1VBE4

Poliovirus (type 3, sabin strain, mutant 242-h2) complexed with r78206
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
68
structure length
62
Chain Sequence
b'GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 3
publication title Structures of poliovirus complexes with anti-viral drugs: implications for viral stability and drug design.
pubmed doi rcsb
molecule tags Virus
total genus 5
structure length 62
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1vbe400
4Q4W4 1AR64 1RUF4 4RHV4 1RMU4 2RS34 1R094 1COV4 1RVF4 1VRH4 1NA1D 1VBD4 2RMU4 1VBA4 2HWB4 1EAH4 3J8F4 4PDWD 2X5ID 3JBG4 1PIV4 2HWC4 1ASJ4 1MQTD 1R084 2RM24 2R074 1EV14 1D4M4 1VBC4 1AR84 1PVC4 1RUC4 2RR14 4Q4Y4 1HRV4 1VBB4 1RUE4 1PO14 1RUJ4 1NCQD 1HXS4 1Z7S4 2R044 2R064 4Q4X4 4Q4V4 1HRI4 1RHI4 1RUI4 2RS54 3JD74 1RUD4 1H8TD 1BEV4 4GB34 1PO24 1K5MD 1AL24 1OOPD 1POV0 1RUG4 2PLV4 1AR74 1VBE4 1AR94 2RS14 1RUH4
chains in the Genus database with same CATH superfamily
3AE3A 1XHXA 1RMU4 4YTMA 2PY5A 1COV4 1NEKA 3CIRA 2H89A 2WQYA 3J8F4 4YSYA 5C2TA 2X5ID 1ASJ4 2RM24 2R074 1VBC4 1D4M4 1VBB4 1RUE4 2WU2A 1HXS4 3P4SA 4Q4X4 4YSXA 1RUI4 1ZOYA 3AEDA 5C3JA 1RUD4 3AE5A 2PYLA 1BEV4 4GB34 1K5MD 3SFDA 3AEGA 1VBE4 1Z7S4 3AE1A 1RUH4 1AR64 3AE9A 2PZSA 2HWB4 1NENA 1EAH4 3AEAA 1L0VA 3VRBA 1PIV4 2HWC4 3P4QA 3AEFA 3GQHA 4YTNA 1XI1A 3AEEA 1EV14 1AR84 1PVC4 2WDVA 2R044 1YQ4A 1YQ3A 1HRI4 3AE6A 2RS54 2WU5A 1H8TD 2EX3A 1KFYA 1AL24 3AECA 3AE2A 3VR8A 2PYJA 3ABVA 2ACZA 1R094 1VRH4 3AE7A 1NA1D 2RMU4 3P4RA 1VBA4 4KX6A 3JBG4 4YSZA 3VRAA 1MQTD 1R084 2WDQA 2WP9A 3GQKA 1HRV4 1NCQD 1XHZA 2R064 1RHI4 3JD74 2WS3A 4YXDA 3SUCA 2R7FA 1POV0 1RUG4 2PLV4 1AR74 2H88A 4PDWD 4Q4W4 3VR9A 1RUF4 4RHV4 4YTPA 2RS34 1RVF4 3SFEA 1KF6A 1VBD4 2FBWA 3AE8A 2B76A 3AEBA 4Q4Y4 1RUC4 2RR14 1PO14 1RUJ4 2WDRA 4Q4V4 3P4PA 1ZP0A 4YT0A 1PO24 3FI7A 1OOPD 3AE4A 1AR94 2RS14 2PW9A
chains in the Genus database with same CATH topology
4Q4W4 1AR64 1RUF4 4RHV4 1RMU4 2RS34 1R094 1COV4 1RVF4 1VRH4 1NA1D 1VBD4 2RMU4 1VBA4 2HWB4 1EAH4 3J8F4 4PDWD 2X5ID 3JBG4 1PIV4 2HWC4 1ASJ4 1MQTD 1R084 2RM24 2R074 1EV14 1D4M4 1VBC4 1AR84 1PVC4 1RUC4 2RR14 4Q4Y4 1HRV4 1VBB4 1RUE4 1PO14 1RUJ4 1NCQD 1HXS4 1Z7S4 2R044 2R064 4Q4X4 4Q4V4 1HRI4 1RHI4 1RUI4 2RS54 3JD74 1RUD4 1H8TD 1BEV4 4GB34 1PO24 1K5MD 1AL24 1OOPD 1POV0 1RUG4 2PLV4 1AR74 1VBE4 1AR94 2RS14 1RUH4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q4W 4;  1AR6 4;  1RUF 4;  4RHV 4;  1RMU 4;  2RS3 4;  1R09 4;  1COV 4;  1RVF 4;  1VRH 4;  1NA1 D;  1VBD 4;  2RMU 4;  1VBA 4;  2HWB 4;  1EAH 4;  3J8F 4;  4PDW D;  2X5I D;  3JBG 4;  1PIV 4;  2HWC 4;  1ASJ 4;  1MQT D;  1R08 4;  2RM2 4;  2R07 4;  1EV1 4;  1D4M 4;  1VBC 4;  1AR8 4;  1PVC 4;  1RUC 4;  2RR1 4;  4Q4Y 4;  1HRV 4;  1VBB 4;  1RUE 4;  1PO1 4;  1RUJ 4;  1NCQ D;  1HXS 4;  1Z7S 4;  2R04 4;  2R06 4;  4Q4X 4;  4Q4V 4;  1HRI 4;  1RHI 4;  1RUI 4;  2RS5 4;  3JD7 4;  1RUD 4;  1H8T D;  1BEV 4;  4GB3 4;  1PO2 4;  1K5M D;  1AL2 4;  1OOP D;  1POV 0;  1RUG 4;  2PLV 4;  1AR7 4;  1VBE 4;  1AR9 4;  2RS1 4;  1RUH 4; 
#chains in the Genus database with same CATH topology
 3AE3 A;  1XHX A;  1RMU 4;  4YTM A;  2PY5 A;  1COV 4;  1NEK A;  3CIR A;  2H89 A;  2WQY A;  3J8F 4;  4YSY A;  5C2T A;  2X5I D;  1ASJ 4;  2RM2 4;  2R07 4;  1VBC 4;  1D4M 4;  1VBB 4;  1RUE 4;  2WU2 A;  1HXS 4;  3P4S A;  4Q4X 4;  4YSX A;  1RUI 4;  1ZOY A;  3AED A;  5C3J A;  1RUD 4;  3AE5 A;  2PYL A;  1BEV 4;  4GB3 4;  1K5M D;  3SFD A;  3AEG A;  1VBE 4;  1Z7S 4;  3AE1 A;  1RUH 4;  1AR6 4;  3AE9 A;  2PZS A;  2HWB 4;  1NEN A;  1EAH 4;  3AEA A;  1L0V A;  3VRB A;  1PIV 4;  2HWC 4;  3P4Q A;  3AEF A;  3GQH A;  4YTN A;  1XI1 A;  3AEE A;  1EV1 4;  1AR8 4;  1PVC 4;  2WDV A;  2R04 4;  1YQ4 A;  1YQ3 A;  1HRI 4;  3AE6 A;  2RS5 4;  2WU5 A;  1H8T D;  2EX3 A;  1KFY A;  1AL2 4;  3AEC A;  3AE2 A;  3VR8 A;  2PYJ A;  3ABV A;  2ACZ A;  1R09 4;  1VRH 4;  3AE7 A;  1NA1 D;  2RMU 4;  3P4R A;  1VBA 4;  4KX6 A;  3JBG 4;  4YSZ A;  3VRA A;  1MQT D;  1R08 4;  2WDQ A;  2WP9 A;  3GQK A;  1HRV 4;  1NCQ D;  1XHZ A;  2R06 4;  1RHI 4;  3JD7 4;  2WS3 A;  4YXD A;  3SUC A;  2R7F A;  1POV 0;  1RUG 4;  2PLV 4;  1AR7 4;  2H88 A;  4PDW D;  4Q4W 4;  3VR9 A;  1RUF 4;  4RHV 4;  4YTP A;  2RS3 4;  1RVF 4;  3SFE A;  1KF6 A;  1VBD 4;  2FBW A;  3AE8 A;  2B76 A;  3AEB A;  4Q4Y 4;  1RUC 4;  2RR1 4;  1PO1 4;  1RUJ 4;  2WDR A;  4Q4V 4;  3P4P A;  1ZP0 A;  4YT0 A;  1PO2 4;  3FI7 A;  1OOP D;  3AE4 A;  1AR9 4;  2RS1 4;  2PW9 A; 
#chains in the Genus database with same CATH homology
 4Q4W 4;  1AR6 4;  1RUF 4;  4RHV 4;  1RMU 4;  2RS3 4;  1R09 4;  1COV 4;  1RVF 4;  1VRH 4;  1NA1 D;  1VBD 4;  2RMU 4;  1VBA 4;  2HWB 4;  1EAH 4;  3J8F 4;  4PDW D;  2X5I D;  3JBG 4;  1PIV 4;  2HWC 4;  1ASJ 4;  1MQT D;  1R08 4;  2RM2 4;  2R07 4;  1EV1 4;  1D4M 4;  1VBC 4;  1AR8 4;  1PVC 4;  1RUC 4;  2RR1 4;  4Q4Y 4;  1HRV 4;  1VBB 4;  1RUE 4;  1PO1 4;  1RUJ 4;  1NCQ D;  1HXS 4;  1Z7S 4;  2R04 4;  2R06 4;  4Q4X 4;  4Q4V 4;  1HRI 4;  1RHI 4;  1RUI 4;  2RS5 4;  3JD7 4;  1RUD 4;  1H8T D;  1BEV 4;  4GB3 4;  1PO2 4;  1K5M D;  1AL2 4;  1OOP D;  1POV 0;  1RUG 4;  2PLV 4;  1AR7 4;  1VBE 4;  1AR9 4;  2RS1 4;  1RUH 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...