1VB0A

Atomic resolution structure of atratoxin-b, one short-chain neurotoxin from naja atra
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQTPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atomic resolution crystal structure of atratoxin determined by single wavelength anomalous diffraction phasing
pubmed doi rcsb
molecule tags Toxin
molecule keywords Cobrotoxin b
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1vb0A00
1L4WA 4ZQYA 1H0JA 2OFSA 2MJ4A 6EBXA 1FSSB 2HLQA 1LXGA 1CHVS 1LJZA 2CRSA 2H5FA 1HOYA 4AEAA 1ERGA 5IMYC 2I9BE 3HH7A 1G6MA 1IDHA 4LFTA 5DU1A 2CCXA 1NEAA 3NH7A 4IYEA 1CODA 2GOOB 2PJYB 1W6BA 1COEA 1KBSA 4UY2C 1I02A 3BT1U 2H64C 2H8UA 2L5SA 1HC9A 1NORA 1V6PA 1CDTA 1RL5A 1ERAA 4XJJA 2JQPA 5IMTD 1KS6A 4OM5A 2MFAA 1ONJA 1BTEA 1REWC 1FSCA 1F8UB 1CTXA 1KU6B 2UX2A 3BT2U 2QJAC 5DZ5A 2PJYC 1NYSA 1KFHA 1F94A 1B41B 1CXOA 2MJ0A 1JBDA 1VB0A 3NEQA 1FFJA 1YWHA 1UG4A 1IDGA 3KFDE 2LA1A 1JGKA 4EY8B 4FAOC 1CREA 2J8BA 4P7UA 1ABTA 1ZADA 3EVSC 1IDIA 3EBXA 1CVOA 1HAJA 1CDSA 2H7ZB 2QJBC 1IJCA 1CDRA 1MR6A 1IDLA 3U74U 1NTNA 1KL8A 2CTXA 2NBTA 2X8BB 1LX5B 2MHYA 1CXNA 2ERAA 2H64B 1BXPA 4RUDA 1TGXA 1XT3A 1KXIA 4BDTB 2H62C 2JVEA 1FASA 2BHIA 1CRFA 2HLRA 1NTXA 2VLWA 4BIKB 1FF4A 2ABXA 2GOOC 4HQPF 1IKCA 1IQ9A 1KBAA 1S4YA 1TXBA 1CDQA 3VTSA 1LXHA 2N99A 1RGJA 5EBXA 1TXAA 4OM4A 2UWRA 4QTIU 2MUOA 5DO6A 1M9ZA 2QJ9C 4DO8A 1DRSA 3LAQU 1KC4A 1HC9B 1QKDA 3KFDI 2BTXA 1JE9A 1FRAA 1QM7A 1QKEA 1MAHF 3PLCA 2MUPA 3NDSA 2K3GA 1CB9A 1NYUA 2H62D 2L03A 2LCRA 2FD6U 1CCQA 1KBTA 1PLOA 4FAOE 1ES7B 1IK8A 3QB4B 1LSIA 3U73U 2H7ZA 2CRTA 1HAAA 2MJYA 1TFSA 1KTZB 3FEVA 2QC1A 1NXBA 3ERAA 2CDXA
chains in the Genus database with same CATH superfamily
1L4WA 4ZQYA 1H0JA 2OFSA 2MJ4A 6EBXA 1FSSB 2HLQA 1LXGA 1CHVS 1LJZA 2CRSA 2H5FA 1HOYA 4AEAA 1ERGA 5IMYC 2I9BE 3HH7A 1G6MA 1IDHA 4LFTA 5DU1A 2CCXA 1NEAA 3NH7A 4IYEA 1CODA 2GOOB 2PJYB 1W6BA 1COEA 1KBSA 4UY2C 1I02A 3BT1U 2H64C 2H8UA 2L5SA 1HC9A 1NORA 1V6PA 1CDTA 1RL5A 1ERAA 4XJJA 2JQPA 5IMTD 1KS6A 4OM5A 2MFAA 1ONJA 1BTEA 1REWC 4KSNA 1FSCA 1F8UB 1CTXA 1KU6B 2UX2A 3BT2U 2QJAC 5DZ5A 2PJYC 1NYSA 1KFHA 1F94A 1B41B 1CXOA 2MJ0A 1JBDA 1VB0A 3NEQA 1FFJA 1YWHA 1UG4A 1IDGA 3KFDE 2LA1A 1JGKA 4EY8B 4FAOC 1CREA 2J8BA 4P7UA 1ABTA 1ZADA 3EVSC 1IDIA 3EBXA 1CVOA 1HAJA 1CDSA 2H7ZB 2QJBC 1IJCA 1CDRA 1MR6A 1IDLA 3U74U 1NTNA 1KL8A 2CTXA 2NBTA 2X8BB 1LX5B 2MHYA 1CXNA 2ERAA 2H64B 1BXPA 4RUDA 1TGXA 1XT3A 1KXIA 4BDTB 2H62C 2JVEA 1FASA 2BHIA 1CRFA 2HLRA 1NTXA 2VLWA 4BIKB 1FF4A 2ABXA 2GOOC 4HQPF 1IKCA 1IQ9A 1KBAA 1S4YA 1TXBA 1CDQA 3VTSA 1LXHA 2N99A 1RGJA 5EBXA 1TXAA 4OM4A 2UWRA 4QTIU 2MUOA 5DO6A 1M9ZA 2QJ9C 4DO8A 1DRSA 3LAQU 1KC4A 1HC9B 1QKDA 3KFDI 2BTXA 1JE9A 1FRAA 1QM7A 1QKEA 1MAHF 3PLCA 2MUPA 3NDSA 2K3GA 1CB9A 1NYUA 2H62D 2L03A 2LCRA 2FD6U 1CCQA 1KBTA 1PLOA 4FAOE 1ES7B 1IK8A 3QB4B 1LSIA 3U73U 2H7ZA 2CRTA 1HAAA 2MJYA 1TFSA 1KTZB 3FEVA 2QC1A 1NXBA 3ERAA 2CDXA
chains in the Genus database with same CATH topology
1L4WA 4ZQYA 1H0JA 2OFSA 2MJ4A 6EBXA 1FSSB 2HLQA 1LXGA 1CHVS 1LJZA 2CRSA 2H5FA 1HOYA 4AEAA 1ERGA 5IMYC 2I9BE 3HH7A 1G6MA 1IDHA 4LFTA 5DU1A 2CCXA 1NEAA 3NH7A 4IYEA 1CODA 2GOOB 2PJYB 1W6BA 1COEA 1KBSA 4UY2C 1I02A 3BT1U 2H64C 2H8UA 2L5SA 1HC9A 1NORA 1V6PA 1CDTA 1RL5A 1ERAA 4XJJA 2JQPA 5IMTD 1KS6A 4OM5A 2MFAA 1ONJA 1BTEA 1REWC 4KSNA 1FSCA 1F8UB 1CTXA 1KU6B 2UX2A 3BT2U 2QJAC 5DZ5A 2PJYC 1NYSA 1KFHA 1F94A 1B41B 1CXOA 2MJ0A 1JBDA 1VB0A 3NEQA 1FFJA 1YWHA 1UG4A 1IDGA 3KFDE 2LA1A 1JGKA 4EY8B 4FAOC 1CREA 2J8BA 4P7UA 1ABTA 1ZADA 3EVSC 1IDIA 3EBXA 1CVOA 1HAJA 1CDSA 2H7ZB 2QJBC 1IJCA 1CDRA 1MR6A 1IDLA 3U74U 1NTNA 1KL8A 2CTXA 2NBTA 2X8BB 1LX5B 2MHYA 1CXNA 2ERAA 2H64B 1BXPA 4RUDA 1TGXA 1XT3A 1KXIA 4BDTB 2H62C 2JVEA 1FASA 2BHIA 1CRFA 2HLRA 1NTXA 2VLWA 4BIKB 1FF4A 2ABXA 2GOOC 4HQPF 1IKCA 1IQ9A 1KBAA 1S4YA 1TXBA 1CDQA 3VTSA 1LXHA 2N99A 1RGJA 5EBXA 1TXAA 4OM4A 2UWRA 4QTIU 2MUOA 5DO6A 1M9ZA 2QJ9C 4DO8A 1DRSA 3LAQU 1KC4A 1HC9B 1QKDA 3KFDI 2BTXA 1JE9A 1FRAA 1QM7A 1QKEA 1MAHF 3PLCA 2MUPA 3NDSA 2K3GA 1CB9A 1NYUA 2H62D 2L03A 2LCRA 2FD6U 1CCQA 1KBTA 1PLOA 4FAOE 1ES7B 1IK8A 3QB4B 1LSIA 3U73U 2H7ZA 2CRTA 1HAAA 2MJYA 1TFSA 1KTZB 3FEVA 2QC1A 1NXBA 3ERAA 2CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4W A;  4ZQY A;  1H0J A;  2OFS A;  2MJ4 A;  6EBX A;  1FSS B;  2HLQ A;  1LXG A;  1CHV S;  1LJZ A;  2CRS A;  2H5F A;  1HOY A;  4AEA A;  1ERG A;  5IMY C;  2I9B E;  3HH7 A;  1G6M A;  1IDH A;  4LFT A;  5DU1 A;  2CCX A;  1NEA A;  3NH7 A;  4IYE A;  1COD A;  2GOO B;  2PJY B;  1W6B A;  1COE A;  1KBS A;  4UY2 C;  1I02 A;  3BT1 U;  2H64 C;  2H8U A;  2L5S A;  1HC9 A;  1NOR A;  1V6P A;  1CDT A;  1RL5 A;  1ERA A;  4XJJ A;  2JQP A;  5IMT D;  1KS6 A;  4OM5 A;  2MFA A;  1ONJ A;  1BTE A;  1REW C;  1FSC A;  1F8U B;  1CTX A;  1KU6 B;  2UX2 A;  3BT2 U;  2QJA C;  5DZ5 A;  2PJY C;  1NYS A;  1KFH A;  1F94 A;  1B41 B;  1CXO A;  2MJ0 A;  1JBD A;  1VB0 A;  3NEQ A;  1FFJ A;  1YWH A;  1UG4 A;  1IDG A;  3KFD E;  2LA1 A;  1JGK A;  4EY8 B;  4FAO C;  1CRE A;  2J8B A;  4P7U A;  1ABT A;  1ZAD A;  3EVS C;  1IDI A;  3EBX A;  1CVO A;  1HAJ A;  1CDS A;  2H7Z B;  2QJB C;  1IJC A;  1CDR A;  1MR6 A;  1IDL A;  3U74 U;  1NTN A;  1KL8 A;  2CTX A;  2NBT A;  2X8B B;  1LX5 B;  2MHY A;  1CXN A;  2ERA A;  2H64 B;  1BXP A;  4RUD A;  1TGX A;  1XT3 A;  1KXI A;  4BDT B;  2H62 C;  2JVE A;  1FAS A;  2BHI A;  1CRF A;  2HLR A;  1NTX A;  2VLW A;  4BIK B;  1FF4 A;  2ABX A;  2GOO C;  4HQP F;  1IKC A;  1IQ9 A;  1KBA A;  1S4Y A;  1TXB A;  1CDQ A;  3VTS A;  1LXH A;  2N99 A;  1RGJ A;  5EBX A;  1TXA A;  4OM4 A;  2UWR A;  4QTI U;  2MUO A;  5DO6 A;  1M9Z A;  2QJ9 C;  4DO8 A;  1DRS A;  3LAQ U;  1KC4 A;  1HC9 B;  1QKD A;  3KFD I;  2BTX A;  1JE9 A;  1FRA A;  1QM7 A;  1QKE A;  1MAH F;  3PLC A;  2MUP A;  3NDS A;  2K3G A;  1CB9 A;  1NYU A;  2H62 D;  2L03 A;  2LCR A;  2FD6 U;  1CCQ A;  1KBT A;  1PLO A;  4FAO E;  1ES7 B;  1IK8 A;  3QB4 B;  1LSI A;  3U73 U;  2H7Z A;  2CRT A;  1HAA A;  2MJY A;  1TFS A;  1KTZ B;  3FEV A;  2QC1 A;  1NXB A;  3ERA A;  2CDX A; 
#chains in the Genus database with same CATH topology
 1L4W A;  4ZQY A;  1H0J A;  2OFS A;  2MJ4 A;  6EBX A;  1FSS B;  2HLQ A;  1LXG A;  1CHV S;  1LJZ A;  2CRS A;  2H5F A;  1HOY A;  4AEA A;  1ERG A;  5IMY C;  2I9B E;  3HH7 A;  1G6M A;  1IDH A;  4LFT A;  5DU1 A;  2CCX A;  1NEA A;  3NH7 A;  4IYE A;  1COD A;  2GOO B;  2PJY B;  1W6B A;  1COE A;  1KBS A;  4UY2 C;  1I02 A;  3BT1 U;  2H64 C;  2H8U A;  2L5S A;  1HC9 A;  1NOR A;  1V6P A;  1CDT A;  1RL5 A;  1ERA A;  4XJJ A;  2JQP A;  5IMT D;  1KS6 A;  4OM5 A;  2MFA A;  1ONJ A;  1BTE A;  1REW C;  4KSN A;  1FSC A;  1F8U B;  1CTX A;  1KU6 B;  2UX2 A;  3BT2 U;  2QJA C;  5DZ5 A;  2PJY C;  1NYS A;  1KFH A;  1F94 A;  1B41 B;  1CXO A;  2MJ0 A;  1JBD A;  1VB0 A;  3NEQ A;  1FFJ A;  1YWH A;  1UG4 A;  1IDG A;  3KFD E;  2LA1 A;  1JGK A;  4EY8 B;  4FAO C;  1CRE A;  2J8B A;  4P7U A;  1ABT A;  1ZAD A;  3EVS C;  1IDI A;  3EBX A;  1CVO A;  1HAJ A;  1CDS A;  2H7Z B;  2QJB C;  1IJC A;  1CDR A;  1MR6 A;  1IDL A;  3U74 U;  1NTN A;  1KL8 A;  2CTX A;  2NBT A;  2X8B B;  1LX5 B;  2MHY A;  1CXN A;  2ERA A;  2H64 B;  1BXP A;  4RUD A;  1TGX A;  1XT3 A;  1KXI A;  4BDT B;  2H62 C;  2JVE A;  1FAS A;  2BHI A;  1CRF A;  2HLR A;  1NTX A;  2VLW A;  4BIK B;  1FF4 A;  2ABX A;  2GOO C;  4HQP F;  1IKC A;  1IQ9 A;  1KBA A;  1S4Y A;  1TXB A;  1CDQ A;  3VTS A;  1LXH A;  2N99 A;  1RGJ A;  5EBX A;  1TXA A;  4OM4 A;  2UWR A;  4QTI U;  2MUO A;  5DO6 A;  1M9Z A;  2QJ9 C;  4DO8 A;  1DRS A;  3LAQ U;  1KC4 A;  1HC9 B;  1QKD A;  3KFD I;  2BTX A;  1JE9 A;  1FRA A;  1QM7 A;  1QKE A;  1MAH F;  3PLC A;  2MUP A;  3NDS A;  2K3G A;  1CB9 A;  1NYU A;  2H62 D;  2L03 A;  2LCR A;  2FD6 U;  1CCQ A;  1KBT A;  1PLO A;  4FAO E;  1ES7 B;  1IK8 A;  3QB4 B;  1LSI A;  3U73 U;  2H7Z A;  2CRT A;  1HAA A;  2MJY A;  1TFS A;  1KTZ B;  3FEV A;  2QC1 A;  1NXB A;  3ERA A;  2CDX A; 
#chains in the Genus database with same CATH homology
 1L4W A;  4ZQY A;  1H0J A;  2OFS A;  2MJ4 A;  6EBX A;  1FSS B;  2HLQ A;  1LXG A;  1CHV S;  1LJZ A;  2CRS A;  2H5F A;  1HOY A;  4AEA A;  1ERG A;  5IMY C;  2I9B E;  3HH7 A;  1G6M A;  1IDH A;  4LFT A;  5DU1 A;  2CCX A;  1NEA A;  3NH7 A;  4IYE A;  1COD A;  2GOO B;  2PJY B;  1W6B A;  1COE A;  1KBS A;  4UY2 C;  1I02 A;  3BT1 U;  2H64 C;  2H8U A;  2L5S A;  1HC9 A;  1NOR A;  1V6P A;  1CDT A;  1RL5 A;  1ERA A;  4XJJ A;  2JQP A;  5IMT D;  1KS6 A;  4OM5 A;  2MFA A;  1ONJ A;  1BTE A;  1REW C;  4KSN A;  1FSC A;  1F8U B;  1CTX A;  1KU6 B;  2UX2 A;  3BT2 U;  2QJA C;  5DZ5 A;  2PJY C;  1NYS A;  1KFH A;  1F94 A;  1B41 B;  1CXO A;  2MJ0 A;  1JBD A;  1VB0 A;  3NEQ A;  1FFJ A;  1YWH A;  1UG4 A;  1IDG A;  3KFD E;  2LA1 A;  1JGK A;  4EY8 B;  4FAO C;  1CRE A;  2J8B A;  4P7U A;  1ABT A;  1ZAD A;  3EVS C;  1IDI A;  3EBX A;  1CVO A;  1HAJ A;  1CDS A;  2H7Z B;  2QJB C;  1IJC A;  1CDR A;  1MR6 A;  1IDL A;  3U74 U;  1NTN A;  1KL8 A;  2CTX A;  2NBT A;  2X8B B;  1LX5 B;  2MHY A;  1CXN A;  2ERA A;  2H64 B;  1BXP A;  4RUD A;  1TGX A;  1XT3 A;  1KXI A;  4BDT B;  2H62 C;  2JVE A;  1FAS A;  2BHI A;  1CRF A;  2HLR A;  1NTX A;  2VLW A;  4BIK B;  1FF4 A;  2ABX A;  2GOO C;  4HQP F;  1IKC A;  1IQ9 A;  1KBA A;  1S4Y A;  1TXB A;  1CDQ A;  3VTS A;  1LXH A;  2N99 A;  1RGJ A;  5EBX A;  1TXA A;  4OM4 A;  2UWR A;  4QTI U;  2MUO A;  5DO6 A;  1M9Z A;  2QJ9 C;  4DO8 A;  1DRS A;  3LAQ U;  1KC4 A;  1HC9 B;  1QKD A;  3KFD I;  2BTX A;  1JE9 A;  1FRA A;  1QM7 A;  1QKE A;  1MAH F;  3PLC A;  2MUP A;  3NDS A;  2K3G A;  1CB9 A;  1NYU A;  2H62 D;  2L03 A;  2LCR A;  2FD6 U;  1CCQ A;  1KBT A;  1PLO A;  4FAO E;  1ES7 B;  1IK8 A;  3QB4 B;  1LSI A;  3U73 U;  2H7Z A;  2CRT A;  1HAA A;  2MJY A;  1TFS A;  1KTZ B;  3FEV A;  2QC1 A;  1NXB A;  3ERA A;  2CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...