4K2UH 1F4WH 5EH1A 4PV8B 3OKMA 4PJBA 1KLUB 5I15L 4DGYL 1HHIA 1B4RA 4X6BB 2J8UF 2OZ4L 3UTQA 4PLNC 1MCWM 1KTKE 5HVFB 1W2KT 3ARYA 4PTUB 4YHPA 4XVSH 5JDSA 1QHOA 3FO1A 3BJ91 3QA3A 1N3NB 9CGTA 1FNHA 2FGZA 3FQNB 5GGUB 1QLEH 1XMWA 4KDTC 1XCQA 3P9MA 2WBJD 3T3ME 3MRGB 5IROA 3WHE1 1MCWW 2EC8A 4NO5B 4XC1H 2G2RB 2CUIA 3DVNB 2BZDA 3JV4B 4UUJB 5F9WC 5M94B 3L6FA 3VFPB 2R0LH 3GJFK 4LL9A 4ONFH 4TQEH 3V7MA 1QHPA 3EZJB 4Y1AE 2ICEB 1VFMA 2NYYD 1MELA 1DN0B 3OPZH 4R26L 2ITDB 4P3CH 3LY6A 3FT3B 4BQ9A 1C8PA 3QJFB 4KRMB 2VXQH 1CU4L 4I2XA 4X98B 4WGWB 1A3RH 5IKCB 1UJ3C 3PGCB 3IDMB 3B3IA 5TFSL 1P9MC 5F7DB 3UJTH 1IM9B 3QULB 3LKSB 5BO1H 1F4WL 1LNUB 3ARBC 3T1WA 1AP2B 3P2TA 1EH9A 3OB8A 5TJWK 4MAUL 2JCCE 5HVGB 3U9UA 3DX9A 1MIML 5ITBH 3QIWA 5ABDE 4MSWB 1UXWB 1AR1D 1FFPB 2AJXH 2H6PB 4Y4FA 5IR1B 4XBGA 2YPLE 1U8QB 4L4TE 3I6GB 3MMEB 4JANA 3DLQR 3KS0J 3GM0A 3O2VH 1A2YB 3DUUB 4ACPA 2AK1L 1ZTXH 1VPOL 3BN9C 2KUTA 3QEUA 3VXNB 3ULUH 2M1KA 1N6UA 4G6MH 4PRAB 4RAVA 1GZPB 5KS9B 2X44D 3EHBC 4MJID 2J1KA 5DXWA 2R0LL 4K7PY 4LLQA 5K9JH 5B38B 1KJ3H 5KSAD 4ONFL 4MLIA 3AREB 3BXNA 4UTBL 2P5WA 3FCTA 1LVEA 5H37H 1Q9WB 4EDWH 4MNHA 3OPZL 4P3CL 1JGLH 1S9XA 4XGZB 5E8PA 3TIEB 2Y7QB 5L2KD 1P5UA 2VXQL 1A3RL 4RFEA 1KXQE 3NFPB 5BO1L 3VFWA 2OL3L 3AVEA 4Z7QF 1IZJA 5D7LB 5FYJD 2BC4A 4Y4HB 2R1WB 2GUOB 5ITBL 1GGCH 4KZDL 2ZOKB 3DX6B 3OR6B 2DQIH 4YXKH 1TTFA 1H0DA 3EOAA 1XCTB 4BH7A 2WQRA 1I7RB 3CFEB 1AGFA 4ODTL 3KPRB 1TVDA 5IG7A 5C09B 3VU2A 5DMGD 1ZTXL 3W81A 5I66B 5IHZB 5E00A 3ULUL 3BISA 2W07A 5BZWB 1INQB 1D3CA 2R2BA 5H2BB 2Y5TA 4I0PC 5FUCE 3WEXA 1OARL 5F72S 1GH7A 5K9JL 1RZIA 1KJ3L 1P4LA 4JFFA 3IFLH 1NFDB 3VXTA 4X8JA 2PUQT 3DWTA 1FH5H 5D72L 3INUH 1ZWIA 4X6FB 4F15B 2XQYG 4GAFB 5C0AD 3MLXL 1JGLL 3PDDA 2BERA 4ERSH 2BSRA 5T3XL 4WW1B 1QFWH 4WV1A 5DJ2B 4PREB 4XBPB 3TVMA 3BOVA 1X5ZA 3HZVA 2A6KA 3RTQD 2OSLB 5J57B 3VMOA 4DKDC 1GGCL 4PYGA 4PV8A 1KLUA 2L4OA 1G6RB 2AQ1A 4KK8D 2X4PB 2RGSA 3BZ4A 3BFOA 3U4BL 5T3ZD 4NHUB 4WY7H 2YRPA 4K94H 3PWUA 4PYHA 4WTXA 1XH3B 2P24A 3LKQA 1D6VH 2KH2B 4ZFFB 1CZ8H 1CVRA 2F5AL 1U58B 2V17H 3MRJB 2WLYA 1G9EA 3FQNA 5I0ZA 1UACL 1R3JA 1JNNH 4XTRC 3T4YB 4Q97A 5CILH 2G2RA 3QUXA 3IFLL 3DHJA 1FH5L 5T1MA 5IOPA 3OR7B 1HWGB 4BSVB 2NXYD 3TCXA 5C07B 2EXWD 4K7FA 5DJ6A 1NCBH 3VFMA 3NAAH 1J11A 4CU6A 2B4CL 2DM7A 1FO0L 4ERSL 2JB6B 2AP2A 4QWWD 3FQWA 3TA3C 5JQ6H 3RIFF 1OAXL 4G3YH 3MRIB 4X98A 1MQKL 4N0UA 5IKCA 1ED3B 4JREB 3QQ9C 1A7OL 5JOFA 4BQ6A 1QBLH 5EZJA 1RVFL 1AFVH 3FQRA 3U4EB 1HQ4B 1XGYL 3RY6A 1WC7A 4WY7L 3LPFA 1A7QH 1UXWA 4K94L 1FFPA 2H6PA 1G9MC 1HYSD 5L2KE 3UBXB 2D0FA 1PG7W 1I4FB 3F7PC 1D6VL 3I6GA 4QHLB 3CUPB 5L8JB 1GOFA 2WBKA 3TBVA 2OP4L 2P8PB 5L6YH 3KWWB 5FYJE 2WWMD 3MRRA 3UEZA 3OTTA 2WUCH 4PBWD 3FQXA 3KPOB 3CZJA 2D7PA 5IVXF 2D31B 1HH9B 4NQSA 2FGWH 5D2LA 2WMPA 2YZ1A 2R15A 3E6FB 3QDJD 5DEZA 5EZIH 1NCBL 3NAAL 5ICYA 2YD2A 3KJ4B 4DW2H 1V5JA 1ZLWK 1HSBB 1KCSH 2VDNL 1HHHB 4XGZA 3C5ZC 1RU9H 5FYLE 2BCKA 2JK5B 1V7NL 4MMXC 5DUBB 1MY7A 4MMZC 4K23H 3C60B 4OTXH 3RWEA 3L5XL 5IEKB 1AFVL 2NYYC 4XT1C 1FGVH 5JORB 4Y4HA 2L7UA 4JFED 3WFBH 2PNDA 2BVOB 3IXTB 3DX6A 2P1YA 3BEWA 5FUOH 1ZEAH 1U93A 1XCTA 4JY6A 4X7DC 5JHDA 3BPLB 3QZWB 3WMSA 2DQJH 5GPRA 1AIFB 3MRHB 1S9YB 2E8YA 4ODXB 2OJZH 5J6HA 3QO1B 3EOBA 3DYPA 1JGVH 5DRNB 3THMH 5IESH 1RIVH 1OL0A 2NTFA 2P8MB 2Q6WB 3X3FH 3SE4C 4KK9D 4L8DA 1AR1C 2YUZA 2CDGB 3DMMA 4LCYB 5FKPA 1CK0H 4H26A 1T83A 3TV3H 1HCFX 1MCNA 2EH7H 3C9NB 3V4UL 4F7MA 4L8SC 2HVKB 3NIGF 1W72H 1MFAH 4CMMB 4YH6A 4LQ1A 2HRLA 1EO7A 4APQB 5EZIL 3OJMB 2CRZA 3ILQD 3LPGA 4FFVD 4K3DH 1IGYB 5A2IH 3V0WH 4DOHE 2FLRT 4OD1H 3H3KA 4HDIB 1DFBL 1KCSL 2V7NB 4M02A 4WUUD 5FUZH 2OR8A 4HK3N 5HGHB 2Y36H 2E7HA 5L7XH 2QTEA 4WW2A 5KSAC 3IFOA 5DJ2A 4PJ7E 1KCRH 4K23L 4X5WA 4Z95H 3RWFB 4M6NL 4Y88A 1E27A 4WU5A 5DFTA 1FGVL 5JO5B 2OSLA 4DCQA 5K59E 3OKLA 5FUOL 4HXAL 5ILTH 4OD2B 4YHIA 3CK0H 3EYVB 5I1IH 4NHUA 2X09A 5ICZB 4KKAD 3WFEH 1QKZH 2Y6SD 5CD5D 1JGVL 3RDTB 4KJWD 1FAKT 2FJGB 3O6KH 4IOSD 3JV6A 4G8EB 4ZFFA 1F00I 2F8OA 3V0AC 3ET9F 2FO4A 1R24B 3MRJA 4KK5C 4OV5B 1Z9LA 2EH7L 2C7UB 4WU7A 3T0WA 4CADA 1KPRB 5EORL 1U6AH 3T4YA 3QHTC 4LPWA 1F5WA 4NRZB 3GB7B 5CSZB 1P7QD 3V0WL 4LSUH 3GM8A 1L0QA 4OD1L 2WIIA 4DGIH 1FBIH 5FUZL 1ZVSB 3BVNB 5E4IA 5KVEH 3D3VB 2GJZA 3SN6N 2ATKA 4LLYB 4NIKB 5BV7B 2NY3B 4YFEA 5IT2H 3ARDB 4N5ED 1NC4D 2XV6B 2Z9TA 3GSVB 3QR2A 3KPLB 2EKJA 1IZKA 4LSDA 4U1HA 3MGTA 3PIQB 5JMOC 3QDJE 3TT3H 43C9A 5DO2D 4LLWB 2O61A 4ZNEE 2AERT 5I8OL 3PXJA 1EMTH 3O6FD 1QYGH 4K71C 4JFOA 5JIIA 4GOSA 2R4SL 4FQQA 5C08A 1K8DB 3RTQC 4P4RA 1I4FA 3MNWB 2AK4A 4IRSB 1A6TA 2E7LC 2YD5A 3EDKA 4U3XA 5H8DA 3FB7A 5T33H 2IG2H 2JTDA 5HHXH 3HG1B 3X11B 3BW9B 1DBAH 4JFEE 3VG9C 1BJ8A 1WF5A 4MCYA 4TVPE 5F7YC 2VWEE 3PL6A 3V5KA 3G08B 5GRUH 3KPMA 1U6AL 5DZLA 6CGTA 5JZ7D 4ZD3H 1VEPA 1UWXH 1C7TA 4ODUA 2EDJA 3DUHA 3IVKA 2IQAA 3OL2A 4LSUL 1A21A 4P2OB 4XPTH 4ZODA 1FBIL 5D1QA 3IDUA 1FLRH 4TUOB 2D4FA 4FNLL 4LRNH 2W0KA 4B5EA 1UZ6E 2AJSL 2FSEA 3MBXH 1HEZA 3LEYH 3HAEG 1FPTH 1HHHA 4KKCD 5HVWA 1G9MH 2JK5A 2Y1VA 2NXYC 3UTTD 3BWAA 3BGFC 4OZFH 2VABA 2CIKB 3C60A 2BVYA 3HMXH 3TT3L 1AE6H 5IEKA 1JTTA 4QWWC 1NBZB 5JORA 1F4HA 3D39A 3ALWA 2VRAA 4WUUE 5J13C 2FWOB 3UXFA 3IKCA 3QZWA 1ONQA 3C8HA 1S9YA 3SGKA 1UWEH 3HZKA 4ODXA 2R39A 5BVPL 4OZHB 1Q94A 5T33L 1VEOA 2IG2L 5HHXL 5GGSB 5IMMA 4RQQA 3U9PL 3FB6B 3RAJL 1DBAL 3ARQA 1SHMA 2ERJB 3SEPA 5IV2A 1I8LA 1KBGL 4JZOA 2IBGA 2V7HA 1PYWB 1XGPB 1IGFH 1T22A 3ZKXB 4CMMA 3NCJH 4PJCF 3OKKA 4XPTL 1NCDL 2WWMC 1S7XA 5MEOA 1PLGH 1IGYA 4XRCA 1GHFL 2ZUQB 4LRNL 3PGDB 5DLML 5ICXB 4PJDE 5I1EH 2I60H 1IGJB 2IAMA 2AJUL 2DYPA 4PRPE 1XF4A 4FQ2H 4LVOC 3O4LD 1G9ML 1T04B 1M71B 3CFCL 3O11A 3I84A 3UZEA 4PRDB 2C3XA 1MWAB 3GK8H 4Y16A 3FT4A 1MFCH 2JJSC 3F6IA 4JY5H 4FQHB 1W0VA 1ZT1A 3FFCB 5JO5A 1B2WH 1BQHB 4G6FB 1KEMH 5MEQB 1EVTC 1RI8A 3QDHA 4D9QD 5I73C 4EI5D 3GO1H 2ICES 2VC2L 4TVSa 3PHSA 4XWOC 5IP4A 3SO5A 5EN2B 5HDBE 1P6AB 3PV7A 2XTJE 3QQ3B 4M1DH 2VLKD 4XNMB 5HHOB 1WWCA 3LQAC 3FQUB 3JUYA 4YHOL 3U0WH 5DUML 1MCEA 3I50L 3RUGA 1V3KA 1IGFL 4I0CC 4YX2L 1KPRA 3GBLA 3NCJL 4M61B 4O00A 3X12A 2BMKA 5J89A 4QT5A 1X6LA 1Z5LA 1PLGL 5EO1B 1M7IB 3VDCA 4KK9C 4X6CB 2EDXA 1PFCA 4TRPH 3AU1B 4LLDA 1M6OA 1MH5A 3P0YL 4GRWF 3VRJB 3HZYB 1GXEA 2P5ED 2YEZB 5GRXG 3O9WB 3OB0K 3VGEA 5I76A 2XZCH 3HPLA 4LIQH 1S9WA 2BOBA 3GSVA 4ODWA 5JR1L 1WBXB 5DVMA 3KPLA 1MFCL 2FR4B 4KI5F 2OM5A 5FYJH 1XR8A 3OKDB 4WWKB 1X5YA 1J05B 3EFFB 3DSNA 5I6XC 2OTWA 3L7EB 2O93L 1AY1H 4JDZB 3MNZB 2D7OA 4F7TA 1JV5B 4LLUA 3A6BH 5LKNA 1FCCA 2G5BB 4XNXH 3DGCR 1TJIH 4PY8I 4IRSA 2DQEH 3ZSTA 3CSPA 3CCHB 3BX7C 2BNRD 4QRPE 4OSUH 1CE6B 5INCA 3QG6A 4PJFA 2DLIA 5CD5C 4PY8J 4KJWC 5LWYL 4G9FD 1KN2L 1K2DB 2YC1A 3GSUA 3O2DA 1A6AB 4UQ3B 5GS1C 4ZAKD 5E08H 3I02B 1A1OB 5GRZA 3HCVB 4AG4H 4PRHB 2A6IB 3Q2CA 1D6EB 3F5WB 4L3EB 4TUOA 4S1QH 2AABH 4D0DB 2XZCL 3KJ6H 2V5TA 3QFDA 1B4JH 1U91A 5DJ8A 3DETD 4YGVB 1CLYH 2B1HL 4B0MM 1PKOA 2FX9L 2BFVH 2H8PA 1RZ7H 3CFJA 3HZMB 5I8EA 2GFBB 1SEBA 3T77A 3L3KB 5I30H 2X42A 4N5EC 4Z78B 5T3ZH 2MKLC 5FFLA 1JWUB 5AEAA 1KTLA 4A2LA 1FFNB 3FHAA 4XNXL 1ORQB 5I1KL 4OCXH 1HILA 5DO2C 2OR7A 5E8OA 1SBBA 3S34L 1WISA 4C54A 4XVTL 1YMME 3GMPA 4P4KA 4Q6IC 3O6FC 2NXZD 4PJ8D 3M07A 2EH8L 4RGNB 4QTIL 5HVHC 3OAYH 3PQYA 5B3JE 3GGWB 5DJYB 3SDDD 4DK6A 5DFWH 4UV4H 2DM3A 5HYSB 3QBTB 4HJJH 4D9QE 3RIFK 2HG5B 1BBJA 3QQNA 4G7YH 5HSFA 1OLLA 3QUYC 1OWRM 4WI5A 4DVRH 3QXAB 3QQ4A 4S1QL 3B2VH 4DKAA 5JZ7C 2XA3A 5IW1A 3PNWA 5K9KA 4F9LC 3TH4T 3BESR 3GMLB 3NTCL 1M71A 3H8NA 1P4IH 4PRDA 1ORSA 5DSCB 2IALA 1S5HB 1MWAA 2BFVL 4Q2ZB 1QNZH 4YHLL 5GGRB 2GTWB 1AXTH 4G8IB 5D7JC 4WHYG 3O0RL 2BSED 5T3ZL 3ZE2E 4NQVB 1N0LA 2RIKA 4JPKH 2P5EE 4KKCC 4ZO9A 3IDGB 3SKJH 2FJFB 3D48R 1AKJA 5EOTA 3CMOH 5C92A 4UDTB 3TBTB 4OCXL 2NY1B 3VGBA 4XC3L 2CR6A 4QRSA 2DIAA 1P7KB 3PJSA 2IFFH 2HJLA 2IANE 3MODL 1DBJL 5FA3B 4Q9QH 1S5IH 2O5ZH 3FQUA 3M1BB 2Y9RT 2MNUA 4ZXBA 1FE8H 1G7IA 3WLWD 4PGJA 4PY7B 3D9AL 4KHTH 1KB5H 2X70A 1CICD 4IIQC 4PJEE 4GAGH 1ODAA 4OZIB 2GQHA 3MUGB 4GRLA 4HQQH 4HX1B 1U8JB 3UJJL 1BFVH 2ADGA 1U8LA 1VADB 5CWSB 3MRFA 4MQXD 4X0KA 2MQCA 2BNRE 3HZYA 3ARFB 1NGZB 4OLZH 4P57B 3VRJA 1T2XA 2HLFD 1OGTB 5GQBA 2WLZA 4N9OB 4NBYB 1NCNA 5DD6B 1P4IL 5CEYA 3U7AA 4G9FE 1NAMA 2LAGB 1G7JB 4H0HB 2JB5H 3HE7D 3BKYL 4YNYA 3GJFH 2O5XL 3SJVD 2D0GA 3WV0A 3LQAH 1GGIH 1WWWX 3VD5A 1LEGA 3L7EA 1FORH 5IIEB 1DEEB 1T20B 3CMOL 3MNZA 4YK4B 4L8CA 4R3SB 5GGVH 4R4ND 3V8OA 5IB2A 2XKSA 5H35B 1AR2A 1EGJH 4RMVA 5IB1B 1S5IL 2O5ZL 3EO0B 1VENA 1D5BB 1AO7B 1RURH 5SX5K 4EI5C 3CPLB 4KUCF 4AEHH 1KB5L 3I6LD 2UWEE 3W9DB 1E6JL 2QADB 5DEFA 1OP3K 3QIBA 1BFVL 4H0GA 1EXUA 1CGTA 4UDUA 1A6AA 1PW3A 3A0OA 1ZLUK 2WQ8A 3BP7B 2EDFA 4Y7MA 3O3DA 3NFSH 2AXGB 4XMPH 3HCVA 3O3EA 1D6EA 3QUZA 4OIBA 2EKSB 5HBBA 1CGSL 3LZFL 4OCNC 3W0WD 4LSPH 4XH2B 4ETYA 1BD2A 3H9SA 3O4OC 4XXCA 4PFEA 4HT1H 5HYEA 4NJ9L 1T4KB 3MOBH 3OHXB 3OZ9H 1UENA 1HHGB 2JB5L 1XZ0B 1LO0L 3ARBB 1LDPH 2NY2B 5D7SH 5FDWB 3HUJE 4YBQD 1FFOA 4Z0XB 2E9JA 4K9EC 1QBBA 4ELMB 3LQAL 1GGIL 1M7XA 1FORL 4XZUB 4PJ9A 1E28B 5GGVL 4MDJB 4D8PB 3MLRH 4MAYD 4XHJD 3D2UB 4U1KB 4N8VG 3W82A 3SDXA 2Z35A 1EGJL 3WE6B 1S7VA 2V2TB 1Z9OA 5F7FA 4BQBA 1CFVH 1JTPA 4HKJB 1RURL 3X3GH 4OF3A 4QRUB 4AEHL 2BJMH 3E3QE 1S7UA 1X5GA 5HYSA 2Y06H 2YXMA 1OGAE 5FM5M 3LSOB 2FBJH 3PWNA 3STBA 4XMPL 4HUXA 2J8UE 2A38A 2LU4A 1C1EH 4J3UA 2NW2A 1W72B 5D6CB 4HT1L 5BRZD 3M45A 1BAFL 4ZAKC 2H3NA 3OZ9L 4X6DA 4FABH 1PG7X 4FA8A 3T0DA 4CVXA 2FD6H 1FZMB 1IEAA 2HRPL 3ABZA 2R1YA 3DETC 1QOKA 35C8H 1CR9H 3EO1B 2FJFA 3MLRL 4ZS7H 5AD0B 3CNKA 3D69B 3O3BB 3TN0D 1KELH 3DARA 3H42H 2RR3A 1P7KA 1PX3A 1CFVL 3X3GL 3SJVE 3ARGB 2PTTA 3L3DB 3CFIC 4PJ5D 4LSSH 4K8RD 5D1XA 4XAWH 2VLJD 2BJML 2Y06L 4WTZA 1FNEA 4Y1AB 2FBJL 4ZUVA 1GSMA 4GAYB 1G7LB 4U33A 3UYOD 3VXMB 2HFGH 2NW3B 2NXZC 4PJ8C 5EB9A 3DURA 3S5LA 2Q8AH 4LF3B 3HB3D 3BMWA 3TYFB 1LO2L 3SDDC 5L9DL 2VR5A 1QRNA 2J6EH 5E1AA 1TNMA 2SEBB 5E8DH 5F93C 4NKDA 1P6FA 1L6ZA 2APWA 4L3CA 5FGBC 5KSBE 2JCCB 3BE1L 4PRIA 2EDQA 2FD6L 3NCFB 1BQLH 4HW6A 1BF2A 1BP3B 1MAKA 2YPLB 5FECB 5MERB 5C6TL 3ROLB 3B9KB 2BSSB 3R1GH 4L4TB 5GIRB 1J1XH 1L0XA 4ZS7L 1DEEA 3HC4H 4R96B 4JFDD 3BRDA 3MV7A 1NGXA 4L5FH 4YZFF 1M7DA 5C0BD 5JW5B 4RMRA 3IKKA 2DLTA 4LSSL 3S4SB 4P49A 3OF6A 4XAWL 1XT5A 4JM2B 3B9EA 4Z7QE 3DSFH 2EYRA 5DURB 1OW0C 3SDCD 1L7IH 3O3AB 1CL7H 5EPMB 5FYKU 5T5NG 3WS3B 3LB6D 5JXED 4TSCH 3SPVB 2V5YA 1BVKA 2Q8AL 3HE6A 3D0VB 5D2NC 2X89A 4NHCL 1AXSB 3CVIH 3UTSD 1WBZB 2EKSA 4R4BB 3TA3B 1A7BA 4LNRB 3WLWC 2XFXA 4UV7L 2J6EL 5E8DL 5DD0H 1CICC 1JNLH 4X6EB 4RGOH 1HZHH 4OI7A 3F62A 4M9OA 1S78D 3TZVB 1QQDB 3TJEL 2CK2A 5CHNA 2APTA 3C2AL 5DHVH 5HI4D 4HJ0D 2NY6D 5GRVK 3MRPB 1P1ZA 2JKXA 4Z0XA 5DA0B 3FO9B 1JGDB 2X4UB 1ZLWH 1AHWB 4Y5YA 1ZHKA 3KYAA 5BRZE 3P77B 1HOCB 3FAWA 1E28A 2AAVA 3HE7C 3OKNA 2ED8A 4L5FL 3D2UA 4OT1H 4RISL 4P5MA 1WICA 3DJ9A 5DD1H 2CKNA 3GDBA 3KNBB 4JO2L 5J3HD 5FIEA 4QRTA 1V7MH 3NCMA 1DSFL 2AJVH 3D85A 2B0SL 4KHXL 2HKHH 4OGYH 2MQ0A 5CJBA 3DSFL 4HK3J 1K85A 1YMHA 2C3VB 4TSCL 4GKZA 3VWJD 2QJDA 2WBJB 1UM4L 3FN0H 3CVIL 3WCYA 4J3WA 4GUPB 2XZQL 4FXGB 5SV3A 1UB6A 5MI0B 2CO7B 1JNLL 4Y2DD 3KXFD 4HZLB 4NO2B 4RGOL 4PJ5E 2VLJE 2VR9A 4G8GE 3CLFH 3GMNA 3K80A 3H7LA 1ZLSH 1A3LH 5DI8A 5KOVC 1YEJL 1NGWA 4RNRB 2NR6D 1JF5A 3G6JA 4PG2C 4XMKL 4NQED 1MCFA 3T0ED 4HGMA 1TPXB 4JFHD 4NFCA 5IMLA 2VLRA 3ZHDA 1K4DB 3MV8A 1LK3H 4OF0A 4OT1L 1AQKH 4YBQC 3CVHH 1V7ML 1PX4A 5F97E 4YPGB 3JTSB 3BDXA 3CAFA 2QBWA 1H3XA 2HKHL 3ARTA 3ARGA 1OSZA 4LLMA 2F53D 2OCFD 4XHJC 2DQUL 5ITFB 2G9HB 4UAOB 2OTUA 4LVNB 3GSOB 4R97C 3RUGF 2FEDD 5IUSA 1CLZH 2HTKD 5C0BE 4H25B 3UZQA 3EIFA 3L3HA 3VXMA 1QEWB 4FHBD 4MHHI 2LE9A 4GBXB 2OI9C 4K9EL 3LQZA 3TGXA 1BZ9A 3F6LA 4MVBD 3ELAT 1M05B 1J8HA 3NACL 4YWGH 2GITB 4PP2A 3MA9H 3QDGD 3EOYG 3UPCA 3GSNB 3FFDA 4PIRF 2CDEB 1E4XI 3EYFA 5L2KB 2ATPB 2DMCA 3KPQA 1A7PH 3UTSE 3ROLA 4WHTB 3QI9D 2ZSVA 1LK3L 2V5MA 4YAQA 1I7UB 2FEEL 3WO3B 2PO6D 1AQKL 5E7BA 4KGJA 5SWZB 2AQ3A 3IF1A 4PGDB 1RIUH 3T65A 1CGYA 2CRYA 2AGJH 4P99A 1EJOH 5IBLD 4F33A 1EFXA 2WW8A 4IHOB 5KW9H 4UB0L 3RA7H 2YD1A 1HSAA 3TN0C 2F5BL 2B5IC 2CKBB 3LRHA 4XP6H 3W39B 2XT1B 1CQYA 5CUSH 5F7HA 1ZXQA 2H2PD 1PDKA 3L5IA 3HPJB 4KV5F 4PJFF 2P7TA 4I3SH 2CK0H 2EYTB 2XXCB 4YXHL 3WS3A 1SJHB 1A6PA 1V8HA 3SPVA 4HULB 1I1FB 4X9IA 1KSRA 3H9YA 3P11L 1QSEE 4YWGL 1JUFB 4LNRA 2D0HA 5HGDB 4X7EC 3HFML 3MA9L 2XWJB 3KAAA 1D9KA 4U1GC 1QZ1A 1MREH 3RGVA 5DYOB 1F11B 4R4FH 5FYKD 4NKMA 5JOPE 3ME0A 3HB3C 3HI1B 5CIPH 5E2WH 1K4CA 4ZMAT 3SE8L 5ERWA 1KOAA 1LP9A 1A7PL 4X7TA 4HEME 3BIKB 1QD0A 3BSZL 1BMGA 1MJJA 3KXFE 3FO2B 2ZPKL 2FECL 3RU8L 3RTQB 3NZ8A 4PLJD 4G7VH 5TDPA 4E41D 4X99A 5JOEA 1HI6B 3MREB 2AV1B 4HHAB 1ADQH 1CG9B 1CFTB 1LHZA 3T0EE 4OZHF 1CDIA 4FRWA 5K9QG 1BZ7B 5EUOA 4JFHE 5CBEB 4XP6L 1NGQL 2C4FT 2R56H 4M5ZL 4NQCD 3RZCD 4HH9B 4L9LA 2J5LC 4DOHB 2K7PA 1UH3A 3SY0B 4I3SL 2CK0L 4HWBA 3STZB 3K2UH 3C5SB 1IQDB 2BP3A 1YDPB 3M8OH 1YQVH 4TPRL 2A74A 3MOAH 3SQBA 4GW1A 2PCPB 3VH8A 5F8QC 5EO0B 5BS0D 5I16A 4HLZG 1P84K 4YHZL 4PJ7B 1VERA 1VACB 3T2PA 3GNMH 5GSRA 2QR0B 4MNQE 1WSST 4NP4H 2F53E 1MRDH 2J3SA 3SDCC 4AL8L 5FDYA 2YXFA 3GIVA 5IF0A 3LB6C 1S7TB 1MREL 4Z9KB 1FVEA 3GMOB 5JW4R 1JPTH 2HWZH 1YEDB 5D1ZD 4HMCA 4X9GA 4FS0A 3U0TA 1RUQL 4QEGA 2ICWB 1L7TH 2WUBH 1FIGL 4WHCA 5ACZB 4OLUH 4ZFOA 2MKWA 2AXFA 4NDMA 1S78C 1CCZA 3BD5A 5IJKC 3QDGE 4K3EH 2PYED 2NY4D 4LCUB 3QT2A 5HI4C 2NY6C 4KVCH 3V4PH 1INDH 1ADQL 2ORBL 5A3ID 2DLFH 4U0RB 2D7TL 4S10A 3JTSA 4M7LT 1A4KB 4ZDHB 1JF6A 2R56L 4A6YL 3CFDA 5FOBB 4QHUB 3VFUA 4OCMC 4XNUH 4HCRL 3H0TA 3K2UL 5HHME 3M8OL 4FZEH 1XGRA 2DQDH 3RKPA 3MOAL 3VXPA 2GEEA 1QPXA 1JPST 1ZGLM 2IEPA 2GW5A 3LN4A 1U92B 4QOKB 3GNML 4LVOB 3NN8A 1IEBA 2OBGA 3C08L 4X6CF 2G60H 3BH9B 3QDJB 3VWJC 2R2EB 1G9NH 4ZYKA 3FB5A 3ULVL 2HLAB 1CD0A 2J8OA 1DLFH 3B5TA 1L7TL 1C5BL 4CU7A 3TC9A 4Y2DC 4BH8B 1Q9KB 4WI9A 4XBEL 5F1KC 5F96L 1IM3A 4KI5D 4C58B 2QV2A 4RIRB 2VAAA 5L88H 5KANG 2VN7A 5F9JA 3OB0H 5C0FA 4QCIA 4YIQA 4HK0B 2VKWA 4X4YB 4GG6E 2NR6C 1I7UA 3GJFB 3I6KB 4KVCL 5SWZA 1INDL 3KPNB 5EIVA 5J12C 3GI8L 1KPVB 5DEGB 1Z3GH 5DQJB 1J5OH 5KZCD 1X5KA 3QIWD 4PGBA 5IMKA 4YDVB 5T1LA 4Y4FD 5ID1A 3LRGA 3TIDB 1RJYB 3BP6B 3LKNA 4XHQA 1UVQB 4GXVL 2EIDA 1FG9C 2X4RB 2CKBA 1HCVA 3QUML 2JF1A 3QJHB 2E8ZA 5FHBH 2ADIB 3UO1H 1GRWA 1NC2A 2EYTA 4ETQB 1DQML 3KPSE 2PTVA 1T1WA 3GRWL 1J9CT 4B50A 5LGJA 3G6AB 4JFZH 1WEJL 5LAXB 3O8XA 4ZUSA 3V7AG 1A7NL 4ZUWA 4PJGE 1IFHH 2HTKC 3QFJA 4GQ9H 4NSKA 4JRYB 4G9DA 2VDOH 3MV9A 1DLFL 4YFLI 4WUUB 1HHJA 5DYOA 2VL5B 2R8SH 5EOQH 5D93C 4PTTB 4MVBC 4OUOA 2Z4QA 2P5WD 1H3WM 3ARWA 1S8DA 5F71A 5DRXB 4N0CD 1SM3H 2F8VA 5L88L 3WBDA 3P4LA 3RL2A 3I3DA 3HTLX 4HXBL 1VDGA 3VGAC 5D96C 1LEIB 4TTDD 5J9PA 2HFTA 1B0GA 5KVGH 5TE6L 5JW4N 4M3JA 1J5OL 4XVUD 3DIFB 1OSPH 1QFWM 3DXAA 3QI9C 5DT1H 4HHAA 4GW5B 2GCYB 4K8RH 3RVVC 1TQBB 1N4XH 4YLQT 1F90L 4KROD 3H3PH 2PO6C 2EECA 2FYYB 4O51A 4B41A 5GS1B 1PD6A 4NNXA 3RHWF 4FQXD 3UO1L 5FHBL 2PYEE 1EZVY 4NWUL 5ESVB 3MLTB 5EU4A 4U7MA 4R8WL 4NT6A 4YEEA 5EU6A 4P5TB 5E8NB 4PRPB 3NH7L 1NFIA 4PJBE 3V5HB 3UAJC 5DMKB 5DJ0B 1VACA 3FOLA 5BZDB 2H2PC 4NZUH 4G6JH 3D6GA 1IGMH 3GMQA 4GQ9L 3JTTA 1LE5B 4GLRH 2VDOL 4JFFD 1GZQA 1I9IH 1PKQA 4G5ZH 4IRJD 2NX5D 3RP1A 4HZAA 5EOQL 1C5DA 1DBBH 1MHEB 1B90A 4X6DF 3HI5H 1SYSA 4XP4H 4DKFL 2ICWA 4MNGA 1SM3L 5E6YA 3VXUA 1BREA 3V0VA 3QXDB 4NC2B 3T2NH 3UYRH 5DGQA 5ESAB 2UVEA 3IS1X 2EC9T 2BVPA 2XTJB 3NVQA 3DTXA 4L8BA 2EIZB 3DECA 2G75A 4PG9B 2NCMA 4DN4H 4LCUA 2X6MA 3KYNB 3N1PC 1TCRB 1OSPL 4EBQH 3L7FA 1FAIL 5HVHB 4JJHA 1N4XL 3H3PL 5SWSA 4ZDHA 4PLJC 4KRNA 4WDIA 4EJ1C 4NYLA 4OLYL 5I2IA 1NFKA 1JGEA 1S7RA 4I2XE 1N7ML 4OI9A 2R0ZL 4QRRA 2XY2A 5F3HA 2R1XA 3AMLA 5DHYB 4LCWA 3QNYA 1U8MA 2V2XB 4C4KO 4UZGA 5J1SC 3NPZB 1Q72H 1NL0H 4QOKA 3RZCC 1EHLH 2Z31A 4G6JL 4C55A 5LXGL 3LD8C 3AAZA 5DJDB 4JFPB 5A2FA 2FZ3B 3DROA 3QUXD 1VKXB 3SKMB 4HUUB 3NGBC 2R2EA 1DBBL 3MA7B 1PG7H 3RNQA 1X5IA 4DKEL 3HI5L 4XP4L 4H1LB 3RQ3A 3NCYS 2DICA 2B39A 3CFBB 1H3UA 3T2NL 1Q9KA 3UYRL 2YR3A 1S3KH 3MR9B 4OZ4B 3WHE0 1ZS8A 4NZRL 3L3IA 3QAZB 1LO5B 1SQ2N 3B2UD 4OCRH 4DN4L 3MACH 1IGCH 5KN5B 4QRPB 5GS2D 1IM9D 3PWVB 1RZ8B 1FNGA 1QBML 4HS3A 4DQOH 4XPFH 2P5WE 4X80L 3S35X 1RZGB 1G7QA 5DC4B 3VW3L 3V5DB 2XICA 1AD9B 4S0SD 4GO6B 3FRPA 1A1NB 2NY4C 3MBEB 1CXEA 4W4OA 5CJ5A 1TJGH 1P69B 4J1UA 1RK1B 4ZO6A 3AXLB 5A40E 2X4OA 4NM8L 5E2TH 2R23A 4NQDA 4XCEB 1RUKH 4KUCD 2ADIA 3P9LA 1I8IA 1BF8A 4O2FB 2X4QA 1DQQA 1BZQK 2YSSB 1RFDL 1NL0L 3R8QA 1KYOK 5IK3A 3LRSB 3VI4F 1IC5H 4RWYL 3SCMA 4HF5L 1DLHB 4LKCA 5SX5H 5F9DC 1Y6NR 3BP5A 4ZPTB 4EI6B 1BECA 2HJFA 1PG7L 2A83A 4JRYA 1OP3H 1QFOA 4LLVB 1DEDA 4KK6D 3ARED 2CQVA 2R9HC 4NN6C 5DFVC 5F1NA 1ZLUH 1S9VA 2FX8H 1BVLB 1J1PH 1ZK9A 4I9WE 4P2CG 2ZUUA 5H94B 3LEXB 2PN5A 4F57L 3DOSA 4HIJB 2DQTL 4W6YB 43CAA 4ELMF 3JUZA 1YMMB 3O45A 3IRZA 1Z9MA 1MCSA 4JFFE 1BJ1J 2Q8BH 4ZG1A 3QEQA 4MLSA 5JPNA 5D7LD 2XPGA 4XPFL 4Y4HD 2X7LB 4KI5C 1JPGA 4UT7H 4EI5B 1Q9LB 4M9PA 5ECJE 3GKWL 1PJ9A 2LQRA 1CD1A 5JHDD 2LVEA 3KPRD 2FYYA 4XX1G 4Y4KA 5C09D 2IBZY 2OL3B 1FL5B 4NKQB 2YD7A 3MXVH 4P5TA 3ILPB 1GYAA 5MEPB 4AH2A 4Y4FC 3DMMD 3IB4A 5DMKA 2GI7A 4GG8A 1VGEL 3DO3A 4M7ZB 7FABH 2DKUA 3B83A 1YC7A 2XG4A 3MJ7B 1TTGA 1U3JA 3P0VL 5IVNA 2B1AH 5E4EC 3T8XB 5JW4M 1BOGA 2BHYA 1LE9B 2P5EB 3GJEA 3R06A 4AENB 2EDTA 2FX8L 4LSQH 5B38G 4ZO7A 3ES6B 5GSVA 2QHLA 4AY0A 3CDCA 3FTGB 5BQ7A 1FZOA 3TO4B 2DQCH 1G7HB 1MQ8A 2IANB 2R2HB 5LBSH 1A02N 4U2ZA 2YS4A 2DAVA 4U3HA 5AG8A 1J0ZA 4E5XA 3REVA 2P8LB 5I0DA 1F4XL 2ESVA 3FOMA 3RWJB 1KIPB 1DTUA 4ISVA 2EEAA 2A6DB 3T3MF 4J4PA 5GGTA 4TTDC 4CAGA 5J56B 5INDB 3MJGX 4N0UE 5IB4B 4XVUC 4P3DA 2CO6B 2BNRB 4UI2A 4D9RD 1CDHA 1F4YH 1TITA 4XCNB 3GI9H 5SWQB 1VB9A 2DLHA 1MCBA 4KROC 3VRIA 1U42A 1EVUA 4G9FB 1MCQA 1E4KC 2OZ4A 5EC1B 4FQXC 1CVSC 4YPJA 1DVFB 2FZ3A 3AM8A 5DK2B 1N0XL 2KZ1B 5FYKH 4POUB 4X83A 1MCOH 2OXHA 5HPMB 4LSQL 2D03H 2PXYC 1H5BA 5AZEL 5J1AB 1T0MA 4JKMA 2YRLA 1NGYA 1HXMA 1DCLA 1RZFH 2DQCL 2BDNL 2C3GA 4IRJC 4FFYH 1IKFH 5D2LE 1T1YA 1W8NA 4L29B 1IBGH 5HTSA 2AJYH 4DZBA 5KN5A 1XGTB 3V6FB 1O7VA 1YEHL 3PWVA 1WFTA 1RZ8A 2JELH 2UWEB 1A6UH 3SGEH 1FL3A 1AQDB 1DQLL 2C26A 1K6QH 3CXDL 1AD9A 4NQUA 1PZ5B 1I1AA 4NKOA 5C08D 5GS0L 3BPNB 2AK4D 5CBAB 5J6GB 4N68A 4JM2F 2NXZB 1FJ1B 1RK0A 1U9KA 4OZGA 2IMMA 1WZ1L 4TULH 3IFPA 3SDDB 5TGBA 2MFNA 2Y72A 1UG9A 4CJ1A 2OR9L 1FDLH 1JHTB 2QSTA 2X1QA 3D1MC 5JHDE 2I9LB 4LVHB 3HUJB 3S88L 1MEXL 1MCOL 4U1IA 4LU5H 2P49B 2VZOA 5D1QD 2XG5A 1F3RB 3O6LH 1R3KA 2XA8L 3QUXC 1RZFL 3SDAB 5H94A 3B8SA 5TH2A 4MD0A 1YN7A 5GGVY 4HIJA 1IBGL 4I18B 2ITCA 5CIPB 1CIUA 3C60D 2JELL 2N1KA 4HJGB 1A6UL 4IM8A 1U8IB 3P73B 4ALAH 3CH8A 2F19L 1KB9J 3LQMA 4TN9A 1KEGL 1K3IA 4H8WC 5CCKH 1OGAB 4NCC1 2GT9B 2I9TB 4QY8B 5C0GA 2FHBA 3GIZH 3RWGB 1SYVB 3S96B 3C6LA 3DV6A 3ZDXF 2CJUL 3G04B 4Q9CA 5GJSH 3UBXG 2OL3A 3DPBA 4MB4A 4TULL 2IPKB 3VWKA 2X4TA 5HYIA 1FGNH 3RY6C 4TNVF 1OCWL 1RUMH 2I5YL 4NQXA 3C5JB 4KQ3H 2DB8A 2C1OB 1PSKL 1WAAA 4OCSH 4GRWH 4CNIB 1JPFA 1OAZH 3NMEA 4IOIA 1DUYB 1JRHI 4LU5L 5DD5L 5DZNA 2UV3A 4APQD 5CGYC 5IBTL 3WL9B 5HJ3A 3QWRA 3OKOA 1XF3B 2P46B 2ARJA 3P4OB 1OP5K 3O41B 1IAIL 3RGHA 3WO4B 3HE7B 5KAQG 4S2SB 3TO4A 4FXLA 1G7HA 1F2XK 4Z77B 4KK6C 3BGMB 3AREC 4WCYH 1NJ9A 4J3TA 4XB8A 1EBAA 4Y16D 1ZHBA 5T1DH 2R2HA 5TQ0H 2KBGA 1XF5A 5J11B 5AYUH 2H32B 1MHCB 3TP4A 3WKML 2XYCA 1PQZA 4G43B 4F9PA 4U6YB 3DYMA 3GIZL 4RFNB 4NRYB 3RVWD 5ANME 3MGOA 3T0VA 4Y4HC 3WUWG 4C83A 1CDUA 2APBA 5B39B 1MI5A 3MQIA 1RUML 3VJ6A 5SWQA 2NLJB 3CC5A 4KQ3L 5KSBB 1LO4H 2W9EL 1I9JH 4OCSL 4QO1A 1JNJA 1HN1A 4LSVH 1OAZL 1DVFA 4IDJH 5C08E 3RWCB 4S1SL 3E0GA 5F1IA 2AK4E 4MQTB 4OKDA 5HPMA 5C1MB 4J12A 3WHXA 4UQ2B 4Y19A 4JFQA 3D3VD 5L2JB 4C59B 3GBNH 3LH2H 4I5BB 3EYUH 2NY3D 3DYOA 1OF2B 1HK6A 1B6DA 3V6ZA 3O81A 4WCYL 4RMUA 3N1FC 4LNVA 4V1DA 2P42B 4F15C 4HKZB 4DUXA 1RMFH 3IT8D 4D0CB 2C4FU 2NY5C 5JXAH 1NMCB 3RHWK 4Q9BA 5AYUL 3ZL4H 5CD3A 2UWEA 1BFTA 3MJ9L 1FO0A 4MAYB 3SKNB 5GRJH 1UM6H 4MB5A 1TNNA 4NBXB 5EA0H 5JIKA 1X9QA 2VQ1A 1N8ZB 5GJTH 4F58L 1WTLA 5D8JH 3WJLC 3OX8A 1X5HA 4IRSD 5CAYB 1NPUA 5C70A 4JZNA 2D9QB 5D6DC 4XB7A 3HG1D 2JIXB 3D39E 4U2YA 1LO4L 4DAGH 1I9JL 1I8KB 4CN6A 2CD0A 1JF1B 4GQPH 3LIZH 4LSVL 3V4VH 2I9LA 5M7QA 4FZ8H 3VFOB 4Z5RB 4AJ0A 3GFUA 3U1SL 3F7VA 1YQ2A 4JY4B 1JWSA 4QXGL 3BMVA 2CH8A 4LCIL 4IMKC 4MQ7A 2RQ8A 1JHKH 3RX7A 1IAOB 3SDAA 3ULSB 3X14A 4AQ1B 4FP8H 5EU5A 4EUPB 2RCSH 1MHHB 5IM7A 3QHFH 5I8KH 1MIEH 4HJGA 1EAPA 3WFHB 1N2RA 1IAII 2ICCA 4HC1H 3U36B 5I1AB 1UEMA 1FNSH 1L9MA 1UM6L 3TN0B 3DUSB 3IU4H 2KDGA 5EA0L 3F7RA 4JREC 5ALBH 5FO8B 3A67L 3IS0X 3G5XA 1QVOB 5GRWA 1OM3L 3SKOB 1Q8MA 1JYWA 1RJLA 3ZDYE 4PJ5B 4I13B 4JFYB 3H6JA 1KJ2L 4MQSB 2VLJB 4NJAL 1LD9B 4MDIA 1Q0XH 2WP3T 4P4KD 4G8GB 3EJYD 3U7YH 3UTZB 3S8WA 3CSYB 1A6WH 4KDTA 4C56A 4DZ8A 2CDFA 2B2XH 3PQYD 3V4VL 3IETA 2DJ4A 2LU7A 2VDKL 3WFDL 2BSTA 3DRTB 4FZ8L 4JPIB 2DJUA 4CNIA 2OK0H 1J1OH 3GHEH 4R7NB 3UZVB 1AH1A 1Z0NA 4W4NA 1ACYH 3ZT7A 4WFED 5K59F 4S11A 3KDMA 2I25N 3RUGE 4JPWH 4H8WH 1IC4H 3S97C 2RCSL 3ZE0E 1WZKA 4F7EA 5D9SA 4KZEH 5GS2H 1UJ3A 3BGMA 5C0JB 3KJ4C 1P9MA 4L3AA 5I8KL 1MIEL 3M17A 2P47B 4HC1L 3FFCD 2QSCH 3L3OB 3BQUB 1K8IA 3IU4L 1NGPH 2VUYA 4YDIH 5C0BB 1AKJD 3MRLB 4OUUA 2YKLL 3C60C 4JKLA 4UT6L 1QLRB 5FO7B 2NY7H 1IAMA 5DR5L 1NANH 2NZIA 2VISB 3CZFB 5D7IA 4I4WB 2F58L 4J3XA 3BKJL 4YGAB 5LJYH 4NNYB 2HFFA 2OQJB 4OB5H 1CDJA 5DJXA 5HHOD 1RPQA 2PW1B 3BPLC 2NLJA 3SDCB 4I3GA 5KSBA 2EEDA 2W60A 5FXCH 5HD8C 1KFAL 5C0IA 5E2UL 2D7NA 1J1OL 4ZUTB 3RWCA 4FQLH 3PABB 3UTSB 4P23A 1A0QH 1BQUA 1JZ7A 1I8LC 1ACYL 1SEQH 1Y18B 3AGVA 5GGQL 2A77L 3MUJA 1JN6A 2DD8H 2BVTA 4HAFA 1D5ZB 4H8WL 2FH8A 4KV5E 1LILA 1FVDB 4PJFE 3O9WD 1OF2A 2XNAB 4Z8FL 2F54A 4APQC 1MRFL 4OM1L 4NGHL 3O3UN 3WD5H 1EERB 3NCYP 3RWHA 4AIZA 3AMKA 2QSCL 3IJSA 4U0QB 5DJCB 2WSKA 4M7KH 2L0DA 2AEIT 1NGPL 3SKNA 2A1WH 5CMAA 1BQHG 4UIMB 4DUWA 4JHWH 4Y16C 1BIIB 1R3IH 3CH1A 1MFEH 2NY7L 2HYMA 2Z93A 4HMDA 1CQKA 1QSEB 2COQA 2W0FB 3MJ6A 1BPVA 4PB9H 1BWWA 5ADPL 2BNUB 1S7WB 3LPWA 5IMOB 1Q9OA 3LMJH 3QUKB 4I3RH 3CX2A 4QYOB 4M5YL 3LS5H 3QO0A 1XIWB 1MUJA 4LEXH 1JF1A 5FF6B 3RVWC 3VWJB 5E03A 3PV6B 3DV4B 5EC2B 3RDTC 3DX8A 4FQLL 2DBLH 5FGSA 1DUZA 3S9DB 2QHRH 3WNMA 5ID0B 2MMXA 2EC9U 3FONB 3U79A 3KXFB 2NY5H 4PRHD 1YNLH 3QNZB 4L3ED 1SMOA 3H9SD 4RBPK 1I7ZA 2Y07H 3PQYE 1MLBB 4XPHH 1A9EB 3T0EB 3TJHD 3BT2L 4CDGC 3OQ3B 5BV7C 2NY3C 4WFEE 4NKIH 2A1WL 3ARDC 3VE0B 4NPYB 3MRNB 3S35H 5KSVA 4MD4A 3H7BB 1Y0LA 1R3IL 4OJFL 4O2EA 1WCBA 1P2CB 1T3FA 1EV2E 3TCLB 3VFGH 1T0NB 4F37F 4MNQB 1DQDL 5EBLB 2F53B 2R69H 4P46A 5L0QB 1MFDH 3O6ML 1LD9A 4I3RL 4MXQC 2ZCKH 3T4AA 3N1QC 3STLA 3CFKB 2DBLL 4QKXB 4IRSC 1C5CH 4LSTL 4OLEA 3OXSA 1QR1B 4N9GB 2PYFA 4YE4H 2IQ9L 4PJAA 3QDGB 1MRCH 5HYJA 4XPHL 5CZKA 1A4JB 2YPKB 3L5WB 4P2OC 1VGKB 4HS6B 5HYQA 1L6XA 5C0JA 3VXQA 5FHAL 3WNOA 4KQ4H 4FG6D 3QI9B 1G6RL 1XAUA 4NKIL 4BUGA 5H37G 1CFNA 3S35L 5HHMB 5TDOA 3WXVL 4YDJB 3S7GA 4EZMA 2FJHB 5E5UB 2HVJA 2PTUA 1BM3H 2NNAB