1VAJA

Crystal structure of uncharacterized protein ph0010 from pyrococcus horikoshii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
203
structure length
203
Chain Sequence
FKIKDEWGEFLVRLARRAIEEYLKTGKEIEPPKDTPPELWEKMGVFVTLNRYNVPPQTALRGCIGFPTPIYPLVEATIKAAIYSAVDDPRFPPVKLEEMDNLVVEVSVLTPPELIEGPPEERPRKIKVGRDGLIVEKGIYSGLLLPQVPVEWGWDEEEFLAETCWKAGLPPDCWLDEDTKVYKFTAEIFEEEYPRGPIKRKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0010 from Pyrococcus horikoshii, which is highly homologous to human AMMECR 1C-terminal region
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0010
total genus 58
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1vajA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1vajA02
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH superfamily
1RJPA 1A0IA 4J0MA 5BPHA 3R5XA 1JDBB 1PX2A 2FLPA 4IRKA 5DQHA 3SE7A 2HGSA 1XNRH 1GO3E 1T36A 2W6NA 3GIIA 3EPGA 2HVRA 2FPGB 3ORQA 3PW5A 3HBLA 4QWDA 2WDTA 2R7ZG 2W57A 4LFBH 4WD3A 4FS1A 1W96A 2VUMA 4ZI7F 1JX4A 4QWAA 3RJ0A 4FBTA 5DG7A 2BQ3A 4B3TH 5KT2A 3KHGA 4O3SA 1MZBA 4DR5H 3KXYT 4JYAH 4XYMB 5IYZF 1XDNA 2B63G 5H80A 2IA6A 3V6KA 2I8CA 4JI1H 1N48A 4TV9F 3GN9A 5IYCG 5KFDA 2DLNA 4XZ3B 4A3MG 2BQUA 4A2BA 3OTOH 4AYBE 2ZM6H 1BNCA 3JSLA 3L4KA 3GTQA 5KFLA 1PK8A 4RNOA 4C5BA 4A3KG 2FPIB 3PW0A 4O2BF 1B04A 3MR2A 2W8KA 2R8GA 5FD5A 2XCAA 2VUMG 1KJIA 4DL4A 2W6ZA 5KKNB 2ALZA 1C3OA 1TWAA 4R7RA 1SFOA 1P8LA 5JUMA 4DV7H 4LF5H 4FBUA 1GGOA 4TQRA 2Q2UA 3RGXA 4PDBA 3BA9A 3ORRA 1VAJA 1ZQ7A 4R8UB 2QK4A 2FMAA 2Y0SA 2JA5G 2YU9A 5KG7A 4YBZB 3V4ZA 1I50A 2C2DA 4DV5H 2W7OA 5LL6b 2NUAB 1TWCA 2W6PA 4TUYF 2JA7A 1XMQH 2J6TA 5DG9A 4YAKB 2RGRA 1E4FT 3KTMA 4LSAA 2R93G 3T1HH 5F9NA 5C44G 1ZETA 3RAXA 1B33N 2JEJA 4F50A 1XMOH 3VPDA 3GIJA 5LMUH 5FLXW 3BJYA 2W6OA 3LWBA 4DV1H 4I7HA 4JV0A 3HOZG 2CZGA 1BXRA 2YL2A 3JAMW 4F4XA 2ZDQA 4UCVA 3H40A 5EOYA 2JA6A 2FLLA 4UCUA 3M9NB 2PILA 3MWMA 2RF4A 5BR8H 5BPFA 3T5LA 3R5FA 3RB6A 2Q2TA 3GTKA 1V9PA 3PR4A 1GSAA 1S68A 4BY1G 2C00A 3M4IA 3GTOA 1TAEA 3N41B 4RU9A 3RB0A 2F4VH 5J2TF 4ECSA 4ETSA 4A3GG 1I6UA 3VPCA 1IOVA 3VPBA 4J9SA 4ECYA 1EZ1A 2X0SA 4UCSA 3F8NA 2R86A 1TWFA 4FM9A 1XNQH 3TQTA 2J6UA 2VUGA 2RDJA 4HNUA 4JUZA 2R8IA 3J7AK 5KFZA 4DL5A 4E4TA 5JVDF 3WO1A 2VA3A 2R82A 3MFHA 3MR5A 2AGPA 2YZMA 4FU0A 2HVSA 4ED6A 1KJ8A 5HBRB 2FB9A 4A2AA 2M3KA 3L4JA 4JI3H 3H0GG 4JV1A 3KHHA 4JV5H 2ZJTA 3PO2G 4ED7A 5BMVF 5L1KA 3HOXG 1K1QA 2HHHH 4DV6H 1M0WA 4ME6A 3WO0A 3I12A 2R85A 3VMMA 2E2IA 2WYOA 3BQ0A 1IOWA 4JI6H 1GSHA 1RYRA 5KFAA 4DV0H 2R92G 2YW2A 5KFUA 2FPPB 4QIWA 4LH6A 1S10A 4IRDA 2PMZA 3J80W 2E2HA 3RBEA 1TWHA 3N8DA 5D8DA 4JI8H 4QJFA 4EBDA 1AUVA 5CB4F 4FS2A 2FK3A 3RTXA 4J9LA 2ZDHA 1AY2A 3GIQA 4UFZA 4C2MA 1TA8A 3OHBA 1X9NA 1X6XX 5KG3A 4ED0A 4YR2A 4LF6H 2RGVA 5EZYF 4RB0A 4AYBA 2R7MA 2R7NA 4TQSA 1Z2PX 4O3QA 2WB1E 4ED3A 2YYAA 3PVXA 1X6PA 3HOUG 4CC6A 2ASJA 4LF7H 1SEIA 5KFJA 4J9KA 3OUZA 4EGJA 3FU1A 2UUBH 1Y14B 3EPIA 3H4DA 3FDSA 4QWBA 2YCHA 4J9MA 2JA7G 4IWYA 2YS7A 3PW7A 2VA2A 3K3VA 2PBZA 4M9UA 1ULZA 5D1OB 5FLMG 4RB1A 1KEEA 2W9BA 4EYIB 4EBCA 4DR3H 3R5HA 4BBRG 3GIDA 3N6RA 3M9MB 2W71A 3KHLA 3RB4A 2JA8G 5KFYA 4DUZH 2Y0SE 4XYLB 3N6XA 4O3PA 3Q8SB 3KHRA 5L1IA 4EEYA 1HR0H 2UUCH 2W6QA 4IR9A 1FJGH 2OH2A 5I47A 5KG2A 1N56A 3HOWG 1I7LA 2V59A 3OSPA 2AQ4A 4JI4H 2PN1A 1X6RA 1CQJB 3JSNA 3N43B 2WTFA 3N44B 2DWCA 2WAQA 4RB3C 1RG0A 4LW9A 5LP6F 4MV7A 5T14A 1AUXA 3TIGA 5L1LA 2HVQA 4RUAA 2GLTA 5C4XG 3GIKA 3RIZA 2B63A 4U7CA 1HNWH 4JV2A 2C35B 4HR7A 5LOVF 4EG0A 4ECRA 5DLFA 3PZPA 2ASDA 2JEFA 5KFSA 4O3RA 3G20A 2ASLA 1UNNC 2HJWA 4HQ6A 4BXXG 2R8HA 2VPQA 1DV1A 2BR0A 5LMNH 2DPJA 1VBHA 5KX5F 4ECTA 1J5EH 1M7JA 3ETJA 4UCRA 2AGOA 2YZNA 2V4RA 2JEIA 1GYFA 4ECVA 2PMZE 3PW2A 1IBMH 2CW7A 3HXLA 4J9RA 3TIIA 2DPIA 3GQCA 3BAAA 2UVVA 3BG5A 4IR1A 4GLXA 2M7GA 2CQYA 4LH7A 4ED8A 1ZHSA 1I94H 4LF8H 4DLKA 2JA5A 3Q8PB 2AU0A 5FJ8G 1X6YA 2W70A 3RBDA 1WH2A 4CC5A 4DV2H 2OLSA 2FK1A 3L2PA 1HNXH 5KG6A 1ZHQA 2R7KA 3JRXA 4HYKA 2SCUB 4ZOLF 4BBSG 2CKZB 4A3CG 3MR3A 4YY3H 4IZOA 3JRWA 3RV3A 4B3SH 4YR0A 2IP4A 3U9TA 4DR7H 4DR6H 1EUDB 5KFRA 3HKZA 5KT3A 3BQ2A 4F4ZA 3HOYG 4APMA 5C8YF 3G8CA 5CAEB 2C2EA 5LXTF 3IN5A 1Z2OX 2W9CB 3LMLA 1B6SA 5L9XA 4YR3A 2FKLA 4ECZA 2KEPA 3KALA 5KFNA 2J9GA 1RK5A 1S97A 2QYZA 2GPSA 1M6VA 5KFKA 1L2ZA 3HOVG 4MV8A 4L1KA 5KT6A 4RZRA 4NXNH 1EYZA 1CQIB 3K3PA 5KFMA 3QZ7A 5KFOA 4F4YA 1KC7A 3Q8RB 4I4TF 4RUCA 3AYHB 2NU8B 4X64H 4YJ2F 4A3FG 3FKIA 2VQEH 4MV9A 1T92A 5EWFA 3RAQA 5KFHA 4LFCH 3PO3G 1Y1VA 3SOKA 5DGAA 5JQWA 4QWCA 5A2QW 1M0TA 1T3NA 4XX0B 4C5CA 4YQWA 1RYSA 2J6SA 3MR6A 3GV8B 2HI2A 1X6QA 1N33H 2VOBA 3HB9A 4ZQIA 5IP7G 2XGQA 3G6VA 1CS0A 4RAZA 2C2RA 4G3IA 3Q1KA 2FE3A 3GTMA 3I4MG 4DR4H 3H0GA 4LSXA 4YJ3F 5KFQA 2R7ZA 2W7PA 2XGPA 2C22A 2XCPA 2FK2A 2YRWA 4Q0YA 5L1JA 2YRXA 2ZDGA 4O2AF 5C3EG 4R8UA 1SYXB 2R84A 1SCUB 1W93A 1S9FA 3WNZA 5EWGA 1WR2A 2I80A 4EGQA 2YZGA 1GSOA 2P0AA 4RZQA 1JXLA 4F4WA 2UXCH 4MA5A 1S0MA 4Q45A 1S0NA 4LF9H 4JI2H 4RB2C 1N32H 5KG0A 5CA0F 1DIKA 3GV5B 1K1SA 2VPSA 5KFCA 5FD6A 4AQYH 4O4LF 5LYJF 1C30A 3LP8A 3UQ8A 4DL2A 2UXDH 4U6PA 2R6FA 3NGDA 2FLNA 3GTPA 3GIPA 2NU9B 1RK6A 5KFBA 3R23A 4UCOA 4HNTA 1EHIA 2R8KA 2XCLA 2MCTA 4J9OA 2UUAH 2YS6A 1JDEA 2NU7B 3GTGA 4YHHH 4QWEA 3Q2OA 1T94A 2V9WA 2WE6A 2WB1A 3TINA 1VBGA 3H3VH 4YP3A 1JIHA 4NXMH 4NLGA 1Z2NX 3KAJA 3QFFA 4DL7A 5LA6F 2KSWA 4WBNF 4JI0H 1I3QA 3MFIA 5KG5A 3RGZA 4YB8B 3GILA 3V6HA 3K5HA 4B3RH 2FJZA 4B3MH 4JI5H 5IYDG 5EDWA 4MV1A 4X62H 5KFEA 1N34H 4I55F 5J2UF 3QZ8A 3G6YA 4EFBA 2PVPA 2IBKA 4DR1H 4DV4H 1R9TA 3JZIA 5IT9W 1RJQA 2VQFH 2PY0A 2NVYA 1EUCB 2DIKA 4BWSC 5KFGA 5FPRA 1V51A 4X66H 4BY7G 1B6RA 5JH7F 2V58A 4TV8F 5KFIA 3OSNA 2C28A 4LF4H 3M9OB 2FP4B 1UC9A 3GTJA 5D1PA 1DV2A 3TQ1A 2M05A 2AGQA 5IYBG 4DR2H 4IAJA 3MWEA 3JYZA 4IWXA 2NVXA 2W6MA 2V4QA 4MV3A 5KT7A 2UXBH 4A3IG 4LFAH 4A3DG 4EEQA 4QW9A 5KT5A 4MTEA 2RDIA 4C5AA 2DZDA 4MA0A 5JVLA 4Q44A 4GKJH 3K5IA 1DZOA 1OQWA 4RNMA 1O75A 4MTDA 3RFCA 4K0KH 3RUPA 3OUUA 2NU6B 3GIMA 2W9CA 2UVRA 5KFPA 4DV3H 1E4GT 4MV6A 2E5LH 3GV7B 5C1OA 5KFFA 1V4YA 5HV6A 5KFXA 1VKZA 1JLLB 3PR5B 3T5KA 3H20A 2I87A 4QIWE 1X6ZA 1HNZH 4O4HF 2BQRA 1BGWA 1HPWA 3RF2A 4RAYA 4X65H 4Y8VB 2CW8A 2W8LA 3T5HA 2R93A 3H4BA 3V6JA 1IBKH 3CVZA 3GTLA 2WAQE 1KJQA 5KFWA 3I4NG 1UC8A 3V4SA 3CQZA 4HNVA 5JW8A 4J9PA 4A3BG 3U9SA 3E5NA 5F9LA 1KBLA 5GONF 1K83A 5KFVA 3BQ1A 1N36H 1E4EB 5C1PA 3BA8A 4DUYH 4DL3A 3SOJA 5IP9G 4IHJF 5D1OA 5DLGA 2W9BB 2W9AA 4ECXA 2VR1A 4Q43A 2GPWA 4LMYA 1Y1WG 4Q8FA 5DGBA 4M7EA 3EYYA 5IWAH 2O03A 1KJJA 2V5AA 3PN1A 5KFTA 4QW8A 4EFEA 1FKAH 1BJTA 3RB3A 3J81W 4ECQA 4I50F 4A93G 4PWQA 2IMWP 1S03G 5KT4A 4DL6A 2ATLA 1OWTA 5DQGA 4OX9H 3FMAA 1VS0A 1Y1VG 5DG8A 4A3JG 1FVIA 3Q8QB 3GLKA 1WCMA 2R8JA 3SI8A 1S0OA 4Q8EA 4A3LG 1E4EA 3MWDA 3T5JA 3N40P 5KG1A 3IG0A 2UU9H 4GKKH 3JZZA 5EWEA 1AN7A 1QVEA 3KAKA 4UCTA 3ETHA 2R92A 3FKIG 4V1JA 4JI7H 4RNNA 4ECUA 2UVWA 5CA1F 1RJRA 5DQIA 2UVUA 2JA6G 2XD4A 2XC9A 4ED1A 1WCMG 3N42B 3MJFA 3DF7A 1A9XA 3T1YH 1GLVA 2R7LA 2XIGA 4MAMA 1DGSA 3RV4A 4ECWA 4YAJB 4ZHQF 4GC6A 1IBLH 4J9NA 1KJ9A 4MV4A 3PW4A 4EYHB 1JKJB 3UFXB 3C0FB 5K2MA 4O3OA 3G6XA 4KHPH 1TWGA 5KG4A 4A3EG 4GC7A 5C5JA 2JEGA 1Y1WA 2VQDA 3HKZE 4EBEA 3BABA 1WSCA 4O3NA 1I7NA 2R87A 4IRCA 5FPOA 3OHAA 4J9QA 4ED2A 4O4IF 2OWOA 1CE8A
chains in the Genus database with same CATH topology
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ7 A;  1WSC A;  1VAJ A; 
#chains in the Genus database with same CATH topology
 1RJP A;  1A0I A;  4J0M A;  5BPH A;  3R5X A;  1JDB B;  1PX2 A;  2FLP A;  4IRK A;  5DQH A;  3SE7 A;  2HGS A;  1XNR H;  1GO3 E;  1T36 A;  2W6N A;  3GII A;  3EPG A;  2HVR A;  2FPG B;  3ORQ A;  3PW5 A;  3HBL A;  4QWD A;  2WDT A;  2R7Z G;  2W57 A;  4LFB H;  4WD3 A;  4FS1 A;  1W96 A;  2VUM A;  4ZI7 F;  1JX4 A;  4QWA A;  3RJ0 A;  4FBT A;  5DG7 A;  2BQ3 A;  4B3T H;  5KT2 A;  3KHG A;  4O3S A;  1MZB A;  4DR5 H;  3KXY T;  4JYA H;  4XYM B;  5IYZ F;  1XDN A;  2B63 G;  5H80 A;  2IA6 A;  3V6K A;  2I8C A;  4JI1 H;  1N48 A;  4TV9 F;  3GN9 A;  5IYC G;  5KFD A;  2DLN A;  4XZ3 B;  4A3M G;  2BQU A;  4A2B A;  3OTO H;  4AYB E;  2ZM6 H;  1BNC A;  3JSL A;  3L4K A;  3GTQ A;  5KFL A;  1PK8 A;  4RNO A;  4C5B A;  4A3K G;  2FPI B;  3PW0 A;  4O2B F;  1B04 A;  3MR2 A;  2W8K A;  2R8G A;  5FD5 A;  2XCA A;  2VUM G;  1KJI A;  4DL4 A;  2W6Z A;  5KKN B;  2ALZ A;  1C3O A;  1TWA A;  4R7R A;  1SFO A;  1P8L A;  5JUM A;  4DV7 H;  4LF5 H;  4FBU A;  1GGO A;  4TQR A;  2Q2U A;  3RGX A;  4PDB A;  3BA9 A;  3ORR A;  1VAJ A;  1ZQ7 A;  4R8U B;  2QK4 A;  2FMA A;  2Y0S A;  2JA5 G;  2YU9 A;  5KG7 A;  4YBZ B;  3V4Z A;  1I50 A;  2C2D A;  4DV5 H;  2W7O A;  5LL6 b;  2NUA B;  1TWC A;  2W6P A;  4TUY F;  2JA7 A;  1XMQ H;  2J6T A;  5DG9 A;  4YAK B;  2RGR A;  1E4F T;  3KTM A;  4LSA A;  2R93 G;  3T1H H;  5F9N A;  5C44 G;  1ZET A;  3RAX A;  1B33 N;  2JEJ A;  4F50 A;  1XMO H;  3VPD A;  3GIJ A;  5LMU H;  5FLX W;  3BJY A;  2W6O A;  3LWB A;  4DV1 H;  4I7H A;  4JV0 A;  3HOZ G;  2CZG A;  1BXR A;  2YL2 A;  3JAM W;  4F4X A;  2ZDQ A;  4UCV A;  3H40 A;  5EOY A;  2JA6 A;  2FLL A;  4UCU A;  3M9N B;  2PIL A;  3MWM A;  2RF4 A;  5BR8 H;  5BPF A;  3T5L A;  3R5F A;  3RB6 A;  2Q2T A;  3GTK A;  1V9P A;  3PR4 A;  1GSA A;  1S68 A;  4BY1 G;  2C00 A;  3M4I A;  3GTO A;  1TAE A;  3N41 B;  4RU9 A;  3RB0 A;  2F4V H;  5J2T F;  4ECS A;  4ETS A;  4A3G G;  1I6U A;  3VPC A;  1IOV A;  3VPB A;  4J9S A;  4ECY A;  1EZ1 A;  2X0S A;  4UCS A;  3F8N A;  2R86 A;  1TWF A;  4FM9 A;  1XNQ H;  3TQT A;  2J6U A;  2VUG A;  2RDJ A;  4HNU A;  4JUZ A;  2R8I A;  3J7A K;  5KFZ A;  4DL5 A;  4E4T A;  5JVD F;  3WO1 A;  2VA3 A;  2R82 A;  3MFH A;  3MR5 A;  2AGP A;  2YZM A;  4FU0 A;  2HVS A;  4ED6 A;  1KJ8 A;  5HBR B;  2FB9 A;  4A2A A;  2M3K A;  3L4J A;  4JI3 H;  3H0G G;  4JV1 A;  3KHH A;  4JV5 H;  2ZJT A;  3PO2 G;  4ED7 A;  5BMV F;  5L1K A;  3HOX G;  1K1Q A;  2HHH H;  4DV6 H;  1M0W A;  4ME6 A;  3WO0 A;  3I12 A;  2R85 A;  3VMM A;  2E2I A;  2WYO A;  3BQ0 A;  1IOW A;  4JI6 H;  1GSH A;  1RYR A;  5KFA A;  4DV0 H;  2R92 G;  2YW2 A;  5KFU A;  2FPP B;  4QIW A;  4LH6 A;  1S10 A;  4IRD A;  2PMZ A;  3J80 W;  2E2H A;  3RBE A;  1TWH A;  3N8D A;  5D8D A;  4JI8 H;  4QJF A;  4EBD A;  1AUV A;  5CB4 F;  4FS2 A;  2FK3 A;  3RTX A;  4J9L A;  2ZDH A;  1AY2 A;  3GIQ A;  4UFZ A;  4C2M A;  1TA8 A;  3OHB A;  1X9N A;  1X6X X;  5KG3 A;  4ED0 A;  4YR2 A;  4LF6 H;  2RGV A;  5EZY F;  4RB0 A;  4AYB A;  2R7M A;  2R7N A;  4TQS A;  1Z2P X;  4O3Q A;  2WB1 E;  4ED3 A;  2YYA A;  3PVX A;  1X6P A;  3HOU G;  4CC6 A;  2ASJ A;  4LF7 H;  1SEI A;  5KFJ A;  4J9K A;  3OUZ A;  4EGJ A;  3FU1 A;  2UUB H;  1Y14 B;  3EPI A;  3H4D A;  3FDS A;  4QWB A;  2YCH A;  4J9M A;  2JA7 G;  4IWY A;  2YS7 A;  3PW7 A;  2VA2 A;  3K3V A;  2PBZ A;  4M9U A;  1ULZ A;  5D1O B;  5FLM G;  4RB1 A;  1KEE A;  2W9B A;  4EYI B;  4EBC A;  4DR3 H;  3R5H A;  4BBR G;  3GID A;  3N6R A;  3M9M B;  2W71 A;  3KHL A;  3RB4 A;  2JA8 G;  5KFY A;  4DUZ H;  2Y0S E;  4XYL B;  3N6X A;  4O3P A;  3Q8S B;  3KHR A;  5L1I A;  4EEY A;  1HR0 H;  2UUC H;  2W6Q A;  4IR9 A;  1FJG H;  2OH2 A;  5I47 A;  5KG2 A;  1N56 A;  3HOW G;  1I7L A;  2V59 A;  3OSP A;  2AQ4 A;  4JI4 H;  2PN1 A;  1X6R A;  1CQJ B;  3JSN A;  3N43 B;  2WTF A;  3N44 B;  2DWC A;  2WAQ A;  4RB3 C;  1RG0 A;  4LW9 A;  5LP6 F;  4MV7 A;  5T14 A;  1AUX A;  3TIG A;  5L1L A;  2HVQ A;  4RUA A;  2GLT A;  5C4X G;  3GIK A;  3RIZ A;  2B63 A;  4U7C A;  1HNW H;  4JV2 A;  2C35 B;  4HR7 A;  5LOV F;  4EG0 A;  4ECR A;  5DLF A;  3PZP A;  2ASD A;  2JEF A;  5KFS A;  4O3R A;  3G20 A;  2ASL A;  1UNN C;  2HJW A;  4HQ6 A;  4BXX G;  2R8H A;  2VPQ A;  1DV1 A;  2BR0 A;  5LMN H;  2DPJ A;  1VBH A;  5KX5 F;  4ECT A;  1J5E H;  1M7J A;  3ETJ A;  4UCR A;  2AGO A;  2YZN A;  2V4R A;  2JEI A;  1GYF A;  4ECV A;  2PMZ E;  3PW2 A;  1IBM H;  2CW7 A;  3HXL A;  4J9R A;  3TII A;  2DPI A;  3GQC A;  3BAA A;  2UVV A;  3BG5 A;  4IR1 A;  4GLX A;  2M7G A;  2CQY A;  4LH7 A;  4ED8 A;  1ZHS A;  1I94 H;  4LF8 H;  4DLK A;  2JA5 A;  3Q8P B;  2AU0 A;  5FJ8 G;  1X6Y A;  2W70 A;  3RBD A;  1WH2 A;  4CC5 A;  4DV2 H;  2OLS A;  2FK1 A;  3L2P A;  1HNX H;  5KG6 A;  1ZHQ A;  2R7K A;  3JRX A;  4HYK A;  2SCU B;  4ZOL F;  4BBS G;  2CKZ B;  4A3C G;  3MR3 A;  4YY3 H;  4IZO A;  3JRW A;  3RV3 A;  4B3S H;  4YR0 A;  2IP4 A;  3U9T A;  4DR7 H;  4DR6 H;  1EUD B;  5KFR A;  3HKZ A;  5KT3 A;  3BQ2 A;  4F4Z A;  3HOY G;  4APM A;  5C8Y F;  3G8C A;  5CAE B;  2C2E A;  5LXT F;  3IN5 A;  1Z2O X;  2W9C B;  3LML A;  1B6S A;  5L9X A;  4YR3 A;  2FKL A;  4ECZ A;  2KEP A;  3KAL A;  5KFN A;  2J9G A;  1RK5 A;  1S97 A;  2QYZ A;  2GPS A;  1M6V A;  5KFK A;  1L2Z A;  3HOV G;  4MV8 A;  4L1K A;  5KT6 A;  4RZR A;  4NXN H;  1EYZ A;  1CQI B;  3K3P A;  5KFM A;  3QZ7 A;  5KFO A;  4F4Y A;  1KC7 A;  3Q8R B;  4I4T F;  4RUC A;  3AYH B;  2NU8 B;  4X64 H;  4YJ2 F;  4A3F G;  3FKI A;  2VQE H;  4MV9 A;  1T92 A;  5EWF A;  3RAQ A;  5KFH A;  4LFC H;  3PO3 G;  1Y1V A;  3SOK A;  5DGA A;  5JQW A;  4QWC A;  5A2Q W;  1M0T A;  1T3N A;  4XX0 B;  4C5C A;  4YQW A;  1RYS A;  2J6S A;  3MR6 A;  3GV8 B;  2HI2 A;  1X6Q A;  1N33 H;  2VOB A;  3HB9 A;  4ZQI A;  5IP7 G;  2XGQ A;  3G6V A;  1CS0 A;  4RAZ A;  2C2R A;  4G3I A;  3Q1K A;  2FE3 A;  3GTM A;  3I4M G;  4DR4 H;  3H0G A;  4LSX A;  4YJ3 F;  5KFQ A;  2R7Z A;  2W7P A;  2XGP A;  2C22 A;  2XCP A;  2FK2 A;  2YRW A;  4Q0Y A;  5L1J A;  2YRX A;  2ZDG A;  4O2A F;  5C3E G;  4R8U A;  1SYX B;  2R84 A;  1SCU B;  1W93 A;  1S9F A;  3WNZ A;  5EWG A;  1WR2 A;  2I80 A;  4EGQ A;  2YZG A;  1GSO A;  2P0A A;  4RZQ A;  1JXL A;  4F4W A;  2UXC H;  4MA5 A;  1S0M A;  4Q45 A;  1S0N A;  4LF9 H;  4JI2 H;  4RB2 C;  1N32 H;  5KG0 A;  5CA0 F;  1DIK A;  3GV5 B;  1K1S A;  2VPS A;  5KFC A;  5FD6 A;  4AQY H;  4O4L F;  5LYJ F;  1C30 A;  3LP8 A;  3UQ8 A;  4DL2 A;  2UXD H;  4U6P A;  2R6F A;  3NGD A;  2FLN A;  3GTP A;  3GIP A;  2NU9 B;  1RK6 A;  5KFB A;  3R23 A;  4UCO A;  4HNT A;  1EHI A;  2R8K A;  2XCL A;  2MCT A;  4J9O A;  2UUA H;  2YS6 A;  1JDE A;  2NU7 B;  3GTG A;  4YHH H;  4QWE A;  3Q2O A;  1T94 A;  2V9W A;  2WE6 A;  2WB1 A;  3TIN A;  1VBG A;  3H3V H;  4YP3 A;  1JIH A;  4NXM H;  4NLG A;  1Z2N X;  3KAJ A;  3QFF A;  4DL7 A;  5LA6 F;  2KSW A;  4WBN F;  4JI0 H;  1I3Q A;  3MFI A;  5KG5 A;  3RGZ A;  4YB8 B;  3GIL A;  3V6H A;  3K5H A;  4B3R H;  2FJZ A;  4B3M H;  4JI5 H;  5IYD G;  5EDW A;  4MV1 A;  4X62 H;  5KFE A;  1N34 H;  4I55 F;  5J2U F;  3QZ8 A;  3G6Y A;  4EFB A;  2PVP A;  2IBK A;  4DR1 H;  4DV4 H;  1R9T A;  3JZI A;  5IT9 W;  1RJQ A;  2VQF H;  2PY0 A;  2NVY A;  1EUC B;  2DIK A;  4BWS C;  5KFG A;  5FPR A;  1V51 A;  4X66 H;  4BY7 G;  1B6R A;  5JH7 F;  2V58 A;  4TV8 F;  5KFI A;  3OSN A;  2C28 A;  4LF4 H;  3M9O B;  2FP4 B;  1UC9 A;  3GTJ A;  5D1P A;  1DV2 A;  3TQ1 A;  2M05 A;  2AGQ A;  5IYB G;  4DR2 H;  4IAJ A;  3MWE A;  3JYZ A;  4IWX A;  2NVX A;  2W6M A;  2V4Q A;  4MV3 A;  5KT7 A;  2UXB H;  4A3I G;  4LFA H;  4A3D G;  4EEQ A;  4QW9 A;  5KT5 A;  4MTE A;  2RDI A;  4C5A A;  2DZD A;  4MA0 A;  5JVL A;  4Q44 A;  4GKJ H;  3K5I A;  1DZO A;  1OQW A;  4RNM A;  1O75 A;  4MTD A;  3RFC A;  4K0K H;  3RUP A;  3OUU A;  2NU6 B;  3GIM A;  2W9C A;  2UVR A;  5KFP A;  4DV3 H;  1E4G T;  4MV6 A;  2E5L H;  3GV7 B;  5C1O A;  5KFF A;  1V4Y A;  5HV6 A;  5KFX A;  1VKZ A;  1JLL B;  3PR5 B;  3T5K A;  3H20 A;  2I87 A;  4QIW E;  1X6Z A;  1HNZ H;  4O4H F;  2BQR A;  1BGW A;  1HPW A;  3RF2 A;  4RAY A;  4X65 H;  4Y8V B;  2CW8 A;  2W8L A;  3T5H A;  2R93 A;  3H4B A;  3V6J A;  1IBK H;  3CVZ A;  3GTL A;  2WAQ E;  1KJQ A;  5KFW A;  3I4N G;  1UC8 A;  3V4S A;  3CQZ A;  4HNV A;  5JW8 A;  4J9P A;  4A3B G;  3U9S A;  3E5N A;  5F9L A;  1KBL A;  5GON F;  1K83 A;  5KFV A;  3BQ1 A;  1N36 H;  1E4E B;  5C1P A;  3BA8 A;  4DUY H;  4DL3 A;  3SOJ A;  5IP9 G;  4IHJ F;  5D1O A;  5DLG A;  2W9B B;  2W9A A;  4ECX A;  2VR1 A;  4Q43 A;  2GPW A;  4LMY A;  1Y1W G;  4Q8F A;  5DGB A;  4M7E A;  3EYY A;  5IWA H;  2O03 A;  1KJJ A;  2V5A A;  3PN1 A;  5KFT A;  4QW8 A;  4EFE A;  1FKA H;  1BJT A;  3RB3 A;  3J81 W;  4ECQ A;  4I50 F;  4A93 G;  4PWQ A;  2IMW P;  1S03 G;  5KT4 A;  4DL6 A;  2ATL A;  1OWT A;  5DQG A;  4OX9 H;  3FMA A;  1VS0 A;  1Y1V G;  5DG8 A;  4A3J G;  1FVI A;  3Q8Q B;  3GLK A;  1WCM A;  2R8J A;  3SI8 A;  1S0O A;  4Q8E A;  4A3L G;  1E4E A;  3MWD A;  3T5J A;  3N40 P;  5KG1 A;  3IG0 A;  2UU9 H;  4GKK H;  3JZZ A;  5EWE A;  1AN7 A;  1QVE A;  3KAK A;  4UCT A;  3ETH A;  2R92 A;  3FKI G;  4V1J A;  4JI7 H;  4RNN A;  4ECU A;  2UVW A;  5CA1 F;  1RJR A;  5DQI A;  2UVU A;  2JA6 G;  2XD4 A;  2XC9 A;  4ED1 A;  1WCM G;  3N42 B;  3MJF A;  3DF7 A;  1A9X A;  3T1Y H;  1GLV A;  2R7L A;  2XIG A;  4MAM A;  1DGS A;  3RV4 A;  4ECW A;  4YAJ B;  4ZHQ F;  4GC6 A;  1IBL H;  4J9N A;  1KJ9 A;  4MV4 A;  3PW4 A;  4EYH B;  1JKJ B;  3UFX B;  3C0F B;  5K2M A;  4O3O A;  3G6X A;  4KHP H;  1TWG A;  5KG4 A;  4A3E G;  4GC7 A;  5C5J A;  2JEG A;  1Y1W A;  2VQD A;  3HKZ E;  4EBE A;  3BAB A;  1WSC A;  4O3N A;  1I7N A;  2R87 A;  4IRC A;  5FPO A;  3OHA A;  4J9Q A;  4ED2 A;  4O4I F;  2OWO A;  1CE8 A; 
#chains in the Genus database with same CATH homology
 1ZQ7 A;  1WSC A;  1VAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...