1VB0A

Atomic resolution structure of atratoxin-b, one short-chain neurotoxin from naja atra
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQTPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobrotoxin b
publication title The atomic resolution crystal structure of atratoxin determined by single wavelength anomalous diffraction phasing
pubmed doi rcsb
molecule tags Toxin
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1vb0A00
1CHVS 1XT3A 1BXPA 2MJ0A 1FF4A 1KS6A 1ERGA 1FASA 1NXBA 2BHIA 2X8BB 3PLCA 1IJCA 2H64C 4OM4A 2LCRA 2CTXA 1JE9A 1LSIA 1I02A 2H8UA 1YWHA 2MHYA 3FEVA 1KFHA 1CCQA 2QJ9C 1HOYA 2K3GA 1FRAA 1MAHF 1IDLA 1HC9B 1IK8A 2MJYA 2ERAA 1NTXA 3ERAA 5IMYC 6EBXA 1REWC 1NTNA 1KBTA 1CVOA 1VB0A 1IDHA 1G6MA 1NEAA 1CXNA 1TXBA 1TFSA 2J8BA 2FD6U 2QJBC 3LAQU 4LFTA 1HAJA 2CDXA 1CDRA 2H7ZA 3U73U 2GOOC 1BTEA 2VLWA 2H64B 2UWRA 1HAAA 1M9ZA 4HQPF 1W6BA 1FFJA 2MUPA 4OM5A 5DU1A 2GOOB 2JQPA 2H5FA 2QC1A 1CODA 1RL5A 2MFAA 1L4WA 1FSSB 1TXAA 1B41B 2NBTA 3NEQA 5EBXA 1QM7A 1CXOA 1ONJA 1MR6A 4EY8B 1F94A 1JBDA 2ABXA 3EVSC 1CREA 2MUOA 1IKCA 5IMTD 2OFSA 2CRTA 1LXGA 2L5SA 2HLRA 2UX2A 1PLOA 4BDTB 3VTSA 1IQ9A 1ZADA 2QJAC 2HLQA 1CDQA 1CDSA 2PJYC 1HC9A 3QB4B 4P7UA 1KU6B 1LJZA 1LX5B 1LXHA 3NH7A 1F8UB 3BT1U 4FAOE 3KFDE 3HH7A 1S4YA 4UY2C 1CRFA 1TGXA 1QKEA 1KXIA 4DO8A 2BTXA 1ES7B 2JVEA 1KC4A 3BT2U 2H7ZB 5DZ5A 2CCXA 4BIKB 2CRSA 3KFDI 1V6PA 1JGKA 2I9BE 1DRSA 5DO6A 1FSCA 4QTIU 2LA1A 4XJJA 1COEA 1ABTA 1KTZB 3NDSA 1CTXA 4ZQYA 1NYSA 2H62C 2PJYB 3EBXA 1ERAA 1QKDA 1CB9A 4RUDA 1IDGA 1H0JA 2MJ4A 4FAOC 1NORA 1KBSA 2H62D 1KL8A 1NYUA 1UG4A 1IDIA 1RGJA 2N99A 1KBAA 2L03A 3U74U 4IYEA 4AEAA 1CDTA
chains in the Genus database with same CATH superfamily
1CHVS 1XT3A 1BXPA 2MJ0A 1FF4A 1KS6A 1ERGA 1FASA 1NXBA 2BHIA 2X8BB 3PLCA 1IJCA 2H64C 4OM4A 2LCRA 2CTXA 1JE9A 1LSIA 1I02A 2H8UA 1YWHA 2MHYA 3FEVA 1KFHA 1CCQA 2QJ9C 1HOYA 2K3GA 1FRAA 1MAHF 1IDLA 1HC9B 1IK8A 2MJYA 2ERAA 1NTXA 3ERAA 5IMYC 6EBXA 1REWC 1NTNA 1KBTA 1CVOA 1VB0A 1IDHA 1G6MA 1NEAA 1CXNA 1TXBA 1TFSA 2J8BA 2FD6U 2QJBC 3LAQU 4LFTA 1HAJA 2CDXA 1CDRA 2H7ZA 3U73U 2GOOC 1BTEA 2VLWA 2H64B 2UWRA 1HAAA 1M9ZA 4HQPF 1W6BA 1FFJA 2MUPA 4OM5A 5DU1A 2GOOB 2JQPA 2H5FA 2QC1A 1CODA 1RL5A 2MFAA 1L4WA 1FSSB 1TXAA 1B41B 2NBTA 3NEQA 5EBXA 1QM7A 1CXOA 1ONJA 1MR6A 4EY8B 1F94A 1JBDA 2ABXA 3EVSC 1CREA 2MUOA 1IKCA 5IMTD 2OFSA 2CRTA 1LXGA 2L5SA 2HLRA 2UX2A 1PLOA 4BDTB 3VTSA 1IQ9A 1ZADA 2QJAC 2HLQA 1CDQA 1CDSA 2PJYC 1HC9A 4KSNA 3QB4B 4P7UA 1KU6B 1LJZA 1LX5B 1LXHA 3NH7A 1F8UB 3BT1U 4FAOE 3KFDE 3HH7A 1S4YA 4UY2C 1CRFA 1TGXA 1QKEA 1KXIA 4DO8A 2BTXA 1ES7B 2JVEA 1KC4A 3BT2U 2H7ZB 5DZ5A 2CCXA 4BIKB 2CRSA 3KFDI 1V6PA 1JGKA 2I9BE 1DRSA 5DO6A 1FSCA 4QTIU 2LA1A 4XJJA 1COEA 1ABTA 1KTZB 3NDSA 1CTXA 4ZQYA 1NYSA 2H62C 2PJYB 3EBXA 1ERAA 1QKDA 1CB9A 4RUDA 1IDGA 1H0JA 2MJ4A 4FAOC 1NORA 1KBSA 2H62D 1KL8A 1NYUA 1UG4A 1IDIA 1RGJA 2N99A 1KBAA 2L03A 3U74U 4IYEA 4AEAA 1CDTA
chains in the Genus database with same CATH topology
1CHVS 1XT3A 1BXPA 2MJ0A 1FF4A 1KS6A 1ERGA 1FASA 1NXBA 2BHIA 2X8BB 3PLCA 1IJCA 2H64C 4OM4A 2LCRA 2CTXA 1JE9A 1LSIA 1I02A 2H8UA 1YWHA 2MHYA 3FEVA 1KFHA 1CCQA 2QJ9C 1HOYA 2K3GA 1FRAA 1MAHF 1IDLA 1HC9B 1IK8A 2MJYA 2ERAA 1NTXA 3ERAA 5IMYC 6EBXA 1REWC 1NTNA 1KBTA 1CVOA 1VB0A 1IDHA 1G6MA 1NEAA 1CXNA 1TXBA 1TFSA 2J8BA 2FD6U 2QJBC 3LAQU 4LFTA 1HAJA 2CDXA 1CDRA 2H7ZA 3U73U 2GOOC 1BTEA 2VLWA 2H64B 2UWRA 1HAAA 1M9ZA 4HQPF 1W6BA 1FFJA 2MUPA 4OM5A 5DU1A 2GOOB 2JQPA 2H5FA 2QC1A 1CODA 1RL5A 2MFAA 1L4WA 1FSSB 1TXAA 1B41B 2NBTA 3NEQA 5EBXA 1QM7A 1CXOA 1ONJA 1MR6A 4EY8B 1F94A 1JBDA 2ABXA 3EVSC 1CREA 2MUOA 1IKCA 5IMTD 2OFSA 2CRTA 1LXGA 2L5SA 2HLRA 2UX2A 1PLOA 4BDTB 3VTSA 1IQ9A 1ZADA 2QJAC 2HLQA 1CDQA 1CDSA 2PJYC 1HC9A 4KSNA 3QB4B 4P7UA 1KU6B 1LJZA 1LX5B 1LXHA 3NH7A 1F8UB 3BT1U 4FAOE 3KFDE 3HH7A 1S4YA 4UY2C 1CRFA 1TGXA 1QKEA 1KXIA 4DO8A 2BTXA 1ES7B 2JVEA 1KC4A 3BT2U 2H7ZB 5DZ5A 2CCXA 4BIKB 2CRSA 3KFDI 1V6PA 1JGKA 2I9BE 1DRSA 5DO6A 1FSCA 4QTIU 2LA1A 4XJJA 1COEA 1ABTA 1KTZB 3NDSA 1CTXA 4ZQYA 1NYSA 2H62C 2PJYB 3EBXA 1ERAA 1QKDA 1CB9A 4RUDA 1IDGA 1H0JA 2MJ4A 4FAOC 1NORA 1KBSA 2H62D 1KL8A 1NYUA 1UG4A 1IDIA 1RGJA 2N99A 1KBAA 2L03A 3U74U 4IYEA 4AEAA 1CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHV S;  1XT3 A;  1BXP A;  2MJ0 A;  1FF4 A;  1KS6 A;  1ERG A;  1FAS A;  1NXB A;  2BHI A;  2X8B B;  3PLC A;  1IJC A;  2H64 C;  4OM4 A;  2LCR A;  2CTX A;  1JE9 A;  1LSI A;  1I02 A;  2H8U A;  1YWH A;  2MHY A;  3FEV A;  1KFH A;  1CCQ A;  2QJ9 C;  1HOY A;  2K3G A;  1FRA A;  1MAH F;  1IDL A;  1HC9 B;  1IK8 A;  2MJY A;  2ERA A;  1NTX A;  3ERA A;  5IMY C;  6EBX A;  1REW C;  1NTN A;  1KBT A;  1CVO A;  1VB0 A;  1IDH A;  1G6M A;  1NEA A;  1CXN A;  1TXB A;  1TFS A;  2J8B A;  2FD6 U;  2QJB C;  3LAQ U;  4LFT A;  1HAJ A;  2CDX A;  1CDR A;  2H7Z A;  3U73 U;  2GOO C;  1BTE A;  2VLW A;  2H64 B;  2UWR A;  1HAA A;  1M9Z A;  4HQP F;  1W6B A;  1FFJ A;  2MUP A;  4OM5 A;  5DU1 A;  2GOO B;  2JQP A;  2H5F A;  2QC1 A;  1COD A;  1RL5 A;  2MFA A;  1L4W A;  1FSS B;  1TXA A;  1B41 B;  2NBT A;  3NEQ A;  5EBX A;  1QM7 A;  1CXO A;  1ONJ A;  1MR6 A;  4EY8 B;  1F94 A;  1JBD A;  2ABX A;  3EVS C;  1CRE A;  2MUO A;  1IKC A;  5IMT D;  2OFS A;  2CRT A;  1LXG A;  2L5S A;  2HLR A;  2UX2 A;  1PLO A;  4BDT B;  3VTS A;  1IQ9 A;  1ZAD A;  2QJA C;  2HLQ A;  1CDQ A;  1CDS A;  2PJY C;  1HC9 A;  3QB4 B;  4P7U A;  1KU6 B;  1LJZ A;  1LX5 B;  1LXH A;  3NH7 A;  1F8U B;  3BT1 U;  4FAO E;  3KFD E;  3HH7 A;  1S4Y A;  4UY2 C;  1CRF A;  1TGX A;  1QKE A;  1KXI A;  4DO8 A;  2BTX A;  1ES7 B;  2JVE A;  1KC4 A;  3BT2 U;  2H7Z B;  5DZ5 A;  2CCX A;  4BIK B;  2CRS A;  3KFD I;  1V6P A;  1JGK A;  2I9B E;  1DRS A;  5DO6 A;  1FSC A;  4QTI U;  2LA1 A;  4XJJ A;  1COE A;  1ABT A;  1KTZ B;  3NDS A;  1CTX A;  4ZQY A;  1NYS A;  2H62 C;  2PJY B;  3EBX A;  1ERA A;  1QKD A;  1CB9 A;  4RUD A;  1IDG A;  1H0J A;  2MJ4 A;  4FAO C;  1NOR A;  1KBS A;  2H62 D;  1KL8 A;  1NYU A;  1UG4 A;  1IDI A;  1RGJ A;  2N99 A;  1KBA A;  2L03 A;  3U74 U;  4IYE A;  4AEA A;  1CDT A; 
#chains in the Genus database with same CATH topology
 1CHV S;  1XT3 A;  1BXP A;  2MJ0 A;  1FF4 A;  1KS6 A;  1ERG A;  1FAS A;  1NXB A;  2BHI A;  2X8B B;  3PLC A;  1IJC A;  2H64 C;  4OM4 A;  2LCR A;  2CTX A;  1JE9 A;  1LSI A;  1I02 A;  2H8U A;  1YWH A;  2MHY A;  3FEV A;  1KFH A;  1CCQ A;  2QJ9 C;  1HOY A;  2K3G A;  1FRA A;  1MAH F;  1IDL A;  1HC9 B;  1IK8 A;  2MJY A;  2ERA A;  1NTX A;  3ERA A;  5IMY C;  6EBX A;  1REW C;  1NTN A;  1KBT A;  1CVO A;  1VB0 A;  1IDH A;  1G6M A;  1NEA A;  1CXN A;  1TXB A;  1TFS A;  2J8B A;  2FD6 U;  2QJB C;  3LAQ U;  4LFT A;  1HAJ A;  2CDX A;  1CDR A;  2H7Z A;  3U73 U;  2GOO C;  1BTE A;  2VLW A;  2H64 B;  2UWR A;  1HAA A;  1M9Z A;  4HQP F;  1W6B A;  1FFJ A;  2MUP A;  4OM5 A;  5DU1 A;  2GOO B;  2JQP A;  2H5F A;  2QC1 A;  1COD A;  1RL5 A;  2MFA A;  1L4W A;  1FSS B;  1TXA A;  1B41 B;  2NBT A;  3NEQ A;  5EBX A;  1QM7 A;  1CXO A;  1ONJ A;  1MR6 A;  4EY8 B;  1F94 A;  1JBD A;  2ABX A;  3EVS C;  1CRE A;  2MUO A;  1IKC A;  5IMT D;  2OFS A;  2CRT A;  1LXG A;  2L5S A;  2HLR A;  2UX2 A;  1PLO A;  4BDT B;  3VTS A;  1IQ9 A;  1ZAD A;  2QJA C;  2HLQ A;  1CDQ A;  1CDS A;  2PJY C;  1HC9 A;  4KSN A;  3QB4 B;  4P7U A;  1KU6 B;  1LJZ A;  1LX5 B;  1LXH A;  3NH7 A;  1F8U B;  3BT1 U;  4FAO E;  3KFD E;  3HH7 A;  1S4Y A;  4UY2 C;  1CRF A;  1TGX A;  1QKE A;  1KXI A;  4DO8 A;  2BTX A;  1ES7 B;  2JVE A;  1KC4 A;  3BT2 U;  2H7Z B;  5DZ5 A;  2CCX A;  4BIK B;  2CRS A;  3KFD I;  1V6P A;  1JGK A;  2I9B E;  1DRS A;  5DO6 A;  1FSC A;  4QTI U;  2LA1 A;  4XJJ A;  1COE A;  1ABT A;  1KTZ B;  3NDS A;  1CTX A;  4ZQY A;  1NYS A;  2H62 C;  2PJY B;  3EBX A;  1ERA A;  1QKD A;  1CB9 A;  4RUD A;  1IDG A;  1H0J A;  2MJ4 A;  4FAO C;  1NOR A;  1KBS A;  2H62 D;  1KL8 A;  1NYU A;  1UG4 A;  1IDI A;  1RGJ A;  2N99 A;  1KBA A;  2L03 A;  3U74 U;  4IYE A;  4AEA A;  1CDT A; 
#chains in the Genus database with same CATH homology
 1CHV S;  1XT3 A;  1BXP A;  2MJ0 A;  1FF4 A;  1KS6 A;  1ERG A;  1FAS A;  1NXB A;  2BHI A;  2X8B B;  3PLC A;  1IJC A;  2H64 C;  4OM4 A;  2LCR A;  2CTX A;  1JE9 A;  1LSI A;  1I02 A;  2H8U A;  1YWH A;  2MHY A;  3FEV A;  1KFH A;  1CCQ A;  2QJ9 C;  1HOY A;  2K3G A;  1FRA A;  1MAH F;  1IDL A;  1HC9 B;  1IK8 A;  2MJY A;  2ERA A;  1NTX A;  3ERA A;  5IMY C;  6EBX A;  1REW C;  1NTN A;  1KBT A;  1CVO A;  1VB0 A;  1IDH A;  1G6M A;  1NEA A;  1CXN A;  1TXB A;  1TFS A;  2J8B A;  2FD6 U;  2QJB C;  3LAQ U;  4LFT A;  1HAJ A;  2CDX A;  1CDR A;  2H7Z A;  3U73 U;  2GOO C;  1BTE A;  2VLW A;  2H64 B;  2UWR A;  1HAA A;  1M9Z A;  4HQP F;  1W6B A;  1FFJ A;  2MUP A;  4OM5 A;  5DU1 A;  2GOO B;  2JQP A;  2H5F A;  2QC1 A;  1COD A;  1RL5 A;  2MFA A;  1L4W A;  1FSS B;  1TXA A;  1B41 B;  2NBT A;  3NEQ A;  5EBX A;  1QM7 A;  1CXO A;  1ONJ A;  1MR6 A;  4EY8 B;  1F94 A;  1JBD A;  2ABX A;  3EVS C;  1CRE A;  2MUO A;  1IKC A;  5IMT D;  2OFS A;  2CRT A;  1LXG A;  2L5S A;  2HLR A;  2UX2 A;  1PLO A;  4BDT B;  3VTS A;  1IQ9 A;  1ZAD A;  2QJA C;  2HLQ A;  1CDQ A;  1CDS A;  2PJY C;  1HC9 A;  4KSN A;  3QB4 B;  4P7U A;  1KU6 B;  1LJZ A;  1LX5 B;  1LXH A;  3NH7 A;  1F8U B;  3BT1 U;  4FAO E;  3KFD E;  3HH7 A;  1S4Y A;  4UY2 C;  1CRF A;  1TGX A;  1QKE A;  1KXI A;  4DO8 A;  2BTX A;  1ES7 B;  2JVE A;  1KC4 A;  3BT2 U;  2H7Z B;  5DZ5 A;  2CCX A;  4BIK B;  2CRS A;  3KFD I;  1V6P A;  1JGK A;  2I9B E;  1DRS A;  5DO6 A;  1FSC A;  4QTI U;  2LA1 A;  4XJJ A;  1COE A;  1ABT A;  1KTZ B;  3NDS A;  1CTX A;  4ZQY A;  1NYS A;  2H62 C;  2PJY B;  3EBX A;  1ERA A;  1QKD A;  1CB9 A;  4RUD A;  1IDG A;  1H0J A;  2MJ4 A;  4FAO C;  1NOR A;  1KBS A;  2H62 D;  1KL8 A;  1NYU A;  1UG4 A;  1IDI A;  1RGJ A;  2N99 A;  1KBA A;  2L03 A;  3U74 U;  4IYE A;  4AEA A;  1CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...