1VAJA

Crystal structure of uncharacterized protein ph0010 from pyrococcus horikoshii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
203
structure length
203
Chain Sequence
FKIKDEWGEFLVRLARRAIEEYLKTGKEIEPPKDTPPELWEKMGVFVTLNRYNVPPQTALRGCIGFPTPIYPLVEATIKAAIYSAVDDPRFPPVKLEEMDNLVVEVSVLTPPELIEGPPEERPRKIKVGRDGLIVEKGIYSGLLLPQVPVEWGWDEEEFLAETCWKAGLPPDCWLDEDTKVYKFTAEIFEEEYPRGPIKRKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0010
publication title Crystal structure of PH0010 from Pyrococcus horikoshii, which is highly homologous to human AMMECR 1C-terminal region
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 58
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1vajA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1vajA02
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH superfamily
4AYBA 3PW0A 3Q8RB 2UUCH 5KG3A 2W57A 3PW7A 4DR6H 2C00A 4JI3H 1VAJA 2W9BB 3PR5B 3RV4A 2R7NA 2R8JA 2HGSA 1N32H 4IAJA 1EYZA 1S0MA 2W70A 4JV0A 3PZPA 2R84A 2V5AA 2IBKA 1GYFA 5DLFA 2R82A 3OHAA 3HOUG 4U7CA 2QK4A 2RDIA 3IG0A 3ORRA 4ZHQF 4J9MA 1Y14B 4ECQA 3G6XA 2JEFA 5IT9W 1VS0A 3J81W 4J9LA 4EBCA 4ECXA 4J9OA 3OHBA 4EYHB 5J2UF 3L4KA 4TV8F 2DZDA 3U9SA 2PBZA 1UNNC 4DV4H 4IRDA 5KFTA 5KFMA 5KT5A 3Q2OA 2Y0SE 5KFVA 4DV1H 3JYZA 4UCUA 3EYYA 1T3NA 1JDEA 5KFPA 3N43B 2AGPA 5C5JA 5DG8A 1FJGH 5DQHA 1S68A 5KG7A 1XNQH 2YZMA 4EYIB 4X62H 2PMZA 2IMWP 3TIGA 5CAEB 3OUZA 2VPQA 2XCPA 4ECRA 2FPPB 4Q45A 1X6QA 4DL3A 4K0KH 1KJJA 4Q8FA 3PO2G 1TWGA 2DLNA 3V4ZA 4J9NA 5EWEA 2DPJA 1CQJB 1UC9A 5IP9G 4FM9A 4A3BG 2M05A 2UVUA 4HNVA 3RGXA 5EWGA 2YZGA 2PVPA 2NUAB 4QWDA 4YB8B 4WBNF 3Q1KA 2YRWA 2FK3A 3QFFA 5KFDA 4B3TH 3RJ0A 4U6PA 1C30A 2HHHH 4JI1H 3OUUA 2VR1A 2YS7A 4BBSG 1DV2A 4LF4H 1HPWA 3JRXA 4RB2C 3QZ7A 5JVDF 5L1KA 1TWHA 1N36H 3OSPA 3VPCA 3U9TA 2PN1A 4I4TF 3R23A 2JEGA 2FPGB 3VPBA 3K3PA 2R93G 4J9QA 3FDSA 4MAMA 4MA5A 3LWBA 4L1KA 2VA2A 1BJTA 4MV6A 4O3QA 1HNXH 1N48A 2JA8G 4BY7G 2NVXA 3V6KA 5L9XA 2KEPA 3KXYT 5KFHA 5LMUH 5KT4A 4TQRA 4A3JG 4YR0A 1FKAH 2R7ZG 3RV3A 3V4SA 2JA5G 2QYZA 1T94A 4I7HA 1EHIA 5EZYF 3KHHA 2AQ4A 1V51A 3G6YA 3RFCA 3H3VH 1RJPA 3H20A 4ECWA 1Y1VA 3G8CA 2GPSA 4MV8A 2XC9A 3BQ1A 2GPWA 4QJFA 4ECZA 2FK1A 2AGQA 2R93A 5LMNH 4JV2A 4J0MA 2Y0SA 1WSCA 1VKZA 5KG6A 5L1JA 4DV3H 1S97A 5LL6b 5KT3A 4DR7H 1JIHA 2NU7B 3C0FB 5F9LA 4BXXG 3BQ2A 2XCLA 1T92A 4GKKH 2JA5A 4A3IG 5BMVF 3MJFA 5KFOA 3RAQA 1Z2OX 4PDBA 4IZOA 3TINA 4MV7A 4A3MG 5KFIA 3MR5A 3RAXA 3GTGA 1A0IA 1XDNA 2O03A 5DGAA 2V58A 1B6SA 5C4XG 3FMAA 2E5LH 5IYZF 2YW2A 4UCVA 4FBUA 2R87A 4ED8A 4MV9A 4JI6H 2AU0A 4JI8H 4LF9H 3KAKA 4QWAA 2XCAA 4B3MH 1B6RA 5FPOA 2BQUA 1RG0A 1OQWA 1B04A 4MV1A 4R8UA 5KFZA 3HB9A 1KC7A 5KFSA 2XGQA 4J9KA 3RB0A 2C2EA 2R92A 1KJIA 3ETJA 5F9NA 4RUAA 3H0GG 4IWXA 5K2MA 2V4RA 3BJYA 5KT7A 2JA6G 5JQWA 3GTPA 4FS2A 3RTXA 1TA8A 2WAQE 3RUPA 3GN9A 4LW9A 4DL5A 2UVVA 2W7PA 1TWAA 3H40A 2R86A 3WO0A 4DLKA 5LA6F 2ZDGA 4KHPH 5KG0A 4BBRG 3VPDA 5L1IA 4HYKA 1S0OA 4A3DG 1I6UA 4DV0H 5IYCG 2C35B 1KJQA 2PY0A 3GTMA 1T36A 2W6OA 3M9OB 3SI8A 3N41B 5JW8A 3H0GA 2ZM6H 4AQYH 4IHJF 3GIPA 2JA6A 2HVQA 2WYOA 1RYRA 2FPIB 1W96A 4XYLB 5EOYA 2CKZB 1RJRA 3OSNA 1Y1WG 1RYSA 4QWEA 4QIWA 4QW8A 5KG1A 4Q44A 3LMLA 4UCSA 2R6FA 3RGZA 5C3EG 5C44G 3TQTA 4EBEA 1DGSA 1DV1A 3NGDA 2R8KA 4B3RH 4DR5H 3T5HA 1GSOA 3PO3G 3J80W 5CA1F 1AN7A 5DG7A 2ASLA 1E4FT 1TAEA 2XD4A 2W9BA 3K5HA 3E5NA 3BABA 1Y1WA 5EWFA 1J5EH 3KHGA 5D1OB 2VUMG 2V9WA 1MZBA 2YS6A 3JSLA 1DIKA 5KFNA 1O75A 2W8KA 1I94H 4XX0B 1K1QA 4ZOLF 4EGQA 4NLGA 3N6RA 2CW7A 1AUXA 4UCOA 2FMAA 3RBDA 4DUZH 2HJWA 2UXBH 4HQ6A 5LYJF 5D1OA 3SOKA 4LH6A 5KFQA 3SOJA 2W6NA 3GIKA 1KJ8A 1BGWA 4ZI7F 2FKLA 2CQYA 3M9NB 1P8LA 2MCTA 4IR9A 1E4GT 1AUVA 5FPRA 2YZNA 2ASDA 3ETHA 5KFGA 4J9SA 5FD6A 4A3EG 4DUYH 4YJ2F 3T5KA 1W93A 4DV6H 4Q8EA 1Z2PX 4O4HF 3R5XA 3Q8QB 5KFCA 4BY1G 5FJ8G 2NVYA 4DR3H 2BQRA 2UXCH 3LP8A 5HV6A 1WH2A 4X65H 4GKJH 1CE8A 2R8GA 4FBTA 2IA6A 1ZQ7A 1CS0A 4RU9A 1EUDB 1GSHA 4ED3A 2VQDA 4IRCA 4APMA 3UQ8A 1KJ9A 2OLSA 2FE3A 4EFBA 2UVRA 4CC5A 3KAJA 4ZQIA 2C22A 4I55F 4JYAH 4HNTA 4RB3C 1HNWH 1UC8A 3BQ0A 2R8IA 4TUYF 3PW2A 2WDTA 3F8NA 4RAYA 1R9TA 3HOVG 5C1PA 3PW4A 1XNRH 1VBHA 1BXRA 4XYMB 3G6VA 5L1LA 4O3SA 3HOWG 4LF6H 5IYDG 2FK2A 3T1HH 1XMOH 4ED1A 4I50F 4E4TA 5BR8H 1X6YA 2R85A 4LMYA 3V6HA 2R7ZA 5DQIA 4UCTA 1IOVA 1OWTA 1JDBB 3Q8SB 4EBDA 3T1YH 2NU9B 4JI5H 2FB9A 3KALA 3PR4A 4J9PA 4F4WA 3KHLA 1EZ1A 4IR1A 4DV7H 1A9XA 4TV9F 3SE7A 2M7GA 2B63G 4HR7A 2UVWA 5LOVF 3BA8A 4A3KG 2UUBH 1PK8A 2W6ZA 3G20A 2W71A 4YR2A 2W9CB 4FS1A 2WE6A 3HBLA 5IYBG 3L2PA 5DQGA 3PW5A 2CZGA 4RZQA 1ZHSA 3N8DA 2YRXA 4X64H 3OTOH 2I80A 4GC6A 4A2BA 3ORQA 4A3FG 2W9AA 3BA9A 3HOXG 3GV5B 4ED7A 1VBGA 4JI7H 4LF8H 1GSAA 1IBLH 2ATLA 5CB4F 3RB4A 2BQ3A 1KBLA 3I4MG 1KEEA 4A93G 3RF2A 4DL6A 1GO3E 4RNMA 2J9GA 3JSNA 3RB3A 4M7EA 4QWCA 4F4YA 4LF7H 1BNCA 1RK6A 2M3KA 4JI0H 4O3RA 2I8CA 4MTEA 3Q8PB 4J9RA 4O2AF 2F4VH 5D1PA 3TIIA 3N44B 3J7AK 4YBZB 4A3GG 3T5JA 2ALZA 3MR6A 4DL4A 5LP6F 2UUAH 1S03G 3JZIA 4YR3A 5FLMG 3FKIG 5KX5F 3M4IA 2ASJA 4ECSA 1IOWA 2JA7G 5KFFA 3MFHA 2W6QA 4X66H 1DZOA 4M9UA 3GV7B 2Q2TA 5J2TF 1S9FA 3JAMW 1HR0H 4QWBA 3CVZA 1V9PA 4Q0YA 5D8DA 3RBEA 1S0NA 2FLNA 3KHRA 4B3SH 3BG5A 2WB1E 5KFRA 2HVSA 3TQ1A 4LF5H 5KFYA 2BR0A 1M0TA 4EFEA 4DR1H 1RK5A 3FKIA 1N34H 4EEQA 4ED2A 4MV3A 5IP7G 3CQZA 4ECTA 1V4YA 2C2RA 1WR2A 2JA7A 5FD5A 5C8YF 5EDWA 1JX4A 1M6VA 4R7RA 2VQFH 5C1OA 2I87A 3UFXB 3H4DA 4A3CG 2W6MA 4C2MA 3I4NG 1WCMG 2FP4B 2ZDQA 5HBRB 3WO1A 5FLXW 3MR2A 1QVEA 3K3VA 5DGBA 4WD3A 4C5BA 2V59A 4F4XA 3MFIA 1X6XX 4ECYA 3HXLA 4UFZA 2NU8B 2R7LA 5KFUA 4EG0A 5KFKA 2WAQA 4ED0A 1SYXB 3PVXA 3GTKA 2VUMA 2Q2UA 5T14A 2W8LA 5KT2A 4LSAA 4YJ3F 3GILA 3T5LA 5DLGA 4NXNH 3EPIA 1RJQA 1ZHQA 2ZJTA 5A2QW 4V1JA 1N33H 2YCHA 4RB0A 3MR3A 4YP3A 4LFCH 4Q43A 4JV5H 1K1SA 1WCMA 1ULZA 4GC7A 1CQIB 3JZZA 3R5HA 2FLPA 4RAZA 2W7OA 2C28A 5KFLA 4ECVA 3HOYG 3R5FA 4DV2H 4Y8VB 1K83A 4O2BF 1S10A 3KTMA 4BWSC 3HKZE 2JEIA 5JVLA 4YAKB 2X0SA 4MV4A 5KT6A 2OWOA 1I50A 4MTDA 4RZRA 1X6PA 4O3OA 2DWCA 2FJZA 3GLKA 4ME6A 2W6PA 4O4IF 1I7LA 4YAJB 3L4JA 3EPGA 4DL7A 2VOBA 2CW8A 4G3IA 1M7JA 5KFJA 3K5IA 3N42B 5DG9A 4DR4H 4LFBH 1SFOA 5BPHA 2WB1A 5JUMA 2E2HA 2XIGA 4FU0A 4ETSA 4EGJA 1Y1VG 3HOZG 3VMMA 4JUZA 1SCUB 4C5AA 4RUCA 3BAAA 4A2AA 3AYHB 1PX2A 4JI4H 1X6RA 2R7KA 2R7MA 1L2ZA 2YL2A 4IWYA 3WNZA 1GGOA 3GIIA 3H4BA 3GIMA 1SEIA 2ZDHA 4YY3H 1IBKH 5H80A 4CC6A 1JLLB 2DIKA 4JI2H 4AYBE 4F4ZA 5GONF 1X9NA 1AY2A 2UXDH 2DPIA 2VUGA 1XMQH 4DR2H 4DL2A 5I47A 3JRWA 3PN1A 1N56A 4RB1A 4QIWE 4F50A 2JEJA 3GQCA 2UU9H 3IN5A 4EEYA 4RNNA 3N6XA 2R8HA 2E2IA 3QZ8A 2PILA 4JV1A 3MWMA 2GLTA 1I7NA 3FU1A 4YHHH 2XGPA 4ED6A 5LXTF 4QW9A 4O3PA 4GLXA 2RF4A 4XZ3B 2NU6B 2R92G 3N40P 5CA0F 2W9CA 1X6ZA 4YQWA 2B63A 1JKJB 4R8UB 2RGRA 4O3NA 5KFAA 4HNUA 2J6TA 2YU9A 4C5CA 4MA0A 3GIDA 2WTFA 2J6UA 4LFAH 1EUCB 4PWQA 3I12A 1ZETA 2YYAA 1JXLA 3HKZA 4A3LG 3GIJA 2P0AA 4TQSA 2FLLA 2OH2A 5KG5A 5KFWA 1M0WA 1E4EB 1FVIA 2AGOA 1TWCA 1IBMH 2PMZE 2J6SA 2VA3A 3GTOA 4LSXA 1C3OA 1B33N 5KG2A 3DF7A 4IRKA 2HVRA 2SCUB 4DV5H 3GV8B 2KSWA 3RB6A 5KG4A 2VPSA 3MWEA 4UCRA 2RGVA 1HNZH 5KFBA 4OX9H 1TWFA 2VQEH 2IP4A 1Z2NX 3M9MB 4NXMH 4ECUA 3GTLA 1E4EA 3MWDA 3RIZA 5BPFA 5KFEA 2V4QA 5IWAH 3GTJA 2C2DA 5KKNB 5KFXA 3V6JA 3GIQA 4RNOA 2RDJA 4LH7A 2HI2A 1GLVA 1I3QA 3GTQA 4O4LF 5JH7F
chains in the Genus database with same CATH topology
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1WSC A;  1ZQ7 A; 
#chains in the Genus database with same CATH topology
 4AYB A;  3PW0 A;  3Q8R B;  2UUC H;  5KG3 A;  2W57 A;  3PW7 A;  4DR6 H;  2C00 A;  4JI3 H;  1VAJ A;  2W9B B;  3PR5 B;  3RV4 A;  2R7N A;  2R8J A;  2HGS A;  1N32 H;  4IAJ A;  1EYZ A;  1S0M A;  2W70 A;  4JV0 A;  3PZP A;  2R84 A;  2V5A A;  2IBK A;  1GYF A;  5DLF A;  2R82 A;  3OHA A;  3HOU G;  4U7C A;  2QK4 A;  2RDI A;  3IG0 A;  3ORR A;  4ZHQ F;  4J9M A;  1Y14 B;  4ECQ A;  3G6X A;  2JEF A;  5IT9 W;  1VS0 A;  3J81 W;  4J9L A;  4EBC A;  4ECX A;  4J9O A;  3OHB A;  4EYH B;  5J2U F;  3L4K A;  4TV8 F;  2DZD A;  3U9S A;  2PBZ A;  1UNN C;  4DV4 H;  4IRD A;  5KFT A;  5KFM A;  5KT5 A;  3Q2O A;  2Y0S E;  5KFV A;  4DV1 H;  3JYZ A;  4UCU A;  3EYY A;  1T3N A;  1JDE A;  5KFP A;  3N43 B;  2AGP A;  5C5J A;  5DG8 A;  1FJG H;  5DQH A;  1S68 A;  5KG7 A;  1XNQ H;  2YZM A;  4EYI B;  4X62 H;  2PMZ A;  2IMW P;  3TIG A;  5CAE B;  3OUZ A;  2VPQ A;  2XCP A;  4ECR A;  2FPP B;  4Q45 A;  1X6Q A;  4DL3 A;  4K0K H;  1KJJ A;  4Q8F A;  3PO2 G;  1TWG A;  2DLN A;  3V4Z A;  4J9N A;  5EWE A;  2DPJ A;  1CQJ B;  1UC9 A;  5IP9 G;  4FM9 A;  4A3B G;  2M05 A;  2UVU A;  4HNV A;  3RGX A;  5EWG A;  2YZG A;  2PVP A;  2NUA B;  4QWD A;  4YB8 B;  4WBN F;  3Q1K A;  2YRW A;  2FK3 A;  3QFF A;  5KFD A;  4B3T H;  3RJ0 A;  4U6P A;  1C30 A;  2HHH H;  4JI1 H;  3OUU A;  2VR1 A;  2YS7 A;  4BBS G;  1DV2 A;  4LF4 H;  1HPW A;  3JRX A;  4RB2 C;  3QZ7 A;  5JVD F;  5L1K A;  1TWH A;  1N36 H;  3OSP A;  3VPC A;  3U9T A;  2PN1 A;  4I4T F;  3R23 A;  2JEG A;  2FPG B;  3VPB A;  3K3P A;  2R93 G;  4J9Q A;  3FDS A;  4MAM A;  4MA5 A;  3LWB A;  4L1K A;  2VA2 A;  1BJT A;  4MV6 A;  4O3Q A;  1HNX H;  1N48 A;  2JA8 G;  4BY7 G;  2NVX A;  3V6K A;  5L9X A;  2KEP A;  3KXY T;  5KFH A;  5LMU H;  5KT4 A;  4TQR A;  4A3J G;  4YR0 A;  1FKA H;  2R7Z G;  3RV3 A;  3V4S A;  2JA5 G;  2QYZ A;  1T94 A;  4I7H A;  1EHI A;  5EZY F;  3KHH A;  2AQ4 A;  1V51 A;  3G6Y A;  3RFC A;  3H3V H;  1RJP A;  3H20 A;  4ECW A;  1Y1V A;  3G8C A;  2GPS A;  4MV8 A;  2XC9 A;  3BQ1 A;  2GPW A;  4QJF A;  4ECZ A;  2FK1 A;  2AGQ A;  2R93 A;  5LMN H;  4JV2 A;  4J0M A;  2Y0S A;  1WSC A;  1VKZ A;  5KG6 A;  5L1J A;  4DV3 H;  1S97 A;  5LL6 b;  5KT3 A;  4DR7 H;  1JIH A;  2NU7 B;  3C0F B;  5F9L A;  4BXX G;  3BQ2 A;  2XCL A;  1T92 A;  4GKK H;  2JA5 A;  4A3I G;  5BMV F;  3MJF A;  5KFO A;  3RAQ A;  1Z2O X;  4PDB A;  4IZO A;  3TIN A;  4MV7 A;  4A3M G;  5KFI A;  3MR5 A;  3RAX A;  3GTG A;  1A0I A;  1XDN A;  2O03 A;  5DGA A;  2V58 A;  1B6S A;  5C4X G;  3FMA A;  2E5L H;  5IYZ F;  2YW2 A;  4UCV A;  4FBU A;  2R87 A;  4ED8 A;  4MV9 A;  4JI6 H;  2AU0 A;  4JI8 H;  4LF9 H;  3KAK A;  4QWA A;  2XCA A;  4B3M H;  1B6R A;  5FPO A;  2BQU A;  1RG0 A;  1OQW A;  1B04 A;  4MV1 A;  4R8U A;  5KFZ A;  3HB9 A;  1KC7 A;  5KFS A;  2XGQ A;  4J9K A;  3RB0 A;  2C2E A;  2R92 A;  1KJI A;  3ETJ A;  5F9N A;  4RUA A;  3H0G G;  4IWX A;  5K2M A;  2V4R A;  3BJY A;  5KT7 A;  2JA6 G;  5JQW A;  3GTP A;  4FS2 A;  3RTX A;  1TA8 A;  2WAQ E;  3RUP A;  3GN9 A;  4LW9 A;  4DL5 A;  2UVV A;  2W7P A;  1TWA A;  3H40 A;  2R86 A;  3WO0 A;  4DLK A;  5LA6 F;  2ZDG A;  4KHP H;  5KG0 A;  4BBR G;  3VPD A;  5L1I A;  4HYK A;  1S0O A;  4A3D G;  1I6U A;  4DV0 H;  5IYC G;  2C35 B;  1KJQ A;  2PY0 A;  3GTM A;  1T36 A;  2W6O A;  3M9O B;  3SI8 A;  3N41 B;  5JW8 A;  3H0G A;  2ZM6 H;  4AQY H;  4IHJ F;  3GIP A;  2JA6 A;  2HVQ A;  2WYO A;  1RYR A;  2FPI B;  1W96 A;  4XYL B;  5EOY A;  2CKZ B;  1RJR A;  3OSN A;  1Y1W G;  1RYS A;  4QWE A;  4QIW A;  4QW8 A;  5KG1 A;  4Q44 A;  3LML A;  4UCS A;  2R6F A;  3RGZ A;  5C3E G;  5C44 G;  3TQT A;  4EBE A;  1DGS A;  1DV1 A;  3NGD A;  2R8K A;  4B3R H;  4DR5 H;  3T5H A;  1GSO A;  3PO3 G;  3J80 W;  5CA1 F;  1AN7 A;  5DG7 A;  2ASL A;  1E4F T;  1TAE A;  2XD4 A;  2W9B A;  3K5H A;  3E5N A;  3BAB A;  1Y1W A;  5EWF A;  1J5E H;  3KHG A;  5D1O B;  2VUM G;  2V9W A;  1MZB A;  2YS6 A;  3JSL A;  1DIK A;  5KFN A;  1O75 A;  2W8K A;  1I94 H;  4XX0 B;  1K1Q A;  4ZOL F;  4EGQ A;  4NLG A;  3N6R A;  2CW7 A;  1AUX A;  4UCO A;  2FMA A;  3RBD A;  4DUZ H;  2HJW A;  2UXB H;  4HQ6 A;  5LYJ F;  5D1O A;  3SOK A;  4LH6 A;  5KFQ A;  3SOJ A;  2W6N A;  3GIK A;  1KJ8 A;  1BGW A;  4ZI7 F;  2FKL A;  2CQY A;  3M9N B;  1P8L A;  2MCT A;  4IR9 A;  1E4G T;  1AUV A;  5FPR A;  2YZN A;  2ASD A;  3ETH A;  5KFG A;  4J9S A;  5FD6 A;  4A3E G;  4DUY H;  4YJ2 F;  3T5K A;  1W93 A;  4DV6 H;  4Q8E A;  1Z2P X;  4O4H F;  3R5X A;  3Q8Q B;  5KFC A;  4BY1 G;  5FJ8 G;  2NVY A;  4DR3 H;  2BQR A;  2UXC H;  3LP8 A;  5HV6 A;  1WH2 A;  4X65 H;  4GKJ H;  1CE8 A;  2R8G A;  4FBT A;  2IA6 A;  1ZQ7 A;  1CS0 A;  4RU9 A;  1EUD B;  1GSH A;  4ED3 A;  2VQD A;  4IRC A;  4APM A;  3UQ8 A;  1KJ9 A;  2OLS A;  2FE3 A;  4EFB A;  2UVR A;  4CC5 A;  3KAJ A;  4ZQI A;  2C22 A;  4I55 F;  4JYA H;  4HNT A;  4RB3 C;  1HNW H;  1UC8 A;  3BQ0 A;  2R8I A;  4TUY F;  3PW2 A;  2WDT A;  3F8N A;  4RAY A;  1R9T A;  3HOV G;  5C1P A;  3PW4 A;  1XNR H;  1VBH A;  1BXR A;  4XYM B;  3G6V A;  5L1L A;  4O3S A;  3HOW G;  4LF6 H;  5IYD G;  2FK2 A;  3T1H H;  1XMO H;  4ED1 A;  4I50 F;  4E4T A;  5BR8 H;  1X6Y A;  2R85 A;  4LMY A;  3V6H A;  2R7Z A;  5DQI A;  4UCT A;  1IOV A;  1OWT A;  1JDB B;  3Q8S B;  4EBD A;  3T1Y H;  2NU9 B;  4JI5 H;  2FB9 A;  3KAL A;  3PR4 A;  4J9P A;  4F4W A;  3KHL A;  1EZ1 A;  4IR1 A;  4DV7 H;  1A9X A;  4TV9 F;  3SE7 A;  2M7G A;  2B63 G;  4HR7 A;  2UVW A;  5LOV F;  3BA8 A;  4A3K G;  2UUB H;  1PK8 A;  2W6Z A;  3G20 A;  2W71 A;  4YR2 A;  2W9C B;  4FS1 A;  2WE6 A;  3HBL A;  5IYB G;  3L2P A;  5DQG A;  3PW5 A;  2CZG A;  4RZQ A;  1ZHS A;  3N8D A;  2YRX A;  4X64 H;  3OTO H;  2I80 A;  4GC6 A;  4A2B A;  3ORQ A;  4A3F G;  2W9A A;  3BA9 A;  3HOX G;  3GV5 B;  4ED7 A;  1VBG A;  4JI7 H;  4LF8 H;  1GSA A;  1IBL H;  2ATL A;  5CB4 F;  3RB4 A;  2BQ3 A;  1KBL A;  3I4M G;  1KEE A;  4A93 G;  3RF2 A;  4DL6 A;  1GO3 E;  4RNM A;  2J9G A;  3JSN A;  3RB3 A;  4M7E A;  4QWC A;  4F4Y A;  4LF7 H;  1BNC A;  1RK6 A;  2M3K A;  4JI0 H;  4O3R A;  2I8C A;  4MTE A;  3Q8P B;  4J9R A;  4O2A F;  2F4V H;  5D1P A;  3TII A;  3N44 B;  3J7A K;  4YBZ B;  4A3G G;  3T5J A;  2ALZ A;  3MR6 A;  4DL4 A;  5LP6 F;  2UUA H;  1S03 G;  3JZI A;  4YR3 A;  5FLM G;  3FKI G;  5KX5 F;  3M4I A;  2ASJ A;  4ECS A;  1IOW A;  2JA7 G;  5KFF A;  3MFH A;  2W6Q A;  4X66 H;  1DZO A;  4M9U A;  3GV7 B;  2Q2T A;  5J2T F;  1S9F A;  3JAM W;  1HR0 H;  4QWB A;  3CVZ A;  1V9P A;  4Q0Y A;  5D8D A;  3RBE A;  1S0N A;  2FLN A;  3KHR A;  4B3S H;  3BG5 A;  2WB1 E;  5KFR A;  2HVS A;  3TQ1 A;  4LF5 H;  5KFY A;  2BR0 A;  1M0T A;  4EFE A;  4DR1 H;  1RK5 A;  3FKI A;  1N34 H;  4EEQ A;  4ED2 A;  4MV3 A;  5IP7 G;  3CQZ A;  4ECT A;  1V4Y A;  2C2R A;  1WR2 A;  2JA7 A;  5FD5 A;  5C8Y F;  5EDW A;  1JX4 A;  1M6V A;  4R7R A;  2VQF H;  5C1O A;  2I87 A;  3UFX B;  3H4D A;  4A3C G;  2W6M A;  4C2M A;  3I4N G;  1WCM G;  2FP4 B;  2ZDQ A;  5HBR B;  3WO1 A;  5FLX W;  3MR2 A;  1QVE A;  3K3V A;  5DGB A;  4WD3 A;  4C5B A;  2V59 A;  4F4X A;  3MFI A;  1X6X X;  4ECY A;  3HXL A;  4UFZ A;  2NU8 B;  2R7L A;  5KFU A;  4EG0 A;  5KFK A;  2WAQ A;  4ED0 A;  1SYX B;  3PVX A;  3GTK A;  2VUM A;  2Q2U A;  5T14 A;  2W8L A;  5KT2 A;  4LSA A;  4YJ3 F;  3GIL A;  3T5L A;  5DLG A;  4NXN H;  3EPI A;  1RJQ A;  1ZHQ A;  2ZJT A;  5A2Q W;  4V1J A;  1N33 H;  2YCH A;  4RB0 A;  3MR3 A;  4YP3 A;  4LFC H;  4Q43 A;  4JV5 H;  1K1S A;  1WCM A;  1ULZ A;  4GC7 A;  1CQI B;  3JZZ A;  3R5H A;  2FLP A;  4RAZ A;  2W7O A;  2C28 A;  5KFL A;  4ECV A;  3HOY G;  3R5F A;  4DV2 H;  4Y8V B;  1K83 A;  4O2B F;  1S10 A;  3KTM A;  4BWS C;  3HKZ E;  2JEI A;  5JVL A;  4YAK B;  2X0S A;  4MV4 A;  5KT6 A;  2OWO A;  1I50 A;  4MTD A;  4RZR A;  1X6P A;  4O3O A;  2DWC A;  2FJZ A;  3GLK A;  4ME6 A;  2W6P A;  4O4I F;  1I7L A;  4YAJ B;  3L4J A;  3EPG A;  4DL7 A;  2VOB A;  2CW8 A;  4G3I A;  1M7J A;  5KFJ A;  3K5I A;  3N42 B;  5DG9 A;  4DR4 H;  4LFB H;  1SFO A;  5BPH A;  2WB1 A;  5JUM A;  2E2H A;  2XIG A;  4FU0 A;  4ETS A;  4EGJ A;  1Y1V G;  3HOZ G;  3VMM A;  4JUZ A;  1SCU B;  4C5A A;  4RUC A;  3BAA A;  4A2A A;  3AYH B;  1PX2 A;  4JI4 H;  1X6R A;  2R7K A;  2R7M A;  1L2Z A;  2YL2 A;  4IWY A;  3WNZ A;  1GGO A;  3GII A;  3H4B A;  3GIM A;  1SEI A;  2ZDH A;  4YY3 H;  1IBK H;  5H80 A;  4CC6 A;  1JLL B;  2DIK A;  4JI2 H;  4AYB E;  4F4Z A;  5GON F;  1X9N A;  1AY2 A;  2UXD H;  2DPI A;  2VUG A;  1XMQ H;  4DR2 H;  4DL2 A;  5I47 A;  3JRW A;  3PN1 A;  1N56 A;  4RB1 A;  4QIW E;  4F50 A;  2JEJ A;  3GQC A;  2UU9 H;  3IN5 A;  4EEY A;  4RNN A;  3N6X A;  2R8H A;  2E2I A;  3QZ8 A;  2PIL A;  4JV1 A;  3MWM A;  2GLT A;  1I7N A;  3FU1 A;  4YHH H;  2XGP A;  4ED6 A;  5LXT F;  4QW9 A;  4O3P A;  4GLX A;  2RF4 A;  4XZ3 B;  2NU6 B;  2R92 G;  3N40 P;  5CA0 F;  2W9C A;  1X6Z A;  4YQW A;  2B63 A;  1JKJ B;  4R8U B;  2RGR A;  4O3N A;  5KFA A;  4HNU A;  2J6T A;  2YU9 A;  4C5C A;  4MA0 A;  3GID A;  2WTF A;  2J6U A;  4LFA H;  1EUC B;  4PWQ A;  3I12 A;  1ZET A;  2YYA A;  1JXL A;  3HKZ A;  4A3L G;  3GIJ A;  2P0A A;  4TQS A;  2FLL A;  2OH2 A;  5KG5 A;  5KFW A;  1M0W A;  1E4E B;  1FVI A;  2AGO A;  1TWC A;  1IBM H;  2PMZ E;  2J6S A;  2VA3 A;  3GTO A;  4LSX A;  1C3O A;  1B33 N;  5KG2 A;  3DF7 A;  4IRK A;  2HVR A;  2SCU B;  4DV5 H;  3GV8 B;  2KSW A;  3RB6 A;  5KG4 A;  2VPS A;  3MWE A;  4UCR A;  2RGV A;  1HNZ H;  5KFB A;  4OX9 H;  1TWF A;  2VQE H;  2IP4 A;  1Z2N X;  3M9M B;  4NXM H;  4ECU A;  3GTL A;  1E4E A;  3MWD A;  3RIZ A;  5BPF A;  5KFE A;  2V4Q A;  5IWA H;  3GTJ A;  2C2D A;  5KKN B;  5KFX A;  3V6J A;  3GIQ A;  4RNO A;  2RDJ A;  4LH7 A;  2HI2 A;  1GLV A;  1I3Q A;  3GTQ A;  4O4L F;  5JH7 F; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1WSC A;  1ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...