1VBA4

Poliovirus (type 3, sabin strain) (p3/sabin, p3/leon/12a(1)b) complexed with r78206
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
62
Chain Sequence
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vba400
1OOPD 1K5MD 1RUG4 4PDWD 1VBB4 1RUJ4 1VRH4 1Z7S4 1PVC4 2R064 1BEV4 1HXS4 1PO14 1RUH4 1EV14 2PLV4 2HWC4 1HRV4 2R044 1VBE4 1NA1D 1AR84 1AR74 1ASJ4 1D4M4 1MQTD 2RS54 3J8F4 1NCQD 1RUE4 4Q4X4 1RUC4 1PO24 2HWB4 1VBC4 3JBG4 1HRI4 4Q4V4 1H8TD 4Q4W4 4GB34 1COV4 1RMU4 2RR14 1PIV4 4Q4Y4 1R094 1RUD4 2R074 1AL24 1R084 1RUF4 2RS34 3JD74 1AR64 2RS14 1RUI4 2X5ID 1AR94 4RHV4 1POV0 1VBA4 1EAH4 2RMU4 1VBD4 2RM24 1RHI4 1RVF4
chains in the Genus database with same CATH superfamily
1OOPD 2WDQA 3P4RA 1RUG4 1PVC4 2WU2A 1HXS4 1KF6A 3P4QA 2PLV4 3SFDA 4YTPA 1NENA 1AR84 3AEFA 3JBG4 3AE3A 4Q4W4 2PW9A 4GB34 1YQ4A 1COV4 1ZP0A 3AE5A 3FI7A 4YSZA 3JD74 2WDVA 3AEDA 3AEGA 1YQ3A 3AE8A 3AE2A 3SFEA 2WS3A 1EAH4 2RM24 2H88A 1RVF4 1K5MD 4YTNA 1Z7S4 1BEV4 2R7FA 3AE6A 1PO14 1HRV4 3VR8A 1NA1D 1NEKA 2WQYA 3VR9A 1NCQD 3AEBA 2HWB4 2PYJA 3AE4A 2EX3A 1RMU4 2WDRA 4Q4Y4 1RUD4 3GQHA 3AE7A 1XHXA 2RS14 2X5ID 2WP9A 3AEEA 2PYLA 4Q4V4 3AE1A 3AEAA 4YTMA 1VBB4 1VRH4 2R064 1RUH4 1EV14 2HWC4 1VBE4 3VRAA 1AR74 1MQTD 2RS54 1L0VA 3AECA 1PO24 3CIRA 3VRBA 1VBC4 3P4PA 4YSXA 2PY5A 2RR14 1PIV4 5C3JA 4YSYA 2R074 5C2TA 1R084 1RUF4 1AR64 1POV0 1VBA4 2WU5A 1VBD4 4YT0A 3P4SA 1RHI4 1ZOYA 3ABVA 2H89A 4PDWD 1RUJ4 2ACZA 1XHZA 4YXDA 2B76A 2R044 1ASJ4 1D4M4 3J8F4 1RUE4 4Q4X4 1RUC4 2PZSA 1HRI4 1H8TD 1KFYA 2FBWA 1R094 3SUCA 1AL24 2RS34 4KX6A 1RUI4 4RHV4 1AR94 1XI1A 2RMU4 3AE9A 3GQKA
chains in the Genus database with same CATH topology
1OOPD 1K5MD 1RUG4 4PDWD 1VBB4 1RUJ4 1VRH4 1Z7S4 1PVC4 2R064 1BEV4 1HXS4 1PO14 1RUH4 1EV14 2PLV4 2HWC4 1HRV4 2R044 1VBE4 1NA1D 1AR84 1AR74 1ASJ4 1D4M4 1MQTD 2RS54 3J8F4 1NCQD 1RUE4 4Q4X4 1RUC4 1PO24 2HWB4 1VBC4 3JBG4 1HRI4 4Q4V4 1H8TD 4Q4W4 4GB34 1COV4 1RMU4 2RR14 1PIV4 4Q4Y4 1R094 1RUD4 2R074 1AL24 1R084 1RUF4 2RS34 3JD74 1AR64 2RS14 1RUI4 2X5ID 1AR94 4RHV4 1POV0 1VBA4 1EAH4 2RMU4 1VBD4 2RM24 1RHI4 1RVF4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOP D;  1K5M D;  1RUG 4;  4PDW D;  1VBB 4;  1RUJ 4;  1VRH 4;  1Z7S 4;  1PVC 4;  2R06 4;  1BEV 4;  1HXS 4;  1PO1 4;  1RUH 4;  1EV1 4;  2PLV 4;  2HWC 4;  1HRV 4;  2R04 4;  1VBE 4;  1NA1 D;  1AR8 4;  1AR7 4;  1ASJ 4;  1D4M 4;  1MQT D;  2RS5 4;  3J8F 4;  1NCQ D;  1RUE 4;  4Q4X 4;  1RUC 4;  1PO2 4;  2HWB 4;  1VBC 4;  3JBG 4;  1HRI 4;  4Q4V 4;  1H8T D;  4Q4W 4;  4GB3 4;  1COV 4;  1RMU 4;  2RR1 4;  1PIV 4;  4Q4Y 4;  1R09 4;  1RUD 4;  2R07 4;  1AL2 4;  1R08 4;  1RUF 4;  2RS3 4;  3JD7 4;  1AR6 4;  2RS1 4;  1RUI 4;  2X5I D;  1AR9 4;  4RHV 4;  1POV 0;  1VBA 4;  1EAH 4;  2RMU 4;  1VBD 4;  2RM2 4;  1RHI 4;  1RVF 4; 
#chains in the Genus database with same CATH topology
 1OOP D;  2WDQ A;  3P4R A;  1RUG 4;  1PVC 4;  2WU2 A;  1HXS 4;  1KF6 A;  3P4Q A;  2PLV 4;  3SFD A;  4YTP A;  1NEN A;  1AR8 4;  3AEF A;  3JBG 4;  3AE3 A;  4Q4W 4;  2PW9 A;  4GB3 4;  1YQ4 A;  1COV 4;  1ZP0 A;  3AE5 A;  3FI7 A;  4YSZ A;  3JD7 4;  2WDV A;  3AED A;  3AEG A;  1YQ3 A;  3AE8 A;  3AE2 A;  3SFE A;  2WS3 A;  1EAH 4;  2RM2 4;  2H88 A;  1RVF 4;  1K5M D;  4YTN A;  1Z7S 4;  1BEV 4;  2R7F A;  3AE6 A;  1PO1 4;  1HRV 4;  3VR8 A;  1NA1 D;  1NEK A;  2WQY A;  3VR9 A;  1NCQ D;  3AEB A;  2HWB 4;  2PYJ A;  3AE4 A;  2EX3 A;  1RMU 4;  2WDR A;  4Q4Y 4;  1RUD 4;  3GQH A;  3AE7 A;  1XHX A;  2RS1 4;  2X5I D;  2WP9 A;  3AEE A;  2PYL A;  4Q4V 4;  3AE1 A;  3AEA A;  4YTM A;  1VBB 4;  1VRH 4;  2R06 4;  1RUH 4;  1EV1 4;  2HWC 4;  1VBE 4;  3VRA A;  1AR7 4;  1MQT D;  2RS5 4;  1L0V A;  3AEC A;  1PO2 4;  3CIR A;  3VRB A;  1VBC 4;  3P4P A;  4YSX A;  2PY5 A;  2RR1 4;  1PIV 4;  5C3J A;  4YSY A;  2R07 4;  5C2T A;  1R08 4;  1RUF 4;  1AR6 4;  1POV 0;  1VBA 4;  2WU5 A;  1VBD 4;  4YT0 A;  3P4S A;  1RHI 4;  1ZOY A;  3ABV A;  2H89 A;  4PDW D;  1RUJ 4;  2ACZ A;  1XHZ A;  4YXD A;  2B76 A;  2R04 4;  1ASJ 4;  1D4M 4;  3J8F 4;  1RUE 4;  4Q4X 4;  1RUC 4;  2PZS A;  1HRI 4;  1H8T D;  1KFY A;  2FBW A;  1R09 4;  3SUC A;  1AL2 4;  2RS3 4;  4KX6 A;  1RUI 4;  4RHV 4;  1AR9 4;  1XI1 A;  2RMU 4;  3AE9 A;  3GQK A; 
#chains in the Genus database with same CATH homology
 1OOP D;  1K5M D;  1RUG 4;  4PDW D;  1VBB 4;  1RUJ 4;  1VRH 4;  1Z7S 4;  1PVC 4;  2R06 4;  1BEV 4;  1HXS 4;  1PO1 4;  1RUH 4;  1EV1 4;  2PLV 4;  2HWC 4;  1HRV 4;  2R04 4;  1VBE 4;  1NA1 D;  1AR8 4;  1AR7 4;  1ASJ 4;  1D4M 4;  1MQT D;  2RS5 4;  3J8F 4;  1NCQ D;  1RUE 4;  4Q4X 4;  1RUC 4;  1PO2 4;  2HWB 4;  1VBC 4;  3JBG 4;  1HRI 4;  4Q4V 4;  1H8T D;  4Q4W 4;  4GB3 4;  1COV 4;  1RMU 4;  2RR1 4;  1PIV 4;  4Q4Y 4;  1R09 4;  1RUD 4;  2R07 4;  1AL2 4;  1R08 4;  1RUF 4;  2RS3 4;  3JD7 4;  1AR6 4;  2RS1 4;  1RUI 4;  2X5I D;  1AR9 4;  4RHV 4;  1POV 0;  1VBA 4;  1EAH 4;  2RMU 4;  1VBD 4;  2RM2 4;  1RHI 4;  1RVF 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...