1VAJA

Crystal structure of uncharacterized protein ph0010 from pyrococcus horikoshii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
203
structure length
203
Chain Sequence
b'FKIKDEWGEFLVRLARRAIEEYLKTGKEIEPPKDTPPELWEKMGVFVTLNRYNVPPQTALRGCIGFPTPIYPLVEATIKAAIYSAVDDPRFPPVKLEEMDNLVVEVSVLTPPELIEGPPEERPRKIKVGRDGLIVEKGIYSGLLLPQVPVEWGWDEEEFLAETCWKAGLPPDCWLDEDTKVYKFTAEIFEEEYPRGPIKRKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0010
molecule tags Structural genomics, unknown function
source organism Pyrococcus horikoshii
publication title Crystal structure of PH0010 from Pyrococcus horikoshii, which is highly homologous to human AMMECR 1C-terminal region
pubmed doi rcsb
total genus 58
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1vajA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1vajA02
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH superfamily
3SOJA 5L1JA 1RK5A 4RZRA 4DV4H 1S68A 3VMMA 5DQIA 4EYIB 4F4YA 3HOUG 2R7MA 1XNRH 4I55F 4JUZA 4DV3H 2R7LA 3ETJA 4EYHB 2FPPB 4PDBA 4IHJF 2PN1A 3G6VA 2R86A 2HVQA 2W9BB 2W9AA 4IRCA 4UCUA 4O3NA 3ORRA 5KFBA 2UXBH 1TAEA 2JEFA 5KG0A 3HKZA 4O2AF 3JZZA 1KBLA 4QWAA 3IN5A 1VBHA 3BQ2A 5FD5A 2NU6B 4BY7G 1E4EA 1UC9A 4YY3H 5KFNA 5C1OA 4DR2H 4C2MA 2OLSA 2W6ZA 1I50A 3N43B 2KSWA 4MTEA 5KFEA 3RAXA 4JI5H 3RB4A 1RK6A 4J9RA 2HHHH 1DV1A 5KFCA 1IBKH 1I7NA 1T36A 1I3QA 3HOYG 2WB1E 1AUVA 5KG3A 5C44G 5C8YF 3KHRA 4YJ3F 2NU8B 4U7CA 2FE3A 2JEGA 3KHHA 5KFYA 2GPSA 4M9UA 3C0FB 4RB2C 4DL6A 4RB1A 1V51A 4MV1A 4OX9H 2RDJA 1JXLA 1M0WA 5LL6b 5FD6A 5F9LA 4O3PA 5D1OB 3N8DA 3BQ1A 5LMNH 1RJPA 2J9GA 2R82A 2C35B 3VPBA 4HNTA 4NXNH 2AGPA 1FVIA 4ECQA 1KJQA 3TINA 1Y14B 4DV5H 2UVVA 4DV1H 5K2MA 4A2BA 3JZIA 5KFMA 5DG9A 4AYBA 3PW2A 4LW9A 2VPSA 2Q2UA 4EBDA 4YR3A 5H80A 3M9NB 2GLTA 3HBLA 4BBSG 2IP4A 2FLLA 4JI3H 4ZI7F 4LF5H 4QW8A 3NGDA 4RU9A 3FKIG 4MV4A 4MTDA 2GPWA 2CW7A 4CC5A 5KFSA 1KEEA 5C5JA 2UUBH 2VOBA 1WCMA 1T94A 4ECTA 3JAMW 4ECZA 3BG5A 3KAKA 1X6QA 2PILA 3U9TA 4LH6A 1K1QA 5IYDG 5IT9W 4O3SA 4UCRA 1E4FT 2R92A 2DPIA 4GC7A 4Q0YA 3GV5B 4MV6A 3H0GG 4J9KA 4DR3H 1N32H 3JSLA 2PVPA 1CQIB 3VPCA 1OWTA 2RGRA 1CQJB 2NUAB 3RUPA 4RB3C 3GTOA 4ZQIA 1GLVA 3RF2A 2YW2A 1PX2A 2YZNA 4I7HA 1Z2OX 1X9NA 3MR3A 3RB6A 3GIQA 1Y1WG 2YZGA 3H20A 4EEYA 4JI4H 1GYFA 2BQRA 2HVSA 4MV8A 5KG4A 3FDSA 4GC6A 4HNUA 1TA8A 4LF8H 2ASDA 3MR2A 2R8KA 4YQWA 3UFXB 4JI6H 3G6YA 1FJGH 4LSXA 4J0MA 4FBUA 1VKZA 4B3TH 1JDBB 5KFTA 2YCHA 3EPIA 1E4GT 2W6OA 2HI2A 4TUYF 4MA0A 3T5KA 3BA9A 4O4LF 4QIWA 1ULZA 5CA1F 4RNNA 5KKNB 1N56A 3GTGA 2IMWP 3PN1A 3RBEA 3HOWG 2FMAA 1W96A 4JI8H 5LYJF 5KG5A 1Z2NX 4YR0A 3JSNA 4O2BF 2R93G 3R5HA 3BABA 2XC9A 3TIIA 2FK1A 1DIKA 3WO0A 3HOXG 2BR0A 3PZPA 5BPFA 5D1OA 4ED0A 3T1HH 4C5BA 1FKAH 1C3OA 4C5CA 3Q8PB 3GTPA 5I47A 4APMA 4HR7A 4ED7A 2QYZA 5KG2A 2J6UA 2W70A 1KC7A 5FPRA 4O3QA 5LP6F 3G8CA 4DV7H 2JA5G 1M7JA 3UQ8A 1ZQ7A 1IBMH 4ME6A 5KG7A 1EYZA 2R8JA 1SCUB 2JA5A 2V9WA 4Y8VB 5KFWA 3WO1A 2XIGA 2R7ZA 4TQRA 2Q2TA 4HNVA 4FBTA 4LFBH 4TV9F 5KT3A 3V4SA 2FB9A 5DLGA 3MWMA 4O4HF 3JRWA 3T5LA 4MAMA 4LMYA 3L4KA 2B63A 1B6SA 2WDTA 3MR6A 4QWEA 1DZOA 2AU0A 2UUCH 5CA0F 1EUDB 4LSAA 2AGQA 3CQZA 5KFJA 1OQWA 1KJIA 4ED1A 3PVXA 3M4IA 3I12A 3V6HA 4EGJA 2W8LA 1GGOA 2CZGA 3Q1KA 5BR8H 3M9OB 4NXMH 1EZ1A 2FP4B 5KFVA 4Q8FA 2ZDHA 2YU9A 4YJ2F 2M7GA 3V4ZA 1S03G 3CVZA 4U6PA 2M3KA 1HNXH 4DR4H 3L4JA 3OUZA 3M9MB 3PO3G 2I87A 4J9SA 5KG6A 1QVEA 2NU9B 4J9QA 4GLXA 2PMZE 4DL2A 3ETHA 4EFEA 4X65H 2R8GA 4DL5A 3SI8A 3KXYT 3G6XA 4DLKA 2RGVA 4RNOA 3KHLA 5FLXW 5DLFA 2JEIA 2M05A 2WE6A 2RDIA 3SE7A 2R7NA 1GO3E 2VQEH 2F4VH 5KG1A 5CB4F 3RIZA 3J7AK 1XMQH 5LA6F 1BGWA 2R85A 1S9FA 4ECWA 2OH2A 4DV0H 4A3MG 3T5JA 3H0GA 3Q8SB 2FK3A 5DGBA 2C2EA 3MFIA 4ED3A 4YP3A 1S0OA 3R5XA 3HXLA 1XNQH 5HBRB 2XD4A 2YS6A 3QZ8A 4JV1A 3KHGA 2NVYA 1EHIA 4DR5H 2FPIB 2C2RA 1B33N 2V59A 2C22A 4ED6A 2OWOA 3GTLA 1JLLB 2IBKA 4A3JG 3IG0A 1MZBA 3K3PA 4UCOA 4QWCA 3GTKA 1Z2PX 1S10A 4A3LG 1TWAA 3TQTA 2IA6A 1BJTA 2VPQA 5EWFA 1RG0A 5F9NA 3Q2OA 5EWGA 2YYAA 2R84A 3F8NA 3OUUA 3MFHA 2W9CB 1HR0H 2HVRA 4RAZA 5L9XA 3DF7A 4IAJA 5KFIA 5KT7A 4YR2A 4JI7H 4Q8EA 3LP8A 2SCUB 4R8UB 2VUMA 1VAJA 2DLNA 3T1YH 4QIWE 1CS0A 4O3OA 4CC6A 5KT2A 1PK8A 4A2AA 3PW5A 3N41B 3VPDA 4M7EA 4X64H 1S0NA 4ECVA 2WAQA 4O3RA 4AQYH 1UNNC 2P0AA 4LF4H 4A3GG 4ED8A 4DR6H 5KFXA 4LF7H 1X6PA 2ZM6H 1N33H 4BWSC 5KX5F 2E2HA 3GQCA 4ED2A 3FKIA 5KFDA 3U9SA 1JDEA 1S0MA 1TWGA 4ECXA 1SEIA 2WTFA 2W71A 2FPGB 4R7RA 4EFBA 3Q8RB 3K3VA 3OSNA 2W7OA 3N44B 3L2PA 2ATLA 1C30A 2CQYA 3KALA 3PW7A 4DR7H 2ZDQA 2FK2A 3RGZA 5JQWA 2R8IA 3RB3A 4EBCA 1V9PA 1KJ9A 2Y0SA 4RZQA 4A3CG 2W8KA 1GSHA 1K83A 3GV7B 2DPJA 3H3VH 2BQUA 4MV9A 1SYXB 3MWDA 5BMVF 2R87A 4ECRA 1X6ZA 1HPWA 4EEQA 2FLNA 2VQDA 3N6RA 2VA2A 2R7KA 4EG0A 4JI2H 3QFFA 4JV5H 2WB1A 4F4XA 2PMZA 2C2DA 2YL2A 2XCLA 2W6MA 1HNWH 2UXCH 3K5IA 1J5EH 3TQ1A 1TWCA 4KHPH 5KFKA 3BQ0A 3K5HA 4O4IF 3QZ7A 2JA8G 3EYYA 5LXTF 5KFAA 1WH2A 4QJFA 2KEPA 4PWQA 2FJZA 4XYLB 2RF4A 2ZDGA 1X6YA 4IWYA 2I80A 3E5NA 4RB0A 3GIIA 1SFOA 1Y1VA 2ASJA 5C3EG 5KFHA 5KFQA 3I4NG 1ZHSA 5C1PA 3T5HA 3RV3A 3G20A 1RJQA 2V5AA 2ALZA 2HJWA 1GSOA 4J9NA 2BQ3A 2W57A 1V4YA 2ZJTA 3RV4A 4BY1G 5KFLA 5CAEB 3J81W 3MR5A 4B3SH 1N34H 4QWDA 4FM9A 5DG8A 5KT6A 2R92G 2UVUA 2YRWA 4V1JA 1M6VA 2W6PA 1WR2A 1B04A 3MWEA 3RJ0A 5IYBG 5L1KA 4DUYH 2AGOA 1CE8A 3FMAA 5FPOA 4IR9A 5KT4A 3GTQA 5JH7F 5BPHA 1AY2A 1JKJB 3N6XA 4UCVA 5EOYA 4RUCA 4XX0B 3N42B 1IOWA 2VUMG 1S97A 1K1SA 2DIKA 4YAKB 3JYZA 4YB8B 3HOZG 2XCPA 1JIHA 4A3DG 1BNCA 4LFCH 4X66H 4DL7A 5J2UF 2JEJA 1RYRA 2UU9H 4BBRG 2UXDH 2JA7G 3BAAA 2JA6G 4FU0A 4ZOLF 4ECSA 3LMLA 2B63G 2VA3A 4GKKH 2YS7A 3MJFA 5C4XG 4QW9A 4Q45A 3HKZE 5JW8A 1AUXA 1O75A 1L2ZA 5KFPA 2W6NA 3EPGA 2FKLA 3GIKA 3OTOH 4DL4A 1XMOH 3PR5B 3R5FA 4YAJB 4L1KA 5LOVF 1A9XA 1M0TA 5T14A 4WD3A 4MV3A 4Q44A 4Q43A 2PY0A 4ECUA 3GLKA 4IR1A 4JV2A 1EUCB 2CW8A 3H4DA 1UC8A 5IP9G 2R8HA 3I4MG 4E4TA 3GIPA 2V4QA 4NLGA 1T3NA 1N48A 4IRKA 1JX4A 2E2IA 1RJRA 3RBDA 2YRXA 3V6JA 5DGAA 1KJ8A 4LH7A 1IBLH 1VBGA 5KFFA 3BA8A 4JI0H 4QWBA 4A93G 3RGXA 5DQHA 1IOVA 3RFCA 1AN7A 4ZHQF 2ASLA 4A3IG 3R23A 5DG7A 4DR1H 2XCAA 1N36H 4A3EG 1BXRA 5FJ8G 2V58A 5DQGA 5EDWA 2R7ZG 4GKJH 4A3FG 5IP7G 2C28A 4HYKA 4YBZB 1A0IA 3H4BA 3GV8B 4JYAH 5L1IA 1XDNA 4B3RH 3BJYA 3J80W 4RNMA 2MCTA 4XYMB 4TQSA 1I94H 1I6UA 2VUGA 2V4RA 1X6XX 4EGQA 2VR1A 2I8CA 1E4EB 5A2QW 4RUAA 1TWFA 2PBZA 3RAQA 4DUZH 1RYSA 3N40P 1B6RA 3GILA 4B3MH 1TWHA 1ZETA 3AYHB 5JVDF 5KFUA 4IZOA 4UFZA 5EWEA 4C5AA 3GTJA 3H40A 1R9TA 4FS2A 2Y0SE 4TV8F 1GSAA 4J9OA 2AQ4A 2R93A 4F4WA 3LWBA 4LF9H 3GIMA 3PW0A 1DGSA 2J6SA 2YZMA 5KFOA 3FU1A 1Y1VG 3TIGA 5HV6A 3OSPA 3JRXA 5IYZF 4YHHH 5KFGA 2VQFH 2UVRA 5KFZA 4J9LA 3KTMA 1T92A 3GIDA 4G3IA 1ZHQA 4R8UA 3SOKA 2NVXA 2WYOA 4UCTA 2XGPA 2X0SA 4F50A 2HGSA 2UUAH 2DWCA 5L1LA 5J2TF 5IWAH 2XGQA 4I4TF 4BXXG 4MV7A 2E5LH 5GONF 3WNZA 5LMUH 5D8DA 4J9PA 1WSCA 4UCSA 4A3BG 4IWXA 2J6TA 3PR4A 4DV6H 2UVWA 4A3KG 2DZDA 4MA5A 4HQ6A 1HNZH 3GN9A 4I50F 3HB9A 1VS0A 1I7LA 5D1PA 5EZYF 5KT5A 5JVLA 4EBEA 4K0KH 1X6RA 3HOVG 4JV0A 4XZ3B 2JA6A 3GIJA 4IRDA 2C00A 5FLMG 3PO2G 4LF6H 4ETSA 5KFRA 1DV2A 5JUMA 1P8LA 2W7PA 2R6FA 4RAYA 2FLPA 4JI1H 1W93A 3RB0A 4LFAH 3V6KA 4X62H 4DL3A 3OHBA 2W9BA 2JA7A 3KAJA 1Y1WA 2W9CA 2WAQE 3Q8QB 4F4ZA 3PW4A 1KJJA 2QK4A 3ORQA 5IYCG 2O03A 2CKZB 4AYBE 1WCMG 2NU7B 3RTXA 3OHAA 4WBNF 4FS1A 3GTMA 4ECYA 4DV2H 2W6QA 4J9MA
chains in the Genus database with same CATH topology
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1ZQ7 A;  1WSC A; 
#chains in the Genus database with same CATH topology
 3SOJ A;  5L1J A;  1RK5 A;  4RZR A;  4DV4 H;  1S68 A;  3VMM A;  5DQI A;  4EYI B;  4F4Y A;  3HOU G;  2R7M A;  1XNR H;  4I55 F;  4JUZ A;  4DV3 H;  2R7L A;  3ETJ A;  4EYH B;  2FPP B;  4PDB A;  4IHJ F;  2PN1 A;  3G6V A;  2R86 A;  2HVQ A;  2W9B B;  2W9A A;  4IRC A;  4UCU A;  4O3N A;  3ORR A;  5KFB A;  2UXB H;  1TAE A;  2JEF A;  5KG0 A;  3HKZ A;  4O2A F;  3JZZ A;  1KBL A;  4QWA A;  3IN5 A;  1VBH A;  3BQ2 A;  5FD5 A;  2NU6 B;  4BY7 G;  1E4E A;  1UC9 A;  4YY3 H;  5KFN A;  5C1O A;  4DR2 H;  4C2M A;  2OLS A;  2W6Z A;  1I50 A;  3N43 B;  2KSW A;  4MTE A;  5KFE A;  3RAX A;  4JI5 H;  3RB4 A;  1RK6 A;  4J9R A;  2HHH H;  1DV1 A;  5KFC A;  1IBK H;  1I7N A;  1T36 A;  1I3Q A;  3HOY G;  2WB1 E;  1AUV A;  5KG3 A;  5C44 G;  5C8Y F;  3KHR A;  4YJ3 F;  2NU8 B;  4U7C A;  2FE3 A;  2JEG A;  3KHH A;  5KFY A;  2GPS A;  4M9U A;  3C0F B;  4RB2 C;  4DL6 A;  4RB1 A;  1V51 A;  4MV1 A;  4OX9 H;  2RDJ A;  1JXL A;  1M0W A;  5LL6 b;  5FD6 A;  5F9L A;  4O3P A;  5D1O B;  3N8D A;  3BQ1 A;  5LMN H;  1RJP A;  2J9G A;  2R82 A;  2C35 B;  3VPB A;  4HNT A;  4NXN H;  2AGP A;  1FVI A;  4ECQ A;  1KJQ A;  3TIN A;  1Y14 B;  4DV5 H;  2UVV A;  4DV1 H;  5K2M A;  4A2B A;  3JZI A;  5KFM A;  5DG9 A;  4AYB A;  3PW2 A;  4LW9 A;  2VPS A;  2Q2U A;  4EBD A;  4YR3 A;  5H80 A;  3M9N B;  2GLT A;  3HBL A;  4BBS G;  2IP4 A;  2FLL A;  4JI3 H;  4ZI7 F;  4LF5 H;  4QW8 A;  3NGD A;  4RU9 A;  3FKI G;  4MV4 A;  4MTD A;  2GPW A;  2CW7 A;  4CC5 A;  5KFS A;  1KEE A;  5C5J A;  2UUB H;  2VOB A;  1WCM A;  1T94 A;  4ECT A;  3JAM W;  4ECZ A;  3BG5 A;  3KAK A;  1X6Q A;  2PIL A;  3U9T A;  4LH6 A;  1K1Q A;  5IYD G;  5IT9 W;  4O3S A;  4UCR A;  1E4F T;  2R92 A;  2DPI A;  4GC7 A;  4Q0Y A;  3GV5 B;  4MV6 A;  3H0G G;  4J9K A;  4DR3 H;  1N32 H;  3JSL A;  2PVP A;  1CQI B;  3VPC A;  1OWT A;  2RGR A;  1CQJ B;  2NUA B;  3RUP A;  4RB3 C;  3GTO A;  4ZQI A;  1GLV A;  3RF2 A;  2YW2 A;  1PX2 A;  2YZN A;  4I7H A;  1Z2O X;  1X9N A;  3MR3 A;  3RB6 A;  3GIQ A;  1Y1W G;  2YZG A;  3H20 A;  4EEY A;  4JI4 H;  1GYF A;  2BQR A;  2HVS A;  4MV8 A;  5KG4 A;  3FDS A;  4GC6 A;  4HNU A;  1TA8 A;  4LF8 H;  2ASD A;  3MR2 A;  2R8K A;  4YQW A;  3UFX B;  4JI6 H;  3G6Y A;  1FJG H;  4LSX A;  4J0M A;  4FBU A;  1VKZ A;  4B3T H;  1JDB B;  5KFT A;  2YCH A;  3EPI A;  1E4G T;  2W6O A;  2HI2 A;  4TUY F;  4MA0 A;  3T5K A;  3BA9 A;  4O4L F;  4QIW A;  1ULZ A;  5CA1 F;  4RNN A;  5KKN B;  1N56 A;  3GTG A;  2IMW P;  3PN1 A;  3RBE A;  3HOW G;  2FMA A;  1W96 A;  4JI8 H;  5LYJ F;  5KG5 A;  1Z2N X;  4YR0 A;  3JSN A;  4O2B F;  2R93 G;  3R5H A;  3BAB A;  2XC9 A;  3TII A;  2FK1 A;  1DIK A;  3WO0 A;  3HOX G;  2BR0 A;  3PZP A;  5BPF A;  5D1O A;  4ED0 A;  3T1H H;  4C5B A;  1FKA H;  1C3O A;  4C5C A;  3Q8P B;  3GTP A;  5I47 A;  4APM A;  4HR7 A;  4ED7 A;  2QYZ A;  5KG2 A;  2J6U A;  2W70 A;  1KC7 A;  5FPR A;  4O3Q A;  5LP6 F;  3G8C A;  4DV7 H;  2JA5 G;  1M7J A;  3UQ8 A;  1ZQ7 A;  1IBM H;  4ME6 A;  5KG7 A;  1EYZ A;  2R8J A;  1SCU B;  2JA5 A;  2V9W A;  4Y8V B;  5KFW A;  3WO1 A;  2XIG A;  2R7Z A;  4TQR A;  2Q2T A;  4HNV A;  4FBT A;  4LFB H;  4TV9 F;  5KT3 A;  3V4S A;  2FB9 A;  5DLG A;  3MWM A;  4O4H F;  3JRW A;  3T5L A;  4MAM A;  4LMY A;  3L4K A;  2B63 A;  1B6S A;  2WDT A;  3MR6 A;  4QWE A;  1DZO A;  2AU0 A;  2UUC H;  5CA0 F;  1EUD B;  4LSA A;  2AGQ A;  3CQZ A;  5KFJ A;  1OQW A;  1KJI A;  4ED1 A;  3PVX A;  3M4I A;  3I12 A;  3V6H A;  4EGJ A;  2W8L A;  1GGO A;  2CZG A;  3Q1K A;  5BR8 H;  3M9O B;  4NXM H;  1EZ1 A;  2FP4 B;  5KFV A;  4Q8F A;  2ZDH A;  2YU9 A;  4YJ2 F;  2M7G A;  3V4Z A;  1S03 G;  3CVZ A;  4U6P A;  2M3K A;  1HNX H;  4DR4 H;  3L4J A;  3OUZ A;  3M9M B;  3PO3 G;  2I87 A;  4J9S A;  5KG6 A;  1QVE A;  2NU9 B;  4J9Q A;  4GLX A;  2PMZ E;  4DL2 A;  3ETH A;  4EFE A;  4X65 H;  2R8G A;  4DL5 A;  3SI8 A;  3KXY T;  3G6X A;  4DLK A;  2RGV A;  4RNO A;  3KHL A;  5FLX W;  5DLF A;  2JEI A;  2M05 A;  2WE6 A;  2RDI A;  3SE7 A;  2R7N A;  1GO3 E;  2VQE H;  2F4V H;  5KG1 A;  5CB4 F;  3RIZ A;  3J7A K;  1XMQ H;  5LA6 F;  1BGW A;  2R85 A;  1S9F A;  4ECW A;  2OH2 A;  4DV0 H;  4A3M G;  3T5J A;  3H0G A;  3Q8S B;  2FK3 A;  5DGB A;  2C2E A;  3MFI A;  4ED3 A;  4YP3 A;  1S0O A;  3R5X A;  3HXL A;  1XNQ H;  5HBR B;  2XD4 A;  2YS6 A;  3QZ8 A;  4JV1 A;  3KHG A;  2NVY A;  1EHI A;  4DR5 H;  2FPI B;  2C2R A;  1B33 N;  2V59 A;  2C22 A;  4ED6 A;  2OWO A;  3GTL A;  1JLL B;  2IBK A;  4A3J G;  3IG0 A;  1MZB A;  3K3P A;  4UCO A;  4QWC A;  3GTK A;  1Z2P X;  1S10 A;  4A3L G;  1TWA A;  3TQT A;  2IA6 A;  1BJT A;  2VPQ A;  5EWF A;  1RG0 A;  5F9N A;  3Q2O A;  5EWG A;  2YYA A;  2R84 A;  3F8N A;  3OUU A;  3MFH A;  2W9C B;  1HR0 H;  2HVR A;  4RAZ A;  5L9X A;  3DF7 A;  4IAJ A;  5KFI A;  5KT7 A;  4YR2 A;  4JI7 H;  4Q8E A;  3LP8 A;  2SCU B;  4R8U B;  2VUM A;  1VAJ A;  2DLN A;  3T1Y H;  4QIW E;  1CS0 A;  4O3O A;  4CC6 A;  5KT2 A;  1PK8 A;  4A2A A;  3PW5 A;  3N41 B;  3VPD A;  4M7E A;  4X64 H;  1S0N A;  4ECV A;  2WAQ A;  4O3R A;  4AQY H;  1UNN C;  2P0A A;  4LF4 H;  4A3G G;  4ED8 A;  4DR6 H;  5KFX A;  4LF7 H;  1X6P A;  2ZM6 H;  1N33 H;  4BWS C;  5KX5 F;  2E2H A;  3GQC A;  4ED2 A;  3FKI A;  5KFD A;  3U9S A;  1JDE A;  1S0M A;  1TWG A;  4ECX A;  1SEI A;  2WTF A;  2W71 A;  2FPG B;  4R7R A;  4EFB A;  3Q8R B;  3K3V A;  3OSN A;  2W7O A;  3N44 B;  3L2P A;  2ATL A;  1C30 A;  2CQY A;  3KAL A;  3PW7 A;  4DR7 H;  2ZDQ A;  2FK2 A;  3RGZ A;  5JQW A;  2R8I A;  3RB3 A;  4EBC A;  1V9P A;  1KJ9 A;  2Y0S A;  4RZQ A;  4A3C G;  2W8K A;  1GSH A;  1K83 A;  3GV7 B;  2DPJ A;  3H3V H;  2BQU A;  4MV9 A;  1SYX B;  3MWD A;  5BMV F;  2R87 A;  4ECR A;  1X6Z A;  1HPW A;  4EEQ A;  2FLN A;  2VQD A;  3N6R A;  2VA2 A;  2R7K A;  4EG0 A;  4JI2 H;  3QFF A;  4JV5 H;  2WB1 A;  4F4X A;  2PMZ A;  2C2D A;  2YL2 A;  2XCL A;  2W6M A;  1HNW H;  2UXC H;  3K5I A;  1J5E H;  3TQ1 A;  1TWC A;  4KHP H;  5KFK A;  3BQ0 A;  3K5H A;  4O4I F;  3QZ7 A;  2JA8 G;  3EYY A;  5LXT F;  5KFA A;  1WH2 A;  4QJF A;  2KEP A;  4PWQ A;  2FJZ A;  4XYL B;  2RF4 A;  2ZDG A;  1X6Y A;  4IWY A;  2I80 A;  3E5N A;  4RB0 A;  3GII A;  1SFO A;  1Y1V A;  2ASJ A;  5C3E G;  5KFH A;  5KFQ A;  3I4N G;  1ZHS A;  5C1P A;  3T5H A;  3RV3 A;  3G20 A;  1RJQ A;  2V5A A;  2ALZ A;  2HJW A;  1GSO A;  4J9N A;  2BQ3 A;  2W57 A;  1V4Y A;  2ZJT A;  3RV4 A;  4BY1 G;  5KFL A;  5CAE B;  3J81 W;  3MR5 A;  4B3S H;  1N34 H;  4QWD A;  4FM9 A;  5DG8 A;  5KT6 A;  2R92 G;  2UVU A;  2YRW A;  4V1J A;  1M6V A;  2W6P A;  1WR2 A;  1B04 A;  3MWE A;  3RJ0 A;  5IYB G;  5L1K A;  4DUY H;  2AGO A;  1CE8 A;  3FMA A;  5FPO A;  4IR9 A;  5KT4 A;  3GTQ A;  5JH7 F;  5BPH A;  1AY2 A;  1JKJ B;  3N6X A;  4UCV A;  5EOY A;  4RUC A;  4XX0 B;  3N42 B;  1IOW A;  2VUM G;  1S97 A;  1K1S A;  2DIK A;  4YAK B;  3JYZ A;  4YB8 B;  3HOZ G;  2XCP A;  1JIH A;  4A3D G;  1BNC A;  4LFC H;  4X66 H;  4DL7 A;  5J2U F;  2JEJ A;  1RYR A;  2UU9 H;  4BBR G;  2UXD H;  2JA7 G;  3BAA A;  2JA6 G;  4FU0 A;  4ZOL F;  4ECS A;  3LML A;  2B63 G;  2VA3 A;  4GKK H;  2YS7 A;  3MJF A;  5C4X G;  4QW9 A;  4Q45 A;  3HKZ E;  5JW8 A;  1AUX A;  1O75 A;  1L2Z A;  5KFP A;  2W6N A;  3EPG A;  2FKL A;  3GIK A;  3OTO H;  4DL4 A;  1XMO H;  3PR5 B;  3R5F A;  4YAJ B;  4L1K A;  5LOV F;  1A9X A;  1M0T A;  5T14 A;  4WD3 A;  4MV3 A;  4Q44 A;  4Q43 A;  2PY0 A;  4ECU A;  3GLK A;  4IR1 A;  4JV2 A;  1EUC B;  2CW8 A;  3H4D A;  1UC8 A;  5IP9 G;  2R8H A;  3I4M G;  4E4T A;  3GIP A;  2V4Q A;  4NLG A;  1T3N A;  1N48 A;  4IRK A;  1JX4 A;  2E2I A;  1RJR A;  3RBD A;  2YRX A;  3V6J A;  5DGA A;  1KJ8 A;  4LH7 A;  1IBL H;  1VBG A;  5KFF A;  3BA8 A;  4JI0 H;  4QWB A;  4A93 G;  3RGX A;  5DQH A;  1IOV A;  3RFC A;  1AN7 A;  4ZHQ F;  2ASL A;  4A3I G;  3R23 A;  5DG7 A;  4DR1 H;  2XCA A;  1N36 H;  4A3E G;  1BXR A;  5FJ8 G;  2V58 A;  5DQG A;  5EDW A;  2R7Z G;  4GKJ H;  4A3F G;  5IP7 G;  2C28 A;  4HYK A;  4YBZ B;  1A0I A;  3H4B A;  3GV8 B;  4JYA H;  5L1I A;  1XDN A;  4B3R H;  3BJY A;  3J80 W;  4RNM A;  2MCT A;  4XYM B;  4TQS A;  1I94 H;  1I6U A;  2VUG A;  2V4R A;  1X6X X;  4EGQ A;  2VR1 A;  2I8C A;  1E4E B;  5A2Q W;  4RUA A;  1TWF A;  2PBZ A;  3RAQ A;  4DUZ H;  1RYS A;  3N40 P;  1B6R A;  3GIL A;  4B3M H;  1TWH A;  1ZET A;  3AYH B;  5JVD F;  5KFU A;  4IZO A;  4UFZ A;  5EWE A;  4C5A A;  3GTJ A;  3H40 A;  1R9T A;  4FS2 A;  2Y0S E;  4TV8 F;  1GSA A;  4J9O A;  2AQ4 A;  2R93 A;  4F4W A;  3LWB A;  4LF9 H;  3GIM A;  3PW0 A;  1DGS A;  2J6S A;  2YZM A;  5KFO A;  3FU1 A;  1Y1V G;  3TIG A;  5HV6 A;  3OSP A;  3JRX A;  5IYZ F;  4YHH H;  5KFG A;  2VQF H;  2UVR A;  5KFZ A;  4J9L A;  3KTM A;  1T92 A;  3GID A;  4G3I A;  1ZHQ A;  4R8U A;  3SOK A;  2NVX A;  2WYO A;  4UCT A;  2XGP A;  2X0S A;  4F50 A;  2HGS A;  2UUA H;  2DWC A;  5L1L A;  5J2T F;  5IWA H;  2XGQ A;  4I4T F;  4BXX G;  4MV7 A;  2E5L H;  5GON F;  3WNZ A;  5LMU H;  5D8D A;  4J9P A;  1WSC A;  4UCS A;  4A3B G;  4IWX A;  2J6T A;  3PR4 A;  4DV6 H;  2UVW A;  4A3K G;  2DZD A;  4MA5 A;  4HQ6 A;  1HNZ H;  3GN9 A;  4I50 F;  3HB9 A;  1VS0 A;  1I7L A;  5D1P A;  5EZY F;  5KT5 A;  5JVL A;  4EBE A;  4K0K H;  1X6R A;  3HOV G;  4JV0 A;  4XZ3 B;  2JA6 A;  3GIJ A;  4IRD A;  2C00 A;  5FLM G;  3PO2 G;  4LF6 H;  4ETS A;  5KFR A;  1DV2 A;  5JUM A;  1P8L A;  2W7P A;  2R6F A;  4RAY A;  2FLP A;  4JI1 H;  1W93 A;  3RB0 A;  4LFA H;  3V6K A;  4X62 H;  4DL3 A;  3OHB A;  2W9B A;  2JA7 A;  3KAJ A;  1Y1W A;  2W9C A;  2WAQ E;  3Q8Q B;  4F4Z A;  3PW4 A;  1KJJ A;  2QK4 A;  3ORQ A;  5IYC G;  2O03 A;  2CKZ B;  4AYB E;  1WCM G;  2NU7 B;  3RTX A;  3OHA A;  4WBN F;  4FS1 A;  3GTM A;  4ECY A;  4DV2 H;  2W6Q A;  4J9M A; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1ZQ7 A;  1WSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...