1VBD1

Poliovirus (type 1, mahoney strain) complexed with r78206
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
283
structure length
283
Chain Sequence
b'AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 1 MAHONEY
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1vbd100
1MEC1 1PGL2 1ZBE2 2HWC1 3VBOC 1ZBA1 2MEV1 5D8AC 5C4WB 1HX6A 1CD3G 2WFF2 3JBG2 4IV1C 1ND3C 1VBE1 4GB32 4YVSC 1PVC3 1NY71 1WCDJ 1AR73 5L7OC 5D8AB 4EJRA 1VB4A 1M06G 1OOPC 2ZTNA 4IV1B 1ND3B 1EV13 4YVSB 1IHMA 1RVF2 5L7OB 5BNNC 1QJU3 2Y26A 1FPN1 3VBHC 1TMF1 1OOPB 1FOD2 4CDUC 1RMU1 4GMP1 5FOJB 3M8LA 2R072 5DDJ1 2RS13 1BMV1 3VBRB 1X36A 5BNNB 3VBHB 1VRH1 1POV0 4CDUB 2QQPA 1HXS3 1V9U2 2WWSA 2R063 5A32B 1RUI1 3J8F1 3NAPC 1RUJ3 1ZBE3 4WM7A 2HWE1 3JBG3 4Q4X1 4QPIA 1PO11 2PLV1 1VBC3 3NAPB 2WS92 2RMU2 4WM8C 5JZGC 5CFDC 3HAGA 1R083 3VBSA 1PVC1 1BEV3 1AYN3 4WM8B 1POV3 5C8CA 5JZGB 2HWD2 1D4M2 1RVF3 5CFDB 1C8M2 1H8TB 4RQPC 1EAH1 1RB8G 5K0UA 1RUD2 4FTSA 2FZ1A 1VBD3 1EV11 4Q4W1 1HRI2 3TN92 4RHV2 1QJU1 4JGYC 4RQPB 4CEYA 2DF7A 4CDWC 1PIV2 1HQNA 4SBVA 3ZFEB 2RS11 1HRV2 2RS52 1RUF2 4CDQA 1TME2 4JGYB 5ABJC 4IV3C 3ZFFC 4Z92B 1HXS1 4QPGA 4N53B 1QJY3 2R061 1RUJ1 3ZFGB 5J98B 1BBT3 5ABJB 3ZFFB 1VBB3 3JBG1 4CEWC 1VBC1 2HWF2 5ACA1 1AYM2 3JD72 3DPRA 2HWD3 1K5MC 1B35A 1PGW1 5C9AC 1R081 1RUD3 4RR3A 1BEV1 1AR62 1AYN1 1RUC3 1POV1 1R093 1RVF1 1QJX2 1K5MB 2XBO3 3VBUC 1NOVA 5C9AB 1RUE2 5BNPC 1VBD1 4N43A 2RR12 1FMD3 2WZR2 4YVWB 1COV2 3VBUB 1RUG2 2ZAHA 4RFT0 5BNPB 2TBVA 3VDDC 5C4WA 4AEDA 3VBOB 4Q4V2 3VBFC 2HWB2 1QJY1 3VDDB 5AC92 1AR82 1DDLA 1BBT1 2RM23 4FTBA 2BPA2 1VBB1 4YVSA 2R043 1QQP3 3VBFB 1AR93 4LLFA 1RHI3 1PO23 1R1A2 1OOPA 2HWD1 1AL22 1VBA2 1RUH3 3VBRA 4Q4Y2 1MQTA 1Z7S2 1SMVA 1RUC1 1R091 3IDEA 1X33A 4CDUA 2XBO1 1COV3 5A32A 4JGZA 2RS32 2WFF3 1AUYA 5CFCA 1FMD1 1MEC2 4GB33 2HWC2 5J96B 2MEV2 3S6PA 1VBE2 1CJDA 4FTEA 1NY72 1AR71 1NCRA 5GKAC 1ND2C 3VBSC 4WM8A 1FOD3 5C8CC 5CFDA 1H8TA 2R073 4PDWA 2RM21 2IZWA 2R041 5BNOA 1FPN2 1ND2B 1QQP1 3VBSB 1TMF2 1NCQC 5C8CB 4Q4Y3 1AR91 1RMU2 4RS5C 1RHI1 1V9U3 1PO21 4CEYC 5DDJ2 1BMV2 1RUH1 3ZFEA 1VB2A 1NCQB 2BFUL 4CDWB 5A33B 3CJIA 4RS5B 4CDQC 4BCUA 1PGL1 1ZBE1 1RUI2 3J8F2 2WS93 4FSJA 2RMU3 1COV1 4N53A 2HWE2 4IV3B 1ASJ2 3ZFGA 1NA1A 2WFF1 4Q4X2 4CDQB 4GB31 3ZFFA 1PO12 2PLV2 1D4M3 1GFF2 1C8M3 3JB8A 4CEWB 2XPJA 1B35C 2X5IA 1F2NA 1HRI3 3FBMA 3TN93 4RHV3 2BUKA 4RR3C 1EAH2 2ZZQA 5LK7B 1FOD1 4CDXA 1PIV3 1EV12 4Y5Z0 2R071 4Q4W2 1HRV3 2RS53 4GH4C 1RUF3 1TME3 4YVWA 4N43C 4Q4Y1 1V9U1 2RS12 5BNPA 4GH4B 4AEDC 1ASJ3 4N43B 3VBOA 1HXS2 5D8AA 2R062 2HWF3 1PO13 1RUJ2 2PLV3 2WS91 2RMU1 3VDDA 4IV1A 1AYM3 3JD73 1ND3A 4AEDB 5L7OA 1C8NA 1VBC2 1AR63 3VBFA 5ACA2 3LOBA 1D4M1 1AL0G 1QJX3 1C8M1 1PGW2 1EAH3 1R082 1RUD1 1RUE3 1F8VA 5BNNA 3VBHA 1HRI1 1BEV2 4Q4W3 1AYN2 2BFUS 2RR13 2WZR3 4NWVA 3VBRC 3TN91 4RHV1 3ZXAC 1MQTC 1RUG3 4WM7C 1PIV1 1VBD2 2VQ0A 1HRV1 2RS51 1ZBA2 1RUF1 1MQTB 1TME1 4JGZC 4QPIC 4Q4V3 5CFCC 3NAPA 4WM7B 2HWB3 2WLPA 5AC93 1AR83 5FMOS 4JGZB 4QPIB 5CFCB 1ASJ1 2FZ2A 5JZGA 1NCRC 1QJY2 2HWF1 5K0UC 5ACA3 1BBT2 1AYM1 1R1A3 3JD71 1AL23 2GSYA 1H8TC 1VBA3 1A6CA 1VBB2 1W39A 4PDWC 1NCRB 1Z7S3 4RQPA 1AR61 4Y4YA 1ND2A 5BNOC 2BBVA 5K0UB 1VAKA 1QJX1 1RUE1 1NG0A 4PDWB 1VRH2 2RS33 4JGYA 5BNOB 3ZFEC 4CEYB 1RUC2 2RR11 2WZR1 1MEC3 1NCQA 1R092 4CDWA 2HWC3 5A33A 1ZBA3 2XBO2 4QPGC 4RS5A 2MEV3 3CJIC 1RUG1 4GMP0 2GH8A 3JB4C 4NWWA 4N53C 5ABJA 4IV3A 1VBE3 1FMD2 3ZFGC 1NA1C 4QPGB 3CJIB 4Q4V1 2HWB1 5FMOL 3DPRC 5AC91 1AR81 1PVC2 4CEWA 1AR72 1QJZA 1NA1B 1E57A 2X5IC 1FPN3 1TMF3 1K5MA 3DPRB 1RMU3 1B35B 4GMP3 5C9AA 1R1A1 5DDJ3 1AL21 2RM22 4CDXC 1QJU2 1VBA1 1OPOA 4RR3B 2R042 2X5IB 1QQP2 1VRH3 1Z7S1 3VBUA 1AR92 1RHI2 1PO22 1RUI3 3J8F3 4YVWC 4CDXB 1RUH2 2HWE3 5C4WC 4GH4A 1OHFA 2RS31 4Q4X3
chains in the Genus database with same CATH superfamily
1LODA 1DYOA 1WMXA 3EQEA 4CCDA 1H30A 4RSUA 5C70A 1PGL2 2GC2A 2HWC1 2WDBA 1ZBA1 4LORA 5FZAA 3USUB 3ZN4A 1BQPA 5D8AC 5C7GA 5C3QA 1QU0A 1ZZ8A 4BZ4A 3T2TA 3O14A 2XWBB 4AHYA 4DMIA 3S57A 2VG9A 4F7ZA 3N7KA 2Z79A 1H2NA 4YVSC 3OD4A 1T2XA 3WNKA 1NY71 3ME2A 3AZVA 1KS4A 1WCDJ 4I0AA 3IN9A 4Q8KA 1QXRA 3GZUC 2W1SA 3NO8A 5FRAA 1M06G 1YFUA 2XKPA 2BNMA 4XDQA 5D1IA 2PHFA 4DEVA 1EV13 1ULPA 1KJLA 4COVA 4FP3A 1OI6A 4B8EA 1W0PA 3DL3A 1RVF2 2IXCA 3ZXKA 1LOFC 1QOTA 5F6LB 1TMF1 3CO2A 2ZXQA 3K77A 5B2GB 1SCRA 1G9DA 2CWMA 4GMP1 5IK8A 1A34A 4BK5A 3AMMA 2RS13 4FCAA 4D94A 4KI5M 3ZMNA 2H0BA 2W47A 2VQTA 5J36A 1UU4A 2JG8A 1QGLA 3VBHB 1UPSA 2ZMLA 5FZEA 3CIHA 2R0FA 2E53A 4WBBA 1HXS3 3LD8A 1T6BX 4MX3A 5KXEA 1IG0A 1P8JA 3UESA 4AFBA 3AJYA 4UFMA 4CCEA 4WM7A 2D98A 5E1RA 4ZHNA 5DMYA 1RITA 3JCIA 4Y5SA 5JSOA 2XGXA 1F9KA 2RG4A 2YXSA 4NMIA 1FNZA 3JBG3 3CBNA 1YO8A 2DFCA 1LHUA 5K9YA 4CXYA 1IQDC 1VJ2A 4XQWA 3KGZA 3PMEA 3BN6A 3MIHA 2H6CA 2BDRA 1M4WA 4BE3A 2E26A 1BEV3 4FOVA 4YGEA 3O7OA 4MG2A 5C3RA 2DCJA 1RB8G 4RQPC 1EAH1 2ADDA 2NMOA 4QDSA 5K0UA 2PFWA 4HXCA 3HPNA 4FTSA 1QOSA 4HETA 4TTGA 1HRI2 4OYUA 2DVBA 3MLLA 2Y6HA 1W0OA 1XYPA 3QD6A 5H9QA 4NIIA 1QJU1 1WW4A 2WIIB 4LK7A 4Y24A 3X29B 3ZM8A 2ZBJA 4ZXKA 3U14A 2JD9A 2ZEYA 1YQ6A 4RD7A 4Y20B 3NNJA 1PIV2 3ELNA 4ZZ8A 2RHPA 2MHFA 3RZLA 4FPCA 3PTYA 4Q0VA 1JZ3A 1GZCA 1WD4A 4FPEA 3VDBA 3SLIA 3FBYA 4JGYB 4D6SA 4E4ZA 1UX7A 4D7SA 1KJRA 4Z92B 1CPMA 1DIWA 1W0NA 2WSUA 3BI3A 4PI0A 1O3RA 2R061 1S0GA 1O4TA 4Y26A 2C9AA 3RFRA 4IERA 1O91A 1JI6A 4LA2A 1LJ7A 1BBT3 1XSRA 2QVSB 2WWUA 3K4DA 2P3YA 5EYXA 3HBKA 2BBAA 5F6KA 2H0VA 3AL5A 4Z8BA 3UKVA 2H6BA 3B69A 4YRDA 4MGTA 3NV1A 1DQ5A 1TEIA 2IWGB 1ZZ9A 1LEMA 3MIBA 5F8PA 2OYZA 5FYSA 3THDA 3UYJA 4AVVA 4EWDA 5ACA1 2VW2A 1JBCA 1HB4A 2GNDA 1PK6C 4U36A 4COZA 1NQJA 3NW4A 5CG8A 1R081 3D5OA 3I2FA 3EMRA 2WLQA 4LHKA 4GQ7A 5HCHA 4ISRA 3CNAA 2JDAA 3ZYFA 3O0WA 4YW1A 2ARAA 1I6XA 2NM1A 1C57A 1CAVA 2WNOA 3AC0A 4QQOA 3THCA 1RVF1 1K5MB 4CXWA 2FCTA 5C9AB 3ZR6A 3D6EA 4NO4A 2CAUA 1H8VA 3FWEA 1VBD1 3POSA 4IEVA 4YM2A 3VGIA 3B02A 2PAKA 2VXJA 4IEWA 5F39A 1X9TA 1YFWA 3UK9A 1C28A 2BP6A 1COV2 1GUIA 3VBUB 2IUWA 1V0AA 4I2OA 3HEIA 3KZ4C 3N36A 5FDBA 3RI8A 1IKQA 1W6QB 3UV9A 3T2OA 1N1SA 1K5JA 5C4WA 4AEDA 1LHNA 3POIA 5IVYA 3OTFA 3W5MA 2JXAA 5B4XA 1N1TA 1T6GC 3NJYA 2A5ZA 2E33A 3MUZ1 3B5LB 3VBFC 3H1WA 5A1FA 1QJY1 3VDDB 4AR2A 4ZS3A 3GALA 3IMNA 3RZJA 2Z5WA 4HPKB 4F3JA 5LZ6A 5LRSA 1US3A 1OUXA 2B9VA 2RM23 5FZ8A 4UW6A 4FPLA 4BQYA 1BVVA 1UZWA 3J26N 4P9GA 1VBB1 4UW4A 4UAPA 2R043 1GU3A 4LKDA 4QMAA 5CBLA 3M70A 1ZX5A 2RV9A 5KHGA 2YU1A 1PHMA 4LLFA 5FY4A 3WQ0A 5FXZA 3O1UA 1W90A 4A6OA 1JZ5A 5DAWA 3AZZA 5HPOA 5JPMB 4CE8A 4NIGA 1V00A 4PT6A 3ZKYA 3ZYBA 4CRQA 3VBRA 4D3WA 2MNGA 3RJRA 3DKQA 2ZS6B 3LCPA 2R32A 2W87A 2JG8C 3OGJA 1SMVA 1RUC1 4NAOA 5F1RA 3VKOA 4BB3A 1RINA 1BHGA 3IIIA 4E27A 2YFZA 1MS0A 5A32A 2DYCA 5IW0A 3MF6A 4BOWA 2JEMA 1U0AA 4JGZA 2WFF3 1BCXA 3PL0A 3VKMA 1MZEA 2JE7A 2WA3A 4HVQA 2QQUA 2DBIA 4WVWA 2X10A 2WJSA 5T52A 2ZX3A 4QHOA 1H2MA 2MEV2 3K2OA 4FPFA 4AEKA 1OLME 4ES8A 2SBAA 3PURA 4K1YA 3QCWA 2E6VA 2ADEA 1XU2A 4DEQA 4AHZA 3N9QA 2BGOA 4MUVA 5A3MA 1S0EA 3TN92 4D6RA 1G9BA 1S2EA 3HQRA 4R4ZA 3AZYA 2JB4A 3J7LA 3ASIA 1RJ7A 1LHVA 2ZCWA 4P00B 5DAXA 4A7ZA 4BMBA 2VOXA 1OF3A 1ULGA 3DKWA 3W5NA 2BOJA 4WM8A 2WINB 3UNPA 4E4SA 2WN3A 1H8TA 2AC1A 5EYYA 2EVXA 2GP5A 1TZOA 3PIGA 3BTAA 2X05A 4A2UA 3T0AA 2IZWA 1V6KA 5FY8A 3MZHA 1KDMA 1QQP1 1ND2B 2ZEZA 2BZDA 3WW4A 2PN5A 2VZTA 1S55A 1S0FA 3MICA 1ONAA 2VCMA 5DXDA 1RMU2 1FI2A 1RHI1 1V9U3 2VMIA 4QQLA 3THTA 2FDGA 1ULFA 3ZXGA 2ZEWA 1L3JA 5DDJ2 1JU3A 1SACA 3KT1A 3U75A 1RUH1 3UT0A 4MOAA 3C3VA 4CCLA 1VB2A 1XBFA 1LOEA 1NCQB 2EA7A 4KH9A 5H9RA 5A33B 4CP1A 4RS5B 1HIXA 4UYBA 2GNTA 4K8FA 4PLOA 5DZGA 5K4LA 3ZLIA 4BCUA 4CCMA 4CP0A 4AFDA 3RZHA 3WW2A 4Z2WA 2RMU3 1COV1 2CGPA 1GSLA 2HWE2 4KG0A 5A7QA 4XCAA 2JG9A 1I3HA 1JUIA 1LENA 3T4HB 1IZ3A 5LWBA 2BERA 1QDCA 4Q4X2 1DZRA 4TN7A 1SZBA 2BVBA 4XTMA 2VOWA 4CDQB 3MIDA 2F17A 3RYPA 2Z4FA 4BH9A 3W9AA 2YV8A 4QGNA 1D4M3 5IVEA 1W99A 1GFF2 1C8M3 5EQUA 2KM2A 3ROUA 2PHLA 1J83A 2BU9A 3E5XA 3LWCA 1K45A 2VOVA 4QAWA 1QKQA 1PX3A 4BDVB 1F2NA 1YCIA 5LEJA 1W04A 3M3CA 4RHV3 4X8NA 3GNEA 1QDOA 4XURA 2B5HA 3PUSA 2WRAA 2VMDA 4XFCA 3VD4A 1KD7A 4CDXA 1XU1A 1UZVA 5FO9B 1EV12 3J9SA 4Y5Z0 1Q8OA 2P6HA 2R071 3LGRA 4TLFA 4OQ9A 4EE2A 2Q8EA 5I0SA 1RUF3 4INDA 3H42B 2XJUA 3ACHA 4KWLA 2FBEA 3USUA 3EBRA 2WNUA 2A3YA 2GAUA 4AG4A 4CVUA 1QXJA 2RS12 3KF3A 4HKOA 2VW0A 4YZ5A 5CISA 2YGLA 3FE5A 3KVBA 4LHSA 4DY3A 4AEDC 3FLTA 4JV4A 1U5YA 4KU7A 4N43B 4XUTA 1HXS2 1YWKA 2E51A 5A3TA 1YQ5A 4MH0E 4GZ9A 3LQCA 5LRRA 1AHSA 2HWF3 4FXKB 3C7EA 4AI1A 3DF0A 1AYM3 3JD73 3EJKA 4NIAA 1OD5A 4AXOA 5FXWA 5I8TA 5F3EA 2CGNA 3QOPA 2J1TA 5JUVA 3RSJA 1AL0G 1QJX3 5T5LA 2D6PA 5LEKA 3UL2A 1EAH3 1IGOA 1RUD1 1RUE3 2O14A 3GZTB 3HNMA 3IBMA 2CWSA 4HKLA 1HQLA 4PBPA 2WC2A 3VHPA 1AX1A 2LROA 3I2JA 4DFSA 5DUUA 2D5HA 3VBHA 1BEV2 3ZIWA 4JRLA 2WZR3 1GBGA 3VBRC 2R6QA 4GWJA 3RZGA 2CV6A 2W3JA 2WQ4A 3DN7A 4Q26A 4UXAA 3U10A 5JPNB 2ZGRA 3HJRA 5TSWA 2A6WA 2GC1A 3BB6A 1MS5A 2BOIA 3BIWE 4IEZA 3HD8B 1TNRA 1YIPA 2ZACA 3OCPA 3I2OA 2OW4A 3RQ0A 5FZLA 4JGZC 1TME1 4OHXA 5A3LA 3RWKX 4CCKA 3HT2A 1X7NA 5SV5A 2QZ3A 4WM7B 4JDOA 4ATFA 5CYYA 5FZ7A 1CQ9A 4XETA 5FK8A 3ZIXA 5JXIA 1CX4A 1W6NB 4K7JA 4NVPA 4S2HA 2V72A 4XHBA 3WG2A 2Y0OA 3K3NA 1JZ6A 1RIRA 4UT5A 3DYPA 5CFCB 3WW1A 2ZA9A 2WNVA 3ACFA 2VZSA 4V1PA 4CXXA 4E4DX 1SLIA 4DXTA 1LULA 2ZJCA 4LHNA 5I0TA 5A7PA 3CJXA 4XAEA 1KFUL 3KCYA 1ODMA 1UY4A 1OFNA 2BTVC 2FMDA 4YGCA 5ACA3 1BBT2 2BEOA 3O12A 2XKOA 5I0UA 1AL23 2TNFA 2VULA 1CJPA 1H8TC 1PMHX 1VBA3 3AYAA 4XVHA 1WCQA 2PA7A 4M3CF 4R8HA 2ARCA 1NCRB 3J7NA 3Q8CA 4OHWA 3D0JA 1Z7S3 5FAXA 5JOXA 3LDRA 1AR61 1UWWA 5L19A 5K0UB 5LBCA 3WG3A 2EXKA 4XZUG 5LBEA 2WSVA 3VKFC 3A0NA 4CU7A 3K4AA 2VMHA 4KGGA 4PDWB 1H1MA 5FYUA 1ENRA 5T5PA 1UU6A 3LEKA 4BQWA 1Q5OA 4AEJA 2RS33 4JGYA 1HW5A 4KGQA 5KHIA 3A23A 5EWSA 4M0HA 2RR11 4QQPA 1MEC3 5GJ6A 4QPGC 2B39A 3TEZA 1RUG1 1UL9A 2I74A 4EWAA 3LZZA 1YQCA 1ZA7A 4MGYE 4P5YA 3RYKA 1MZFA 3ZPOA 3WP5A 4HG6B 1HV0A 4NWWA 3BU0A 4N7IA 4L0PA 3RYRA 1OQDA 1RGSA 3L9JT 3I54A 3VZOA 2JG9C 4YARA 3K3OA 1WCKA 4LKFA 4MGKE 2ENRA 3KV5A 3ZYGA 1WKYA 2VZRA 1RXGA 2W95A 2OT7A 3M4FA 3POYA 1PM7A 2E31A 5FMOL 5IAVA 1GOGA 2A6VA 4PHZA 3T2QA 2ZGOA 3WLUA 2EXIA 1AR72 2GZWA 1JU4A 1YRZA 2A6XA 3PLQA 4RFRB 5T50A 2X53S 3ORJA 1ZYBA 2A71A 3ECQA 4P14A 2BV4A 4M00A 1SFNA 5GLUA 1K5MA 2QDRA 3I3BA 3T3YA 2VAUA 3WG4A 3WNMA 5C9AA 4IGQA 1H1AA 1Q43A 2VQAA 4Y1VA 1R1A1 2AEYA 5FMCA 2ARBA 2RM22 4CDXC 1OPOA 2R042 4MXWB 1CAVB 1VRH3 3GM8A 4TYSA 3WF2A 4L92A 3VBUA 3LFIA 5GZFA 1Y4WA 4YG0A 3J8F3 1Z0HA 1WMFA 1W6QA 4NE9A 5FZ6A 3FHIB 4M3CE 3GF6A 4XACA 4X8PA 5KXDA 4EN9B 5IK5A 1C5HA 3H0OA 3OEAA 4R52A 4D7YA 4UWDA 2VTFA 1RL3A 3MUY1 4AGVA 1ZBE2 4UBHA 2VMGA 5F5CA 1OQEA 3DV8A 1JYXA 3FMGA 2A6ZA 4BQ3A 2JDUA 3IDBB 4HPKA 1HX6A 4OZOA 3DUIA 1J58A 5FZCA 3AP4A 1CD3G 2WFF2 5CZKA 2P34A 5GLWA 1SBDA 1W3VA 3HQXA 1VBE1 1CR7A 1WMDA 4QX1A 1DGRN 4URTA 1R1ZA 1W8TA 1PVC3 4BHPA 5CAZA 3BIEA 5IVCA 3GJBA 1HJFA 1J3RA 2EF6A 4LBQB 5FUNA 2W68A 1YJLA 4K9SA 2QQKA 3O1MA 2P3IA 4IV1B 2ZX0A 4QGMA 3SCFA 4FP2A 1F5FA 1JZ7A 4YZ3A 4G4FA 4OI4A 1IS4A 2DUPA 5CG9A 1YYNA 1IHMA 4R4XA 3VHRA 4QHBA 3JUUA 3PJYA 2Y26A 4BXSV 1FPN1 3VBHC 3IZOA 3WY6A 3FL7A 2J22A 3W59A 1UY0A 4WVMA 4JDMA 1W8WA 3MV11 2ET1A 2EAKA 3VBRB 4LUMA 4Z1VA 2UWAA 2XJVA 2Q30A 4C0BA 1POV0 1UXZA 2VJXA 4JCKA 2AACA 1V9U2 2WWSA 4JHZA 4X6RB 5H9PA 5A32B 5A1AA 1RUI1 2W94A 3WNNA 4B3NA 4NHYA 1TVGA 3R05A 5DAQA 5IHRA 1GMMA 3SQOA 4UFHA 2AR6A 4UOJA 4NRMA 5FLIA 4B4QA 4S2FA 4BA6A 1UW8A 2A7AA 3OUJA 2XHNA 2L9LA 4P08A 4QPIA 1GZWA 2PLV1 3IWZA 5FPAA 3NAPB 4HVOA 1ZRDA 4UFLA 2RMU2 4H3WA 4FVVA 4ISQA 2DUQA 3RWNA 5J3UA 2HJIA 3HAGA 3DYOA 4WVZA 3WDXA 3LSEA 1AVBA 1UMHA 1UKGA 3ZPYA 4XFFA 1AYN3 1WBFA 2CAVA 4WM8B 5JZGB 1D4M2 1O5UA 4OFGA 5FFOC 5FYIA 5JMCA 1C8M2 1H8TB 2XDVA 2D97A 4PLMA 2DVGA 3MO4A 3F2ZA 4YM1A 3AKPA 3TNQA 5KHJA 2DFBA 4FBFA 2FZ1A 1J1LA 2PHTA 4Q4W1 4DUVA 4OI2A 1UPIA 3AZWA 3FUOA 2ZAAA 2C0ZA 4IEUA 4RHV2 5FQ0B 1W28A 2VUAA 4JGYC 5A80A 4E2SA 1D0GA 3V0BB 2NYYA 5C3SA 4Q1RA 5F5QA 5H9SA 2FCVA 1HQNA 3SMHA 1NX9A 1VMFA 4CCOA 4ZZ5A 2LRPA 5C6CA 2VM9A 5CKQA 1ZRFA 1VP6A 3WUDA 1MS3A 1RUF2 4CDQA 4L8QA 1FNYA 2GN3A 1O7FA 2XMLA 5FP3A 2VTXJ 3U11A 1YXWA 1RUJ1 4JHTA 5J98B 1Y3TA 1UIKA 4M01A 2J1VA 3MFCA 5ABJB 3H1YA 3TOJA 4CZSA 3I59A 4GWNA 3HBZA 3M3EA 3DCQA 1J3PA 4MO3M 4LR4A 1L7LA 2ZEXA 3Q8AA 4OQ8A 5FP9A 1VBC1 1NAEA 2HWF2 4S2GA 2VMFA 2BGCA 1AYM2 1LHOA 3JD72 3CDZB 3DPRA 2HWD3 1K5MC 1L7QA 4GJYA 1POQA 3C7HA 1W3XA 3PUHA 1OFSA 1IG3A 2QQIA 2YYOA 5C9AC 1DQ1A 2C1FA 4PQ9A 3LPGA 1RUD3 3RVHA 2J7MA 5FUPA 3OG2A 1E5SA 4AAXA 3I3EA 1QMJA 3VKNA 1POV1 2XLFA 1R093 1QJX2 3SCGA 5ISLA 2XBO3 3NL1A 3VBUC 3W58A 1NOVA 2YFUA 1RUE2 3W21A 1U5ZA 1W9WA 5BYNA 4HK9A 3SKJE 1KGYA 3G6JB 3H1MA 2FDFA 4N43A 2WZR2 3N7JA 3URFA 1UOBA 4IETA 1G6NA 4LBMA 3I2KA 3K48A 2WNUB 4AI3A 2ZAHA 3L2HA 3ON7A 3ETPA 3VDDC 4EZHA 1YUDA 3K4ZA 2VZ3A 1W6MA 2DU1A 2YC0A 3AVRA 4MYEA 4R9AA 4Z82A 5IVVA 2PTMA 2OIIA 1HDKA 1QF3A 4BM8A 2XVLA 1OA3A 3FLRA 2BNNA 4NRPA 3WG1A 2WBKA 1TQ5A 1S0BA 4AI2A 1DDLA 1EPZA 1DU3D 3S30A 4GKYA 5FBJA 1Q8PA 2J1AA 3P3NA 4C1XA 4CCJA 1F31A 2VVEA 4XFBA 1VLNA 1SDDB 1XNCA 2X09A 2D6NA 1AR93 1QNYA 2AREA 3NNGA 5L9BA 1PO23 1YIFA 2Y6JA 1OOPA 2VMEA 3USSA 1CIWA 1AL22 3ZSEA 4MZUA 3CF6E 4FFHA 1VBA2 2KD7A 4FO9A 3N9PA 4XUNA 2Z42A 1HN0A 1Z7S2 2FHRA 2J1RA 4XFIA 2YHJA 1DQ2A 1SBFA 4CDUA 1X33A 1Q8VA 2RJ2A 2VCBA 5JDBA 4LO7A 5FWEA 3BYWA 2JE9A 4IDZA 1W6NA 1GOHA 3AFGA 3ZDSA 3WF1A 4NR1A 1GKBA 2RS32 3B94A 2XUEA 4LKSA 4QD2A 4CP2A 5CFCA 1FMD1 1MEC2 3NMBA 3POFA 4GB33 2NP0A 3NNLA 2VNOA 3FHAA 1LAJA 2ETEA 1C1LA 2HLEA 1W06A 4NIDA 2ZPXA 1O8SA 3AZXA 4PIXA 5DQ0A 3WP4A 3WW3A 4AAPA 5FYTA 2YC4A 4AF9A 2WNVB 1NCRA 3IMMA 3WINE 4L9BA 1US2A 4MGZE 1MZ6A 4LMFA 5L36A 3KWVA 1ND2C 3EB7A 1IS5A 3ZXFA 1FOD3 5CFDA 1UMZA 3NQHA 4DRRA 2XL7A 4IGPA 4K6BA 3GYDA 5JOYA 2ZGSA 4PDWA 4WVVA 1DCSA 4Y5TA 1LB2A 3BALA 3LOIA 3Q9OA 4HL0A 2QQMA 4AQ2A 2HEYF 4ZY9A 3VBSB 1AXYA 5AVPA 2E7TA 1NCQC 1FATA 3ZXDA 4Q4Y3 5GZDA 4RS5C 2VNVA 5FO8B 3R4UA 2D6KA 1BMV2 3T08A 3CZJA 5CNAA 3U07A 2YBSA 4XUQA 2WO7A 3MLJA 4QHZA 2JICA 5IVFA 1OLMA 1Y9QA 4CDQC 4Q1PA 1I9RA 3M3IA 4AFMA 3PU3A 2OQ6A 4LPLA 3J8F2 1RTVA 4QKFA 1WCUA 3AKSA 4AVBA 2WS93 4ARYA 4N53A 4QX7A 5DG1A 1APNA 3NJXA 4DUWA 5FR3A 1XOYA 1JXNA 1ASJ2 4PCRA 1SBEA 2Y6LA 1DYKA 4PF1A 2BJSA 3CZUA 3ZFFA 1PO12 5DUXA 4ZKTB 2XWJB 3CQOA 2ZGKA 4URAA 1GZ9A 4NAMA 3LF7A 1ZREA 4R9BA 3MW4A 2FDKA 5FZFA 1WD3A 1O4ZA 3O5SA 1SLLA 2ZGUA 3SNMA 3P1IA 2OZ6A 2G9FA 3MLKA 4DIQA 1CVNA 5FYMA 4MXWA 2CHHA 2X29A 5FPZA 4U2AA 4DS0A 2VL4A 1G9CA 3HR9A 4P9WA 3WP3A 3Q8BA 4E9KA 5ERLA 5FBZA 2LUWA 4B4PA 2ZGLA 5IAXA 1XE7A 1YEWA 2J1EA 3EXUA 3I8TA 5FZKA 4QKBA 4A4AA 3AP7A 1LKNA 1HRV3 5T54A 2RS53 3KV4A 2VGDA 1QXPA 2W1QA 4FPOB 2PHRA 1H2KA 4YG6A 2VUDA 2D5FA 1W9FA 5A7NA 3ZYRA 4EN0A 4N43C 1JYNA 3RS6A 1FV2A 5FUIA 4A7YA 2R30A 2I07B 4A7KA 2P17A 1AX2A 4Y1UA 3PVOA 4GKXA 4YZ2A 5BNPA 3EYPA 4OUMA 2XH6A 4ATEA 4CU9A 5I8YA 1I5PA 1NT0A 1OH4A 1ZZBA 4R9DA 4LBQA 4EROA 3SEPA 2K2SA 1UY1A 2PLV3 2PHXA 1CESA 3KHCA 4L11A 3WHUA 2ZHLA 4IV1A 1Q56A 2Q1MA 1SG3A 2VOKA 4LIVA 4XQDA 4NHMA 5EXOA 1BLZA 1KS5A 4ZU4A 4HVRA 4QPWA 4I30A 4W6YA 1OLQA 1V6MA 3FC0A 4IE4A 4LLOA 4FPYA 4H55A 3U1XA 1ULOA 4DO0A 2GU9A 3WDVA 2O0OA 3POJA 2D3SA 2GC0A 1HV1A 5IK4A 1JZ8A 1PMJX 2A3WA 5EV7A 3LOBA 4OLLA 5KC6A 2JDKA 4K3UA 5FY0A 1PGW2 1WA4A 1V70A 1F4HA 2VH9A 2VCCA 1I5ZA 3KQRA 2WL1A 3AL6A 4JKMA 4UFJA 5KXCA 2AGSA 1OT5A 1NUKA 3WXPA 5AFBA 1HRI1 3VD9A 4Q4W3 1AYN2 2EALA 2Y6FA 4NWVA 3WF3A 3TN91 2PHWA 2QQVA 5JXJA 3E1F1 4WVMB 4QQHA 5LBBA 2AYHA 1F15A 4GXLA 4WM7C 1K42A 2EXHA 1PIV1 2BRTA 1OH3A 3LE0A 1CGPA 2VQ0A 1UZYA 5BUVA 1MQTB 4Q4V3 5CFCC 3NAPA 4D7TA 2HWB3 2WLPA 3LDBA 4EQVA 4K40A 5FMDA 4W6WA 2XLAA 4Y33A 5AC93 4FI9A 3H7YA 1AR83 2HH9A 2PMWB 4XOGA 4YLZA 3WDWA 4QPIB 1GZWB 1AJKA 1ASJ1 1DG6A 1JOPA 1NZCA 2QNKA 1ZNPA 1NCRC 5GALA 3WT3A 4Y3OA 5JZGA 1OA2A 3LEIA 1WA6X 4CP9B 1MS8A 1YHFA 1WW5A 3BODA 2XG3A 4MHRA 5K0UC 2ZABA 4CU6A 2GSYA 1H6XA 5A3UA 1A6CA 1ULCA 2TEPA 2W2IA 4PDWC 1G9FA 2W92A 4KQ7A 3B9CA 5FQ0A 1NLRA 4LOTA 2HYKA 3HNBM 4Y4YA 3V0BA 4JVAA 3APBA 2NZ9A 2BVVA 2DCTA 2RDSA 5GM0A 5AVAA 1W6PB 2XQRA 1W6OA 3LSDA 1GZTA 4MHUA 1DBNA 3SISA 4HSLA 2IXIA 1JYIA 1NG0A 4EN7B 1CZSA 1BVP1 1X8MA 5EPAA 1GYKA 5FKCA 3I2HA 3ILNA 2JDHA 4YNIA 1MVQA 1R092 1L7RA 1LRHA 3GBFA 2HWC3 1N1VA 1Y43B 1ZBA3 2XBO2 5FY9A 2D43A 2GH8A 3ACGA 1N3OA 4CA9A 2Q1ZB 4BQ4A 4YM3A 2WWJA 1CAUA 3GXUA 1JN2P 4I3PA 4BWOA 5ABJA 4N53C 2GMEA 4C90A 4IV3A 3RMYA 2EIGA 3HVDA 5C8WA 4XPVA 5JMOA 3A22A 1NKGA 3CJIB 4LQRA 2DCZA 2I2SA 5FXVA 3PNAA 3BOPA 3WP6A 2B45X 5FWJA 3Q8EA 4H7MA 1SLBA 3S5AA 1QHDA 2OA2A 4Q0QA 1UCXA 3I59B 4LULA 4RL7A 5JI9A 3GHMA 3LDKA 1QJZA 4XJAA 1NA1B 1E57A 3T4VA 1EUTA 4ZU7A 1Q8QA 1EPWA 1KXGA 1TMF3 2XJQA 4CCNA 5EIYB 2A1XA 5FXXA 2O1QA 3DPRB 4H7LA 1VPHA 2D93A 2JD4A 4GMP3 3JQWA 2R49A 4YGBA 3L2YA 3TRSB 1UAIA 4HOOA 4Y1YA 3BU7A 3U78A 5EZWA 3J7HA 1LESA 2Q8CA 3VL9A 1SDWA 1Y9MA 3H3LA 1UU5A 4MSVA 4ET7A 4DXRA 1AR92 4ORFA 3UJQA 4DNYA 1PO22 2W1UA 4FOYA 3ACLA 3E6CC 3WNLA 5C3PA 2ET7A 4I0BA 1IKPA 2OZJA 2VVDA 5C4WC 3FUQA 4K21A 4XF3A 4GH4A 1OHFA 1UMIA 3KS7A 3HQUA 3U0ZA 4D69A 1GICA 1UY2A 2JDMA 5LA1A 4GJZA 3AM2A 2MEV1 2P3JA 4JTNA 1W6MB 2ZX4A 1OC1A 4MLOA 4QXKA 1XE0A 3JBG2 3ES4A 4IV1C 5FYYA 2D44A 2DWRA 5A3NA 4GB32 3GZAA 1REDA 2D6OX 4C0HA 2WO2A 2WYSA 1ZRRA 4EJRA 1VB4A 3MBWA 3AYEA 5I93A 1DFQA 1W2UA 2D3PA 4FFFA 4QXCA 1MS9A 3SCHA 3D4KA 1NZIA 4GIQA 5F5IA 1W8UA 1ND3B 4A41A 4OUSA 4HK8A 2JB8A 4QM9A 3FJSA 4XQ4A 4YM0A 2LTNA 5L7OB 1V6LA 5FPXA 3A0KA 5JR7B 1QJU3 4CUAA 2W52A 2ZKNA 3ZSKA 1OOPB 1FOD2 4M3CA 4B29A 3JQXA 3AKRA 1RMU1 5FZDA 3OF1A 5FOJB 1XB9A 1F35A 2JKXA 2BYVE 3M8LA 1LU1A 5DDJ1 3GBWA 2PAEA 4P5HA 1X36A 3NJVA 5BNNB 3ENRA 5IK7A 4UF0A 1GR3A 5HCBA 4CDUB 2QZ2A 2QQPA 1DQ6A 4XF9A 2R063 3W20A 1UYZA 2Y8KA 3NAPC 1XC6A 3HWJA 3VLBB 3VV1A 3AXDA 4BPZA 4UFIA 1LOBA 3NVCA 2WA4A 5C4WB 5F3CA 5JOWA 4XIKA 2HWE1 3OPZA 1ALYA 4PIYA 4AI8A 1JW6A 1WMEA 1H6YA 1OMIA 3KV9A 4Q4X1 3OB8A 2WS92 3N7LA 4WM8C 4TSVA 3S7IA 3ZXLA 5JZGC 4LO6B 3DECA 1OA4A 4UW5A 3WQ7A 5D21A 3F95A 5DAPA 5FMBA 1R083 1WW6A 2F6BA 4B7EA 3MIGA 3OGSA 4COWA 3I97A 4BJ0A 4PJYA 3VBSA 1R64A 3D8CA 1PX4A 4FT8A 5A6ZA 4KNCA 1RVF3 1DF0A 1OKQA 4IEXA 5LASA 2CGOA 2V5DA 4XUOA 4CYDA 2CSGA 5CFDB 3IT8A 4Y1XA 3RZKA 4K20A 3VZLA 3O1RA 1VBD3 1EV11 4XUPA 5FP8A 3PTRB 5FZOB 3AYCA 5BPXA 1YQ8A 3MGUA 1H1IA 1X82A 5LBFA 3RGBA 1LOCA 2UWCA 2R16A 1HN1A 2VCAA 4CEYA 5LATA 3LA7A 1S4CA 2IC1A 3AMNA 2DVAA 2QE3A 4OMCA 3MPPG 1O59A 4SBVA 3UKTA 2RS11 3UGGA 1HRV2 1W8NA 2RS52 1D7PM 1BK1A 4E2GA 5ABJC 2YC2A 1SLCA 1ST8A 4IV3C 5GZEA 1F4AA 2HBTA 3C7OA 1HXS1 3GJAA 1VE0A 4N53B 2W39A 1QJY3 2NMNA 4QB2A 4BU2A 2QQJA 1WUVA 4BIFA 4HN1A 1RC6A 1URXA 4HMZA 4RGGA 4LK6A 5HV4A 3OBTA 4Z2AA 4P9LA 3LPFA 1VBB3 2Y64A 3ZFFB 2JE8A 4OULA 1JYCA 3BOWA 3QBQA 2B7YA 1FYUA 3JBG1 3MIEA 2ID4A 5CU1A 3KD4A 4Q0PA 4W8JA 3DEMA 2VZQA 1XNDA 1W2AX 4OUEA 1BKZA 1OXCA 2DTYA 4HSJA 3H8OA 1B35A 4Q2FA 2PELA 2CL2A 2JENA 2RE9A 1KFXL 4AOCA 2YBKA 1WLCA 4RR3A 3OBZA 1BEV1 4DQAA 3RG0A 2CDOA 1JHJA 3MDPA 1RUC3 3AMHA 2Y6KA 4P9YA 3N35A 1FX5A 4UFKA 4B7KA 5I0RA 1DGWA 2WT2A 2YY1A 1VALA 1E5HA 2KA3A 4F83A 2RVAA 1ENXA 2WNUC 4D8MA 4I01A 4QQ2A 3OUIA 2ZX2A 2VZOA 3ZYJB 2RDQA 1YFYA 1CONA 3IPVA 2XOMA 2PXJA 2GMPA 4BYYA 4RFT0 3CLPA 5BNPB 5JOZA 3TEXA 4YW5A 1HB2A 3VZMA 1AXZA 3H3UA 3I2IA 4RA0A 4FOQA 2BQPA 1H9WA 5LY2A 1V6IA 3POBA 2R7EB 4B1MA 2NN8A 1AZDA 3O1OA 1S2KA 2B4KA 4Q4V2 5F2SA 2VU9A 2XUMA 1NYWA 1OURA 2HWB2 2P2KA 4QB6A 2VNGA 4XDOA 4IEPA 4AI0A 5FY5A 3VUOA 1LNSA 5A6YA 2Z69A 5AC92 2JECA 3WQ1A 5BV6A 1AR82 4NIHA 4XBNA 1BBT1 1PVXA 5F7UA 5C33A 2NPIA 4FTBA 2BPA2 1UYYA 2XVKA 4YVSA 1QQP3 4OHVA 5K7PA 1JTZX 4AYUA 3MI8A 3OPTA 3AB0A 1GV9A 4BXFA 3OBAA 3Q8FA 1S0JA 1JMUB 1UOJA 4EZ4A 1RHI3 2GN7A 4AQ6A 2DV9A 2W08A 4OVEA 5FZ3A 3PVBB 4C8DA 1RUH3 4QDQA 2K0GA 1RYYA 2GDFA 3N9LA 3O0VA 2C6SA 1MVEA 4RGAA 3J7MA 1UN1A 3WNOA 4COUA 5C3OA 1DLCA 1MQTA 2VZPA 1E5IA 4LXLA 1LOFA 3I2DA 1H4HA 5DN2A 4ASLA 3IDEA 1WLWA 1OUSA 2R0HA 1COV3 4ASMB 4XZPA 3CHXA 4LT5A 3PVEA 3LB9A 3GCXA 3M1HA 1GLHA 1UZZA 4TLGA 3FLPA 1SEFA 5FLHA 1CAXA 2HWC2 2WNVC 1DLLA 4NUBA 4QKDA 5J96B 4LO4B 1ENQA 5FZGA 5KHKA 4CP9A 1VR3A 4XF1A 5IFTA 5JR2A 2QUOA 2A6YA 2MPFA 2CTVA 2XJSA 2B42B 1CJDA 1LGBA 2VD7A 3E5UA 3P3PA 3UKNA 4FTEA 5GZGA 1NY72 1AR71 1SFPA 2D3RA 5GKAC 2IXKA 2IXLA 2CU5A 3GDBA 5J7MA 3VBSC 5B4NA 5IUQA 1W6PA 2WYFA 4DXZA 3KHBA 1QNWA 2XHKA 5BNQA 2C24A 2CDPA 4AFCA 2R073 5FO7B 1N1YA 2RM21 5JXHA 3I49A 1WCSA 4JTOA 2EIBA 2XQXA 1LGNA 1X8EA 2R041 4XFAA 2DBNA 4I0WB 4JDNA 1TMF2 1STMA 4LBNA 1PZ7A 5FZ1A 3LIHA 4QT6A 3KCXA 4Q5OA 5F3GA 1W6OB 5C8CB 4JQRA 1LGCA 4C91A 1N3QA 4CEYC 4DINB 5FTTC 3UJOA 5A6QA 2BNOA 3ZFEA 2VUCA 4CPBA 4Y22B 1DP0A 1ZZCA 2PHUA 1GNZA 3K51A 3FX3A 3SEEA 2BFUL 2A73B 3TWIA 5FPUA 1UZ0A 3JU9A 3CJIA 2D6LX 3I4IA 3WQBA 3ZOIA 5JI7A 2OX0A 3RRDA 1ZBE1 1CAUB 3OJBA 3KM5A 1AJOA 1AF9A 3ITQA 5ANNA 3HN3A 1XPWA 3OBRA 4BIOA 4IV3B 5FYZA 1GWLA 3ZYHA 2B9UA 3B93A 1Q8SA 3ZFGA 1DZQA 3TB0A 3KMHA 1NA1A 2WFF1 2ZKLA 4QB1A 3TYJA 2QQWA 2F4PA 3H8RA 2ZGPA 5FYVA 4XBLA 5IJRA 2E32A 1TG7A 3O1PA 1PM4A 3H8XA 2Q5TA 3WCRA 2DDUA 5LY1A 3AKTA 5L9VA 4LIUA 4JKKA 1SHWB 3JB8A 3POWA 2HEVF 5JCTA 2ARXA 1A78A 1PZ8A 1B35C 2PYTA 4XFGA 2WT0A 4NOTA 4FXGB 3FBMA 1UY3A 5FZIA 2HKXA 2IFWA 5FCCA 1UO9A 1W8FA 5FJKA 4RGKA 4RR3C 1EAH2 1HB3A 2LW8A 4G3YC 2P6CA 4YW4A 1H0BA 2XL9A 1EY2A 3B7MA 1HLCA 1JYTA 4CUBA 4XJZA 5I91A 4P9JA 1UX6A 2EICA 4AZZA 3FHQA 3O1VA 2XJRA 1TME3 4ARXA 4QWNA 4QXHA 3S5QA 4AW7A 4YVWA 2C5DA 1H9PA 5FZBA 1XSQA 1DZTA 1V9U1 4HZFA 2J1UA 5FYCA 1QWRA 3PDQA 3ALQA 3UGFA 1NQDA 2ZHKA 4XAAA 4GH4B 4QXBA 4A42A 2ES3A 1ODNA 3KSCA 1KQRA 3ZR5A 2BWAA 3MEPA 4ES9A 5A3PA 3WNXA 3VBOA 1CAWA 4ZPIA 5F3IA 3KV6A 1G8WA 2R062 4NPRA 2K9ZA 2RMU1 4MGQA 5FYBA 1SCSA 2VZVA 1YLLA 1ND3A 3TBDA 1J3QA 2WFPA 1J59A 1XQNA 4XMIA 1LOAA 4L2NA 5L7OA 1C8NA 3KQ4B 3N9NA 4O9GA 5E8AA 4XJ8A 4YW7A 1AR63 3VBFA 5C5UA 5ACA2 5JIUA 4GWMA 3ILRA 3N9MA 5EJZB 3SH3A 1JYWA 1D4M1 3POGA 1C8M1 5FZ9A 3TEWA 1R082 5LA0A 2OPKA 5E89A 2DTWA 3I3DA 1VMHA 3ZMOA 4XXAA 4J6GA 5HXVA 1GQHA 2FCUA 2K46A 4AHWA 5BNNA 2LM3A 2KR2A 3JZVA 2XVGA 2BFUS 3LFMA 2RR13 4N9IA 1PZ9A 4M3CB 4RHV1 4HN0A 4FQ4A 1MQTC 5FJHA 1JODA 1IOAA 1RUG3 2VECA 4IE5A 2WR9A 5LA2A 2QQLA 4XF0A 2AUYA 1ZRCA 1VBD2 4YWAA 1S0IA 3I3MA 3IAPA 4UF0B 4MADA 2VC9A 1W9TA 1IS6A 1RUF1 1JH5A 1XRUA 4ONUA 4QPIC 4BLJA 4OMDA 4J25A 5JVVA 3U37A 1AX0A 3VDAA 2WQZC 1S1AA 1W9SA 4XEZA 4Q8LA 4YFWA 1EUUA 3VHOA 3WX5A 3PUIA 5T55A 2VXRA 1AXKA 2DCYA 5A7WB 5DZEA 4R9CA 4H2AA 2XONA 2DURA 3AP9A 1F5JA 4MGSA 5DAVA 2FZ2A 2GP3A 1QJY2 5A1LA 3V56A 2HWF1 4Q29A 4JZRA 1FV3A 1GANA 3GZEA 5FPVA 1KEXA 5FKBA 4OI1A 1AYM1 1R1A3 3JD71 3H7JA 5F9TA 5J09A 4E4HA 5G04L 4YG3A 1XE8A 3B00A 5EJ3A 1VBB2 3LIGA 3PU8A 5FZOA 3VD7A 3ZDVA 4BK4A 3SHRA 1DGWX 1X9PA 5IVJA 3GGLA 2P3KA 4HFSA 3RNSA 4HONA 4QGLA 4QKNA 3MF9A 4L97A 4AGRA 3EHKA 1C4RA 4IXLA 2BBVA 2ERFA 1QJX1 2P37A 4GA9A 4IE7A 2W9XA 3C7GA 4MVTA 4OI0A 1RUE1 3SKVA 1D0HA 4LJHA 2NLRA 1A8MA 1VRH2 3OD0A 1NLSA 5KXBA 4UI9L 3N9OA 3NNFA 2WZPP 2VBPA 4FFIA 4LBQD 2SLIA 3ZFEC 4CEYB 1RUC2 2WZR1 5BNOB 3ETQA 3MV01 1S0CA 1CPNA 3FN9A 4CDWA 4BQ2A 3RZMA 3CJIC 3WR0A 5LA9A 1BJQA 5FZ4A 4AEMA 4ASKA 1IQAA 1GP5A 5CKMA 3NWKA 3JB4C 1QOOA 4LOSA 1IPJA 1EYBA 1VBE3 3A21A 3R6SA 1O3SA 2PHDA 3ZFGC 4YZ4A 1NA1C 1ULDA 5C71A 3N3HA 3O1TA 4A3XA 1VAMA 4GALA 2WQ8A 4UW3A 4C1WA 1LR5A 3DPRC 3OPWA 4NHXA 5FK7A 2HBUA 4AHXA 3TEYA 3SC7X 3WVJA 1PVC2 3BTZA 2QDNA 3P6BA 4OHZA 4CEWA 2GC3A 4TZDA 1LOGA 4BLIA 4A44A 3THPA 1B09A 1FPN3 1WWYA 2IXHA 2UYAA 4JAAA 3M3OA 3ZO0B 4B4RA 1B35B 2WUHA 2A70A 3PMSA 3DGTA 5G05L 1AL21 2G4IA 2QJVA 4IEYA 2AENA 4BQXA 1VBA1 4NHKA 4RR3B 2X5IB 1QQP2 2V4AA 3PVNA 4M4RA 1U5IA 3RMXA 3A4UA 2ORZA 1Z7S1 1YQ2A 2O8OA 1WLDA 2ZX1A 5IVBA 4FPGA 5IFPA 5KC5A 5M0TA 1RHI2 3INAA 1SPPA 1Y9GA 1RUI3 4YVWC 3C8XA 4KG8A 1RUH2 5FY1A 4XTPA 4DRVA 2XB6C 3ZSMA 2IVJA 1MPXA 2J1SA 2VUJA 4FPJA 3IPVB 2RS31 3PIJA 3HNYM 3AXEA 3KT7A 4KBZA 4WZFA 4AGGA 1OVPA 3TNPB 3KGLA 5EJ1B 1MEC1 3NNMA 3VBOC 1QH6A 3ZN6A 2GH2A 4LO8A 4Y4RA 4UBGA 3U4XA 1JHNA 3VKLA 4G9SB 4IEOA 2Y60A 1I1EA 2A3XA 1REEA 3NSTA 4KBBA 4XIOA 4YGDA 5DUVA 3T2PA 1ND3C 1MACA 1MR5A 2WT1A 3AKQA 1VAVA 2GMMA 2W91A 4LNVA 1JYVA 5DPNA 1AR73 2VBDA 5L7OC 2CY6A 3BGAA 5D8AB 1K12A 5T5OA 4W6XA 2E7AA 1OOPC 2WABA 2ZTNA 2XR4A 3PUAA 2Q1FA 2JDNA 3WZ1A 2DVFA 5E88A 4XE9A 4YVSB 4CSWA 5HBAA 5JAXA 4FQZA 4NHLA 2EIDA 1UOGA 4OHYA 5A70A 5IYYA 3V0AB 1J1TA 5FY7A 3SH4A 2DCKA 3WV6A 5BNNC 4A45A 3ATGA 4GWIA 4XHXA 1NE6A 5EFUA 3WOGA 1PMIA 4CDUC 4AVCA 1WLTA 1U12A 2VO5A 1W2NA 2R072 3NKGA 1W8HA 5JXGA 1BMV1 3AYDA 3ZX7A 2NQYA 1XYOA 1BK0A 3S7EA 1DGRA 1JUHA 1W2TA 2QQNA 3BCWA 4HBNA 3O1SA 1UD1A 1PNGA 2A75A 1JZ2A 1VRH1 4LA3A 3VD5A 2UURA 2YPJA 1NXD1 1FT9A 1OSGA 4OZXA 3H8UA 4PIZA 3ZN5A 4FAGA 2DVDA 1HB1A 1ZA4A 2VNRA 2ZHNA 1RUJ3 1ZBE3 3J8F1 5F2WA 3MIFA 3VB9A 3OY8B 3VL8A 4OCTA 1CAXB 4DZGA 1FAYA 2N7GA 2YGMA 1SFYA 2JWPA 3GBGA 2VR4A 4GAZA 1D2QA 1PO11 4QX2A 1VBC3 2WAOA 3B01A 5LW9A 2Y38A 2HYXA 5CFDC 1SLTA 3KF5A 3WCSA 1J84A 5FREA 3N4MA 3OYWB 1CZVA 2FQPA 2CYFA 1ULEA 2UU8A 4HANA 4HKWA 1W05A 1PVC1 2EIEA 5IWFA 3WNPA 4AQTA 1SQ4A 1PGSA 1POV3 5C8CA 1HKDA 2HWD2 1ENSA 2QKDA 5JIAA 3E97A 4M4PA 2WO1A 2ZHMA 4XC9A 1RUD2 4BQ1A 3RI9A 1GP4A 3NV3A 4CUCA 3NRUA 3G7DA 3UETA 1A3KA 2Q4SA 3FZ3A 4Y22A 2VY0A 2KXLA 1EP0A 1HQWA 4N7UA 5A3OA 2LALA 4RQPB 3T30A 3HOBA 2DF7A 3ILFA 4CDWC 3OGVA 4MXVA 4PQQA 4KMQA 2YROA 3ZFEB 3MPBA 2OUHA 3ZYIB 4ZONA 1LHWA 3ZSJA 1KDKA 2BW8A 1TME2 2ILMA 4LE3A 3H3ZA 5FZHA 3WDYA 2EXJA 2YUEA 4BQ5A 4DOUA 3ZFFC 2FD8A 2V73A 2OS2A 3B3QE 4QPGA 2Y34A 1UKRA 3ZFGB 4LBKA 3VN4A 5KHHA 3WF0A 5T5JA 3ZXEA 1K3IA 3IB3A 4CEWC 3RPQA 1WZXA 1BXHA 4GULA 4I02A 3T09A 1UXXX 4NPMA 1A8DA 1WGPA 4JRAA 2AEZA 4S2DA 1PGW1 4TXWA 3AVSA 2AH2A 4IE6A 1QIQA 4FAHA 3E5QA 2D6MA 4QU2A 5J1XA 4FOWA 4XCBA 1AR62 1AYN1 4RN5A 4FPHA 2JX9A 1PK6B 1W9YA 2RDRA 5DZFA 1RUOA 2TUNA 3HIFA 4AVTA 1O8PA 1OVSA 4YW2A 2I45A 5BNPC 3BTXA 4A6SA 2ZOEB 4XABA 4COYA 4AI9A 2C9KA 1OPMA 2OQ7A 3BPSA 2RR12 1FMD3 4YVWB 4HT1T 4ITCA 4DXSA 1O3QA 2G9GA 2G19A 2Q0AA 2P1BA 1RUG2 1QJFA 3BTYA 5I0DA 3V64A 2ZZJA 2TBVA 2QFEA 5LK5A 2GNBA 1QEXA 2DUOA 1YFXA 3EO6A 3IM0A 3O0XA 3VBOB 1CAWB 1ACCA 2VVFA 2IXJA 5LB6A 4LBJA 4W4ZA 2QTWB 1QH7A 1RUNA 4I09A 1NXMA 3OGRA 2ZGTA 2WZ8A 3AFKA 1KITA 1GNYA 2JDYA 2VMCA 2CNAA 3NV2A 4XFHA 5BY5A 1QY4A 4QX3A 1PNFA 1D4VB 1OD3A 3RJ2X 4E8DA 1FXZA 4QX8A 4XDPA 3VBFB 4H14A 1DHKB 2ZGNA 3OGGA 4L99A 4XJ9A 2P5BA 1BYHA 1R1A2 2ORXA 2PQQA 1TE1B 2HWD1 5HV0A 1SLAA 1CZTA 3I2GA 5E6HA 5A7OA 4IESA 1YI7A 4DY5A 4F8AA 2FMYA 1O6UA 2DU0A 4Q4Y2 4Y1ZA 3VZNA 5CEHA 5JSRA 1NE4A 2Q8DA 3T0DA 1OQ1A 3VDCA 2F4LA 2QQOA 1R091 3NV4A 2G1MA 1W2OA 3BUCA 2YG0A 4LBOA 2XBO1 2Y6GA 2OVUA 3C2UA 3KVAA 4NRQA 2RDNA 3ZVXA 3M2MA 4Q0UA 4FPKA 2VTXA 3DXTA 5A7WA 3C7FA 1AUYA 5J37A 2W5FA 1H2LA 2JG8B 3D82A 1C1FA 2YB7A 3K46A 1UF2C 2Y33A 3RZZA 5KR7A 2VQUA 3MW3A 3JXSA 3LA3A 2Z2SB 2D7FA 1S0DA 1ZM1A 4EN6B 5E16A 3R4DB 5KWRA 3U4SA 3J4UH 1UQXA 2V5YA 4V2WA 4DB5A 4AVSA 4META 3BPZA 5FIXA 4EWEA 1N47A 3E6DA 3S6PA 4P9XA 1VBE2 4PBOA 2OXBA 2RJLA 4XILA 4LITA 1YNAA 4YW3A 5IATA 1G86A 4LUKA 5SV8A 5L9RA 3QLQA 4N8MA 3WF4A 4CTEA 3V65A 2VPVA 3LEGA 5C8CC 4O9EA 2WO3A 4GD4A 5F5AA 2ZGMA 3KT4A 5GLVA 2YBPA 3ES1A 4HLTA 1NLQA 1OBNA 4AQSA 2O8QA 5IT6A 4YSFA 4V2VA 5BNOA 1QJEA 1FPN2 4Q27A 4Z07A 4LEJA 1AR91 4XJWA 3KCCA 3ZYPA 1PO21 2XLGA 1GQPA 1JZ4A 4MV2A 4QPYA 4Y20A 1CN1A 1TNFA 2UWBA 3NKTA 5GZCA 3ACIA 2ZMKA 4CDWB 4FFGA 3M7AA 2OUJA 3T0BA 3UGHA 1LCLA 1RUI2 4N90A 2WKKA 4YW6A 1IPKA 4FSJA 1XJAA 3OOXA 2YDEA 1XYNA 1CIYA 2X8KA 1V6NA 3VZJA 2UY8A 1O4YA 2HEWF 3AX4A 2V4VA 4GB31 1HJGA 2P4EA 2PLV2 1X50A 1XNTA 1YI9A 5GLZA 1CX1A 1Q3EA 4IUGA 4XW3A 5EP9A 2YMZA 4AWDA 4LTAA 2R1DA 4IL7A 2W0XA 4K8RB 4KU8A 3AK0A 4PF5A 4KWKA 5D2AA 4CEWB 2XPJA 1XNBA 2JJ6A 4QM8A 3AMPA 3CL1A 2X5IA 1Y7BA 3MYXA 1HRI3 3BVCA 5GLTA 1KRIA 2YZ4A 3IKWA 3TN93 3SITA 2Q8OA 3AP5A 2BUKA 3CKHA 3D3AA 4AL9A 2ZZQA 5LK7B 2W46A 1FOD1 4AFAA 1PIV3 4W65A 4W50A 1C3HA 1ZZ6A 4KL1A 4LBLA 4Q4W2 1C5IA 5FPBA 2ATFA 4YZ1A 4GH4C 1BZWA 3SXWA 1RXFA 2VZUA 1UYXA 2VW1A 1SPPB 2AZ5A 1W03A 2JIJA 2EAAA 1GNHA 1VMJA 3PHMA 4YFZA 4Q4Y1 2QBXA 3I3QA 4CUGA 1G9AA 4NN0A 1DQ0A 3SH5A 4ZXEA 2E63A 3T1LA 5AFEA 1G7YA 2BGPA 3H9AA 4ZS2A 3CU7A 3WDTA 1O5LA 5CADA 1MS1A 2JDZA 3D0SA 1ASJ3 2BWCA 4QDRA 1ZRIA 5A7SA 3IDCB 4YYOA 4TWTA 4JC1A 3ZN6B 5D8AA 1GWMA 4D6QA 1PO13 1RUJ2 2WS91 4X6QB 3ABZA 1UIJA 3VDDA 5C5TA 4IQPA 2XXZA 5DUWA 2YU2A 4RYDA 4AEDB 1YC61 5CB7A 5A3WA 4YPJA 4AVAA 4NROA 4EN8B 3FFZA 3V0AA 4LHLA 3FFQA 2ZMNA 1OLRA 1VBC2 2B8MA 4I3GA 4JQTA 1JS9A 4NJ4A 5L73A 4ZU5A 3IDAA 5FZ0A 2WNEA 1ZZ7A 2E9QA 1H4GA 5APAA 3DXUA 2LS6A 1JOJA 4XXPA 5CIRA 5F32A 1LU2A 5I8SA 4BISA 4CPBD 4Q0SA 1F8VA 4WZCA 5FOBB 3TAYA 5HCFA 3VHNA 2WZEA 2IFRA 3S0MA 1W8ZA 4N9HA 5T3NA 1LECA 3ZXAC 2FDHA 2ZGQA 4JX0A 3OSDA 1LTEA 3AJZA 3VD3A 2FDIA 3OY8A 3H50A 5HXMA 4J1XA 1OKOA 1HRV1 5EHDA 2RS51 2JIGA 3WUCA 5J48A 3LEMA 5LCWL 1ZBA2 4QX0A 1WW7A 3HT1A 2XJPA 5HCAA 2W1WA 2G9ZA 4E8CA 2GNMA 4PI2A 4AE2A 3OEBA 3ZXJA 5FYHA 3OYWA 5JLVA 4KWJA 1V6OA 5FMOS 3WDUA 3QH7A 5HI0A 4JGZB 4IE0A 3KB5A 3WSOA 4CU8A 3NJZA 3PUQA 2JKBA 1JOBA 1O3TA 1IPSA 4XJUA 4IGOA 3MHZA 2QCSB 4O7XA 4KWUA 2JDPA 2C4XA 3MW2A 1GQGA 4D0QA 4SLIA 3HN1A 5FV3A 3RDIA 1PGL1 2VZ1A 2VE1A 3T1MA 1DQ4A 5F37A 1ZVFA 5KBFA 3HMYA 4QX5A 1W39A 1LEDA 3GHNA 3LA2A 5FP7A 2IVIB 4RQPA 2R1BA 3PJQA 4EV0A 1ND2A 4JKLA 5BNOC 2D40A 1VAKA 3ZSLA 1MZ5A 3N7MA 4IW3A 4MGIE 2VBBA 1XXNA 2RJKA 4NPLA 3AMQA 3CMGA 3R0RA 4K1ZA 4O61A 3ST7A 5FLJA 5FPLA 1GWKA 1NCQA 3QH6A 5A33A 1OF4A 4RS5A 4XMAA 2MEV3 4GMP0 2PQSA 4AK3A 4WV8A 3QACA 1REFA 2VOTA 2WN2A 2E7QA 5FZMA 5ANQA 3VZKA 4QU1A 1FMD2 2UYBA 4DPNA 3A7QA 3P5BA 4LO5B 4QPGB 5DABA 4Q4V1 3AP6A 2HWB1 1YJKA 1VIWB 4J1WA 4LE4A 5AC91 1AR81 3BKZA 4EYUA 1VRBA 2WAAA 2C26A 4IEQA 1CWPA 2JG9B 5JSPA 1RJ8A 3GCWA 4E2QA 5K8SA 2V09A 4LKEA 1GOFA 1N3PA 2X5IC 3K75B 1IS3A 3MFAA 4CCCA 1Z78A 1PK6A 5JWPA 1DGLA 2XJTA 5CKNA 1RMU3 1S2BA 1W8OA 2FDJA 4BMEA 3R4SA 3WEZA 5A6XA 3M3QA 2GALA 3I7DA 2YPDA 4P02B 4XF4A 5DDJ3 3LAGA 2PAMA 1QJU2 1XNAA 2J42A 2UY9A 3E6BA 1E5RA 3B9IA 3IAQA 4O65A 4B1LA 4DUXA 3KLSA 5BXXA 1V6JA 1DYPA 1XNKA 1MS4A 1UOFA 3CEWA 1GP6A 5DG2A 4A3ZA 4PLNA 5CVRA 1U5XA 3OUHA 5FP4A 4CDXB 1D2SA 3POEA 3DYMA 2OKXA 3WD5A 3IIAA 2OPWA 4P9IA 2HWE3 1UNBA 2Y0IA 3LKJA 4XBQA 3ZKUA 1WBLA 3WHTA 1UYPA 4M0NA 2B46X 4XYXA 5CA6A 4Q4X3
chains in the Genus database with same CATH topology
1LODA 3EQEA 1H30A 4RSUA 1PGL2 2GC2A 2HWC1 3USUB 1ZBA1 3ZN4A 1BQPA 5D8AC 1QU0A 1ZZ8A 4BZ4A 3T2TA 3O14A 2XWBB 4AHYA 4DMIA 2VG9A 4F7ZA 3N7KA 2Z79A 1H2NA 4YVSC 3OD4A 1NY71 3ME2A 3AZVA 1KS4A 1WCDJ 4I0AA 3IN9A 4Q8KA 1QXRA 3GZUC 3NO8A 5FRAA 1M06G 1YFUA 2XKPA 2BNMA 4XDQA 5D1IA 2PHFA 1EV13 1KJLA 4COVA 4FP3A 1OI6A 4B8EA 1W0PA 3DL3A 1RVF2 2IXCA 3ZXKA 1LOFC 1QOTA 5F6LB 1TMF1 3CO2A 5B2GB 1SCRA 1G9DA 2CWMA 4GMP1 5IK8A 3AMMA 2RS13 4FCAA 4D94A 3ZMNA 2H0BA 5J36A 1UU4A 2JG8A 1QGLA 3VBHB 1UPSA 2ZMLA 2R0FA 2E53A 4WBBA 1HXS3 4MX3A 5KXEA 4AFBA 3AJYA 4WM7A 2D98A 5E1RA 1RITA 3JCIA 5JSOA 2XGXA 1F9KA 2YXSA 1FNZA 3JBG3 1YO8A 2DFCA 1LHUA 5K9YA 1VJ2A 4XQWA 3KGZA 3PMEA 3MIHA 2H6CA 1M4WA 4BE3A 1BEV3 4FOVA 4YGEA 3O7OA 2DCJA 1RB8G 4RQPC 1EAH1 2NMOA 5K0UA 2PFWA 4FTSA 1QOSA 4HETA 1HRI2 2DVBA 3MLLA 1W0OA 1XYPA 3QD6A 5H9QA 3TN92 1QJU1 1WW4A 2WIIB 4Y24A 3X29B 5JCTA 2ZBJA 4ZXKA 4Y20B 4RD7A 1PIV2 3ELNA 2RHPA 2MHFA 4FPCA 3PTYA 4Q0VA 1GZCA 1WD4A 4FPEA 3SLIA 3FBYA 4JGYB 4E4ZA 4D7SA 1KJRA 4Z92B 1CPMA 1DIWA 2WSUA 1O3RA 2R061 1S0GA 1O4TA 4Y26A 2C9AA 4IERA 1O91A 4LA2A 1LJ7A 1BBT3 2QVSB 5EYXA 5F6KA 2H0VA 4Z8BA 3UKVA 2H6BA 3B69A 4YRDA 3NV1A 1DQ5A 1TEIA 2IWGB 1ZZ9A 1LEMA 3MIBA 2OYZA 4AVVA 4EWDA 5ACA1 2VW2A 1JBCA 2GNDA 1PK6C 4U36A 4COZA 1NQJA 3NW4A 5CG8A 1R081 3D5OA 2WLQA 4LHKA 4GQ7A 4ISRA 3CNAA 3O0WA 4YW1A 1I6XA 2NM1A 1C57A 1CAVA 1RVF1 1K5MB 5C9AB 3D6EA 4NO4A 2CAUA 1H8VA 3FWEA 1VBD1 3POSA 4IEVA 4YM2A 3VGIA 3B02A 2PAKA 4IEWA 1YFWA 3UK9A 1C28A 1COV2 3VBUB 4I2OA 3KZ4C 3N36A 5FDBA 3RI8A 1IKQA 1W6QB 3UV9A 1N1SA 5C4WA 4AEDA 1LHNA 3OTFA 2JXAA 1N1TA 1T6GC 2A5ZA 3B5LB 3VBFC 3H1WA 1QJY1 3VDDB 3GALA 3IMNA 2Z5WA 4HPKB 4F3JA 5LRSA 2RM23 4UW6A 4FPLA 1BVVA 3J26N 4P9GA 4UW4A 1VBB1 2R043 4QMAA 5CBLA 3M70A 1ZX5A 5KHGA 1PHMA 4LLFA 3WQ0A 3AZZA 5JPMB 1V00A 4CRQA 3VBRA 4D3WA 2MNGA 3RJRA 3LCPA 2ZS6B 2R32A 2JG8C 3OGJA 1SMVA 1RUC1 5F1RA 3VKOA 1RINA 4E27A 5A32A 1MS0A 2DYCA 3MF6A 4BOWA 2JEMA 1U0AA 4JGZA 2WFF3 1BCXA 3VKMA 1MZEA 2JE7A 2WA3A 4HVQA 4WVWA 2WJSA 5T52A 2ZX3A 1H2MA 2MEV2 4FPFA 4AEKA 4ES8A 2SBAA 4K1YA 3QCWA 2E6VA 1XU2A 4AHZA 4MUVA 5A3MA 1S0EA 1G9BA 4R4ZA 3AZYA 4A7ZA 3ASIA 1RJ7A 1LHVA 2ZCWA 4BMBA 2VOXA 1ULGA 3DKWA 4WM8A 2WINB 4E4SA 1H8TA 5EYYA 2EVXA 3BTAA 4A2UA 2IZWA 1V6KA 3MZHA 1KDMA 1QQP1 1ND2B 3WW4A 2PN5A 1S55A 1S0FA 3MICA 1ONAA 5DXDA 1RMU2 1FI2A 1RHI1 1V9U3 2VMIA 4QQLA 3THTA 1ULFA 3ZXGA 5DDJ2 1L3JA 1SACA 3KT1A 1RUH1 3C3VA 1VB2A 1LOEA 1NCQB 2EA7A 4KH9A 5H9RA 5A33B 4CP1A 4RS5B 1HIXA 2GNTA 4K8FA 4PLOA 5DZGA 4BCUA 4CP0A 4AFDA 3WW2A 4Z2WA 2RMU3 1COV1 2CGPA 1GSLA 2HWE2 4KG0A 2JG9A 1I3HA 1LENA 1JUIA 1IZ3A 1QDCA 4Q4X2 1DZRA 4XTMA 4CDQB 2BVBA 2VOWA 3MIDA 3RYPA 4BH9A 3W9AA 2YV8A 4QGNA 1D4M3 1GFF2 1C8M3 2KM2A 3ROUA 2PHLA 3E5XA 3LWCA 2VOVA 1QKQA 1F2NA 1YCIA 5LEJA 3M3CA 4RHV3 4X8NA 3GNEA 1QDOA 2B5HA 4XFCA 1KD7A 4CDXA 1XU1A 5FO9B 1EV12 3J9SA 4Y5Z0 1Q8OA 2R071 4TLFA 3LGRA 5I0SA 1RUF3 4INDA 2XJUA 4KWLA 2FBEA 3USUA 3EBRA 2WNUA 2A3YA 2GAUA 4AG4A 1QXJA 2RS12 4HKOA 2VW0A 4YZ5A 2YGLA 3FE5A 4DY3A 4AEDC 3FLTA 4JV4A 1U5YA 4KU7A 4N43B 1HXS2 1YWKA 2E51A 4MH0E 5LRRA 1AHSA 2HWF3 4FXKB 4AI1A 3DF0A 1AYM3 3JD73 3EJKA 1OD5A 4AXOA 5I8TA 2CGNA 3QOPA 3RSJA 1AL0G 1QJX3 5T5LA 2D6PA 5LEKA 3UL2A 1EAH3 1IGOA 1RUD1 1RUE3 3GZTB 3IBMA 4PBPA 4HKLA 2CWSA 3U07A 1HQLA 3VHPA 2WC2A 1AX1A 4DFSA 5DUUA 2D5HA 3VBHA 1BEV2 3ZIWA 4JRLA 2WZR3 1GBGA 3VBRC 2R6QA 2CV6A 2WQ4A 3DN7A 4Q26A 4UXAA 3U10A 5JPNB 2ZGRA 5TSWA 2A6WA 2GC1A 3BB6A 1MS5A 4IEZA 3BIWE 3HD8B 1TNRA 1YIPA 2ZACA 3OCPA 2OW4A 3RQ0A 4JGZC 1TME1 4OHXA 5A3LA 3HT2A 1X7NA 5SV5A 2QZ3A 4WM7B 4JDOA 4ATFA 1CQ9A 4XETA 3ZIXA 1CX4A 1W6NB 4K7JA 4NVPA 4S2HA 4XHBA 3WG2A 2Y0OA 1RIRA 5CFCB 3WW1A 2ZA9A 2WNVA 4V1PA 4E4DX 1SLIA 1LULA 2ZJCA 4LHNA 5I0TA 3ZSLA 3CJXA 1KFUL 3KCYA 2BTVC 2FMDA 1OFNA 4YGCA 5ACA3 1BBT2 2BEOA 3O12A 2XKOA 5I0UA 1AL23 2TNFA 2VULA 1CJPA 1H8TC 1VBA3 3AYAA 4M3CF 2PA7A 4R8HA 1NCRB 4OHWA 5FAXA 5JOXA 3D0JA 1Z7S3 1AR61 5L19A 5K0UB 3WG3A 2EXKA 2WSVA 3VKFC 3A0NA 2VMHA 4KGGA 4PDWB 1H1MA 5T5PA 1ENRA 1UU6A 1Q5OA 4AEJA 2RS33 4JGYA 1HW5A 4KGQA 5KHIA 5EWSA 4M0HA 2RR11 4QQPA 1MEC3 5GJ6A 4QPGC 2B39A 1RUG1 1UL9A 2I74A 4EWAA 3LZZA 4MGYE 3RYKA 1MZFA 3WP5A 1HV0A 4NWWA 4N7IA 3RYRA 1OQDA 1RGSA 3L9JT 3I54A 3VZOA 2JG9C 4YARA 1WCKA 4MGKE 2ENRA 3ZYGA 3M4FA 3POYA 1PM7A 5FMOL 2A6VA 2ZGOA 3WLUA 2EXIA 1AR72 1YRZA 2GZWA 2A6XA 3PLQA 5T50A 2X53S 1ZYBA 2A71A 3ECQA 4P14A 4M00A 1SFNA 5GLUA 1K5MA 2QDRA 3WG4A 5C9AA 1H1AA 1Q43A 2VQAA 4Y1VA 1R1A1 2ARBA 2RM22 4CDXC 1OPOA 2R042 4MXWB 1CAVB 1VRH3 4TYSA 4L92A 3VBUA 5GZFA 4YG0A 3J8F3 1Z0HA 1WMFA 1W6QA 3FHIB 4M3CE 3GF6A 5KXDA 4X8PA 4EN9B 5IK5A 1C5HA 3H0OA 4R52A 4D7YA 1RL3A 4AGVA 1ZBE2 4UBHA 2VMGA 1OQEA 3DV8A 3FMGA 2A6ZA 5C4WB 4HPKA 3IDBB 1HX6A 3DUIA 1J58A 3AP4A 1CD3G 2WFF2 5GLWA 2P34A 1SBDA 3HQXA 1VBE1 1CR7A 1WMDA 1DGRN 4URTA 1R1ZA 4BHPA 1PVC3 5CAZA 1J3RA 2EF6A 4LBQB 2W68A 1YJLA 4K9SA 2P3IA 4IV1B 2ZX0A 4QGMA 3SCFA 4FP2A 1F5FA 4YZ3A 4G4FA 4OI4A 1IS4A 2DUPA 5CG9A 1YYNA 1IHMA 4R4XA 3VHRA 4QHBA 3JUUA 3PJYA 2Y26A 1FPN1 3VBHC 3WY6A 3W59A 4WVMA 4JDMA 2ET1A 2EAKA 3VBRB 4LUMA 4Z1VA 2UWAA 2XJVA 2Q30A 4C0BA 1POV0 4JCKA 1V9U2 2WWSA 4X6RB 5A32B 1RUI1 4B3NA 3R05A 2AR6A 5FLIA 4B4QA 4S2FA 4BA6A 1UW8A 2A7AA 4QPIA 1GZWA 2PLV1 3IWZA 3NAPB 4HVOA 1ZRDA 2RMU2 4H3WA 4FVVA 4ISQA 2DUQA 3RWNA 5J3UA 2HJIA 3HAGA 4WVZA 3WDXA 3LSEA 1AVBA 1UKGA 3ZPYA 4XFFA 1AYN3 1WBFA 2CAVA 4WM8B 5JZGB 1D4M2 1O5UA 4OFGA 5FFOC 5JMCA 1C8M2 1H8TB 2D97A 4PLMA 2DVGA 4YM1A 3AKPA 3TNQA 5KHJA 2DFBA 4FBFA 2FZ1A 1J1LA 2PHTA 4Q4W1 4OI2A 1UPIA 3AZWA 3FUOA 2ZAAA 2C0ZA 4IEUA 4RHV2 5FQ0B 2VUAA 4JGYC 4E2SA 1D0GA 3V0BB 2NYYA 4Q1RA 5F5QA 5H9SA 1HQNA 3SMHA 5C6CA 1ZRFA 1VP6A 3WUDA 1MS3A 1RUF2 4CDQA 4L8QA 1FNYA 2GN3A 1O7FA 3U11A 1YXWA 1RUJ1 5J98B 1Y3TA 1UIKA 4M01A 3MFCA 5ABJB 3H1YA 3TOJA 4CZSA 3I59A 4GWNA 3HBZA 3M3EA 1J3PA 4LR4A 1VBC1 2HWF2 4S2GA 2BGCA 1AYM2 1LHOA 3JD72 3DPRA 2HWD3 1K5MC 1OFSA 5C9AC 2YYOA 1DQ1A 2C1FA 4PQ9A 1RUD3 1QMJA 3VKNA 1POV1 2XLFA 1R093 1QJX2 3SCGA 2XBO3 3NL1A 3VBUC 3W58A 1NOVA 1RUE2 1U5ZA 5BYNA 4HK9A 3G6JB 3H1MA 4N43A 2WZR2 3N7JA 3URFA 4IETA 1G6NA 4LBMA 3K48A 2WNUB 4AI3A 2ZAHA 3L2HA 3VDDC 1YUDA 4Z82A 1W6MA 2DU1A 2YC0A 4MYEA 4R9AA 2PTMA 2OIIA 1HDKA 1QF3A 4BM8A 2XVLA 1OA3A 3FLRA 2BNNA 3WG1A 1TQ5A 1S0BA 4AI2A 1DDLA 1EPZA 1DU3D 3S30A 4GKYA 1Q8PA 3P3NA 4C1XA 1F31A 2VVEA 4XFBA 1VLNA 1XNCA 2D6NA 1AR93 1QNYA 2AREA 1PO23 1YIFA 3USSA 1OOPA 1CIWA 1AL22 3ZSEA 4MZUA 3CF6E 1VBA2 4FO9A 2Z42A 1Z7S2 2FHRA 4XFIA 2YHJA 1DQ2A 1SBFA 4CDUA 1X33A 1Q8VA 5JDBA 4LO7A 2JE9A 1W6NA 3AFGA 3ZDSA 4NR1A 1GKBA 2RS32 3B94A 5CFCA 4QD2A 4CP2A 1FMD1 1MEC2 4GB33 2NP0A 2VNOA 2ETEA 1C1LA 2ZPXA 3AZXA 4PIXA 3WP4A 3WW3A 4AF9A 2WNVB 1NCRA 3WINE 4L9BA 4MGZE 1MZ6A 5L36A 1ND2C 1IS5A 3ZXFA 1FOD3 5CFDA 1UMZA 4DRRA 2XL7A 4K6BA 3GYDA 5JOYA 2ZGSA 4PDWA 4WVVA 1LB2A 3BALA 3LOIA 3Q9OA 4HL0A 4AQ2A 2HEYF 3VBSB 1AXYA 5AVPA 2E7TA 1NCQC 1FATA 3ZXDA 4Q4Y3 5GZDA 4RS5C 5FO8B 3R4UA 2D6KA 1BMV2 5CNAA 3MLJA 2JICA 1Y9QA 4CDQC 4Q1PA 1I9RA 3M3IA 4AFMA 4AVBA 1PGL1 3J8F2 1RTVA 3AKSA 2WS93 4N53A 5DG1A 1APNA 1JXNA 1ASJ2 4PCRA 1SBEA 1DYKA 3ZFFA 1PO12 5DUXA 4ZKTB 2XWJB 2ZGKA 1GZ9A 1ZREA 4R9BA 3MW4A 1WD3A 1O4ZA 3O5SA 1SLLA 2ZGUA 3SNMA 2OZ6A 2G9FA 3MLKA 1CVNA 4MXWA 2X29A 1G9CA 5FPZA 4U2AA 4DS0A 3HR9A 4P9WA 3WP3A 4E9KA 5FBZA 2LUWA 4B4PA 2ZGLA 1XE7A 3EXUA 3I8TA 3AP7A 1LKNA 1HRV3 5T54A 2RS53 2VGDA 1QXPA 4FPOB 2PHRA 1H2KA 4YG6A 3ZYRA 2D5FA 4EN0A 4N43C 3RS6A 1FV2A 4A7YA 2R30A 2I07B 4A7KA 2P17A 1AX2A 4Y1UA 3PVOA 4GKXA 4YZ2A 5BNPA 4OUMA 2XH6A 4ATEA 5I8YA 1ZZBA 4R9DA 4LBQA 4EROA 2K2SA 2PLV3 2PHXA 1CESA 4L11A 3WHUA 2ZHLA 4IV1A 1Q56A 2Q1MA 2VOKA 4XQDA 4NHMA 5EXOA 1KS5A 4ZU4A 4HVRA 4I30A 4W6YA 1OLQA 1V6MA 3FC0A 4LLOA 4FPYA 4H55A 2GU9A 3WDVA 2O0OA 5IK4A 2D3SA 2GC0A 1HV1A 3LOBA 5EV7A 2A3WA 4OLLA 5KC6A 4K3UA 1PGW2 1WA4A 1V70A 2VH9A 3KQRA 1I5ZA 2WL1A 5KXCA 2AGSA 3WXPA 5AFBA 1HRI1 4Q4W3 1AYN2 2EALA 4NWVA 3TN91 2PHWA 4WVMB 4QQHA 2AYHA 4GXLA 4WM7C 2EXHA 1PIV1 1CGPA 2VQ0A 1UZYA 5BUVA 1MQTB 4Q4V3 5CFCC 3NAPA 4D7TA 2HWB3 2WLPA 4K40A 4W6WA 2XLAA 5AC93 3H7YA 1AR83 4XOGA 4YLZA 3WDWA 4QPIB 1GZWB 1AJKA 1ASJ1 1DG6A 1NZCA 3WT3A 2QNKA 1ZNPA 1NCRC 5GALA 5JZGA 1OA2A 1MS8A 1YHFA 1WW5A 3BODA 2XG3A 5K0UC 2ZABA 2GSYA 1A6CA 1ULCA 2TEPA 4PDWC 1G9FA 4KQ7A 3B9CA 5FQ0A 1NLRA 2HYKA 4Y4YA 3V0BA 4JVAA 3APBA 2NZ9A 2BVVA 2DCTA 5GM0A 5AVAA 1W6PB 1W6OA 3LSDA 1DBNA 3SISA 4HSLA 2IXIA 1JYIA 1NG0A 4EN7B 1BVP1 1X8MA 1GYKA 3ILNA 4YNIA 1MVQA 1R092 1LRHA 3GBFA 1N1VA 1Y43B 1ZBA3 2HWC3 2XBO2 2D43A 2GH8A 1N3OA 4YM3A 2Q1ZB 1CAUA 1JN2P 4I3PA 4BWOA 5ABJA 4N53C 2GMEA 4C90A 4IV3A 3RMYA 2EIGA 5C8WA 4XPVA 3CJIB 2DCZA 2I2SA 3WP6A 3PNAA 3BOPA 2B45X 4H7MA 1SLBA 1QHDA 2OA2A 4Q0QA 1UCXA 3I59B 4LULA 4RL7A 5JI9A 3GHMA 1QJZA 4XJAA 1NA1B 1E57A 4ZU7A 1Q8QA 1EPWA 1KXGA 1TMF3 2XJQA 2O1QA 3DPRB 4H7LA 2D93A 2JD4A 4GMP3 3JQWA 2R49A 4YGBA 3L2YA 3TRSB 1UAIA 4Y1YA 3BU7A 5EZWA 1LESA 3VL9A 1SDWA 1UU5A 4MSVA 1AR92 4ORFA 3UJQA 4DNYA 1PO22 4FOYA 3ACLA 3E6CC 2ET7A 4I0BA 1IKPA 2OZJA 2VVDA 5C4WC 3FUQA 4K21A 4XF3A 4GH4A 1OHFA 3KS7A 3U0ZA 4D69A 1GICA 3AM2A 2MEV1 2P3JA 4JTNA 1W6MB 2ZX4A 4MLOA 4QXKA 3JBG2 3ES4A 4IV1C 2D44A 2DWRA 4GB32 3GZAA 1REDA 2D6OX 4C0HA 1ZRRA 4EJRA 1VB4A 3AYEA 5I93A 1DFQA 1W2UA 2D3PA 3SCHA 1MS9A 3D4KA 4GIQA 1ND3B 4OUSA 4HK8A 4QM9A 4XQ4A 3FJSA 4YM0A 2LTNA 5L7OB 1V6LA 5FPXA 3A0KA 5JR7B 1QJU3 2W52A 2ZKNA 3ZSKA 1OOPB 1FOD2 4M3CA 4B29A 3JQXA 3AKRA 1RMU1 3OF1A 5FOJB 3M8LA 2BYVE 1LU1A 5DDJ1 3GBWA 2PAEA 4P5HA 1X36A 5BNNB 3ENRA 5IK7A 1GR3A 5HCBA 4CDUB 2QZ2A 2QQPA 1DQ6A 4XF9A 2R063 3NAPC 3HWJA 3VLBB 3VV1A 3AXDA 4BPZA 5JOWA 1LOBA 3NVCA 2WA4A 4XIKA 2HWE1 3OPZA 1ALYA 4PIYA 4AI8A 1JW6A 1WMEA 1OMIA 4Q4X1 2WS92 3N7LA 4WM8C 4TSVA 3S7IA 3ZXLA 5JZGC 4LO6B 4UW5A 1OA4A 3WQ7A 4B7EA 1R083 1WW6A 2F6BA 4COWA 3MIGA 4PJYA 3VBSA 3D8CA 4FT8A 4KNCA 1RVF3 1DF0A 1OKQA 4IEXA 5CFDB 2CGOA 4CYDA 3IT8A 4Y1XA 4K20A 3VZLA 1VBD3 1EV11 3AYCA 5BPXA 3MGUA 1H1IA 1X82A 1LOCA 2UWCA 2R16A 4CEYA 3LA7A 2IC1A 3AMNA 2DVAA 2QE3A 3MPPG 3UKTA 4SBVA 2RS11 1HRV2 2RS52 1BK1A 4E2GA 5ABJC 1SLCA 4IV3C 5GZEA 1HXS1 4N53B 2W39A 1QJY3 2NMNA 1WUVA 4BIFA 4HN1A 1RC6A 1URXA 4HMZA 4RGGA 3OBTA 4P9LA 3ZFFB 1VBB3 4OULA 1JYCA 3BOWA 3QBQA 2B7YA 1FYUA 3JBG1 3MIEA 5CU1A 5H9PA 3KD4A 4Q0PA 1XNDA 1BKZA 2DTYA 4HSJA 1B35A 4Q2FA 2PELA 2CL2A 2JENA 2RE9A 1KFXL 1WLCA 4RR3A 4DQAA 1BEV1 3RG0A 3MDPA 4P9YA 1RUC3 3AMHA 4B7KA 5I0RA 3N35A 1FX5A 1DGWA 2WT2A 2YY1A 1VALA 4F83A 2KA3A 2WNUC 1ENXA 4I01A 4QQ2A 2ZX2A