1VC0A

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in imidazole and sr2+ solution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
total genus 22
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vc0A00
2B0GA 3ZZYA 2CQ2A 1M5PC 2X1BA 3TP2A 3U1MA 4YUDA 5GAEU 4TU7A 3LQVA 3Q2TC 1S79A 2HGLA 2KI2A 2RT3A 1H2UX 2ZJQQ 2FPHX 5LSOA 3V4MA 3G8TA 2N3LA 3G4SS 1WHWA 2RUGA 2M8DB 2DO4A 2DNOA 4WCEQ 3MUMP 3N9UC 2AYMA 2XB2D 2DGTA 2LA4A 3MD1A 2RNEA 1KQSR 1U2FA 2J8AA 3CCQS 2MB0B 2QA4S 1F9FA 3K0JA 4J5OA 2AYBA 5GVQA 4LIRA 3CF5Q 2CPEA 3VAFA 1Q86T 4TU9A 2ADCA 1Q81T 2BZ2A 1M5VC 1WF2A 4LMZA 2OSQA 2D9PA 1M90T 3CUNA 1KOHA 2KYXA 2MZJA 2LYVA 2ADBA 4YB1P 3UCGA 4PKDB 1ZZFA 3VF0B 5DDQC 1YIJS 1VBXA 2QEXS 2DHGA 1WEYA 4WFBQ 2CQ0A 2DHAA 5LJ5Y 3VAHA 2OTJS 2CPJA 3SXLA 3Q2SC 1DZ5A 4FXVA 2XNRA 2MMYA 5DDRC 4CQ1A 2AYEA 3MURP 1OPIA 5IM0B 5GAHU 2YH1A 3LPYA 4CH1A 3CCVS 2VONA 2L08A 3SDEB 2BOPA 1X4FA 4WFNQ 2NLWA 3R27A 4M5DB 2CQ4A 2F3JA 2PEHA 2M9KA 1ZZNA 1X4EA 2KN4A 1VQ4S 1R8PA 2A3JA 2CQDA 3UD4P 1P27B 2LEBA 1WELA 1KC8T 3G9CA 3EGZA 2DNHA 3VALA 2MKIA 2Q79A 5D77A 5CYJA 1U1QA 2DGVA 2HZCA 4P6QA 5IM0A 2RU3A 4IUFA 3SDEA 2DH7A 1SJ3P 4A8XA 2ZJRQ 4UY8T 4BS2A 1M1KT 2JRSA 2DGWA 5DM6Q 1FNXH 5MLCV 1DBDA 2XNQA 2MKJA 1OO0B 2RS2A 1U1KA 1WF0A 1YHQS 3NNCA 2K8GA 3CCUS 2PE8A 1WG5A 1X4AA 2MZRA 2VOOA 2E44A 3S01A 2XS7A 2KRRA 2CQIA 2JX2A 1FJCA 4Z2XA 2DNGA 1VQNS 2CJKA 2CQBA 2M0GB 1URNA 2KHCA 1VBYA 3TYTA 2FC9A 1YI2S 4OZ1A 2XS5A 2DNRA 2X1AA 3B4MA 3MUTP 1JMTA 4F02A 2HYIB 3IRWP 4RU2A 2MJUA 2DNYA 1SXLA 3CC4S 2M88A 3TO8A 5H1SV 1X5OA 2E5IA 5GAGU 2RVJA 2N7CA 2YWKA 2KG1A 5IFMA 4EGLA 1WG1A 1Q82T 2ZJPQ 3H2VE 2JVOA 2OIHA 2M52A 5CA5A 1NO8A 2DIUA 1WHYA 2RQCA 2CPHA 2LKZA 3THPA 3NMRA 5DDPC 1FJ7A 3CC2S 1WEZA 1X4DA 4C0OC 4ZKAA 1WHXA 1FT8A 1VC5A 4F26A 2MQQA 2MKCA 1H2TZ 2CQCA 3CMAS 1U1PA 2DNKA 2KVIA 1VQ5S 2X1GA 5ITHA 2DGSA 2LCWA 2MYFA 3G6ES 2DNZA 2KM8B 2M4MA 5LXYA 2CPZA 5JVHQ 5DM7Q 1X4HA 2DGXA 1X5PA 1U6FA 1S72S 1N88A 4V19X 3BO3A 3NS6A 1SJ4P 1U1RA 2I38A 1VQ8S 2JWNA 2HVZA 1DHMA 2LXUA 2DGOA 1VQOS 2D9OA 5LJ3Y 2E5JA 1XN9A 2V94A 4UQTA 1BY9A 2J76E 4Y00A 2MZTA 5D78A 1WI6A 1OWXA 2WBRA 4TU8A 5FJ4A 3R1LA 3P5TL 3S8SA 1PGZA 2X1FA 1X5TA 1N52B 1K73T 2AYGA 3HI9A 2KXNB 1YTYA 2U1AA 3ULHA 1WEXA 2DISA 1QVGR 1WHVA 2F9DA 3PIOQ 1UW4A 2DITA 2OTLS 2KXHA 1RKJA 2CQ1A 5JVGQ 2CPXA 4WFAQ 2U2FA 3EX7B 4Y0FA 1FJEB 3BO4A 2UP1A 1O0PA 2ERRA 2OSRA 1UAWA 3MD3A 1VBZA 3S6EA 2YH0A 2LECA 2G0CA 3PIPQ 1CVJA 1YJWS 4W92B 3CTRA 3NNHA 2VOPA 1DRZA 1YITS 3CXCR 5IQQA 1SJQA 3CCSS 1VQ9S 1YJNS 1SJFA 2MQMA 2MGZB 2RS8A 2M7SA 1G2EA 3I56S 3DXBA 3G8SA 1JJ4A 1ZH5A 1D8ZA 3JB9k 1JJ2R 3S7RA 2DNMA 1OIAA 2CPDA 1VQ7S 2LA6A 4PRFA 2MHNA 3CCRS 3VAIA 3R1HA 2DGUA 5LSLA 2MKKA 2GO9A 2NZ4A 3SMZA 5GMKa 3UWTA 2MSSA 2FHOB 2EK6A 3VAKA 1M5OC 1VQKS 1WTBA 3CCES 2CPYA 2RRAA 3CD6S 3J7YU 1U1LA 1N54B 4QQBA 2AD9A 1HL6A 1VQPS 2I2YA 2CQPA 2G4BA 4ED5A 2QFJA 2L41A 4ERDA 4WF9Q 2DH9A 3B4DA 1WF1A 1L3KA 4U67Q 2MGZA 4IO9Q 1PO6A 3D2WA 1K9MT 1R8HA 3H2UB 4W90B 2YKAA 1K8AT 2JVRA 1KOOA 2MY8A 3I55S 3RW7A 2DGQA 2E5HA 2KH9A 3VAGA 2XS2A 5HL7Q 3UCZP 2GHPA 1U1MA 3RW6A 1UP1A 4IOCQ 3DLLQ 2DNQA 2N82B 1H2VZ 1X4GA 3HHNB 3P6YC 3MXHP 2MZQA 2DO0A 2K3KA 1YWXA 1IQTA 5GADU 3MDFA 1B7FA 3G96A 1Q7YT 2DK2A 2MKSA 3UD3P 2J0QD 3CULA 2CQ3A 2XSFA 2M2BA 1HD1A 4F25A 2LXIA 2CQGA 2KFYA 1WG4A 4C4WA 5LXRA 2DH8A 2MQNA 2MSTA 1X4BA 2FC8A 2DNPA 1QM9A 2MZSA 2MJNA 2G1DA 1VC0A 1A7GE 1RK8A 2F9JA 3CCJS 2MQPA 1FO1A 3MUVP 5DETA 3BO2A 2KT5A 3FEXB 3THTA 1VQMS 3CMES 2EK1A 2CPIA 3U1LA 3ZZZA 1WWHA 1KD1T 2KRBA 3NS5A 2DHXA 5HO4A 4YOEA 4WKRA 3OW2R 5CXTA 3L3CA 2E5GA 2MZ1A 4QPTA 5DDOC 3US5A 2DHSA 3CCLS 4WIIA 2CQHA 1NJIT 4TLQA 2O3DA 5EN1A 2DB1A 2CPFA 2MPUA 2MXYA 3CCMS 1VQLS 1X0FA 1VQ6S 2HGMA 3UCUP 4PR6A 2MQLA 3CPWR 1N8RT 4CIOA 2M70A 2MKHA 3J7ZT 3IWNC 4LJMA 1U6BA 1X4CA 1UFWA 2MY7A 3VAMA 3EGNA 3BEGB 1HA1A 3VAJA 1QVFR 2D3OR 1U1NA 2L9WA 4OZ0A 2DNLA 2KG0A 2KXFA 1JJHA 2FY1A 4QU6A 5BJRA 3NNAA 1WI8A 1HD0A 2LMIA 2YTCA 2EVZA 1H6KX 2KM8C 4C7QA 2OJ3A 2J0SD 1FHTA 1NU4A 3P3DA 3MOJB 3UE2A 1SJRA 2LQ5A 4IOAQ 2DNNA 1P1TA 1YJ9S 1X5SA 2RRBA 1U1OA 1W2BR 3G71S 4FXWA 1AUDA 1VC6A 4QU7A 3MI7X 3CC7S 4CH0S 1FXLA 2KU7A 2DIVA 2RQ4A 3BS9A 2MQOA 1A9NB 2LEAA 2N3OA 2VODA 1D9AA 2HGNA 2SXLA 3P49B 3FEYB 1M5KC 2M8HA
chains in the Genus database with same CATH superfamily
2B9YA 1QE1A 4K0KJ 3Q2TC 3BSAA 3GJTB 1XMOJ 3M32B 3PDNA 3QFHA 1KS2A 2EFQA 3GYNA 2BA9A 2R2UA 3KJVA 3C6TA 2RNEA 3KLGB 2OPRA 2W01A 1BXNA 2YQ0A 1X0PA 2QLJB 3ZZOA 4TU9A 4N7TA 2VDHA 1KOHA 4HEA9 4NI2A 4Y3CA 3OL6A 3ZTOA 2HFOA 2GVDB 2GMJA 2WBMA 4I2QA 1YRUA 2DHHA 3OLAA 1TVRB 4IG0A 1FX4A 1ZZNA 3KDOA 2A3JA 2CXEA 1WELA 3NRBA 1HBUB 2DNHA 2N4DA 4M5MA 1IKYA 1V5VA 1T3NA 4R8UB 3VHQA 3NAIA 4C8YA 2RU3A 4IUFA 4DF4A 3CT9A 4A8XA 3GTYX 3ETMA 3CE8A 3OR1B 4J9OA 1T94A 3DI6A 2WK4A 4DPYA 1X4AA 2XI3A 2XS7A 4LSNB 1K47A 1PYSB 4K4YA 1IN0A 4B9SA 3M2VA 1VBYA 1FWPA 3LWMA 3BDEA 4J7CA 2YNIB 3UN2A 1D0EA 2WCXA 3FEZA 1X5OA 3GJRB 4BHQA 3WX8A 1MMLA 1WG1A 1Q82T 3HT3A 5CZVA 1LXJA 2DR5A 2CVIA 1HFEL 2CFXA 2R8GA 2OELA 2DYAA 3NMRA 1OSDA 1IBMF 1WHXA 2MQQA 2B51A 3AHPA 1WOPA 4LRCA 5C7PA 4RW8B 1N88A 2FZKB 4CT9A 2NSBA 2D9OA 2DXEA 5L46A 4Y00A 3PKYA 2I8EA 1Y10A 2G13A 3CCWA 2KXNB 3C2PA 2C3MA 5KAKA 2XLJA 1ZTWA 5A8RA 3LP0A 2GMHA 1EP4A 3AXMA 4KC5A 4Y0FA 4O44B 3E01B 3CSKA 2CZ9A 2B4OA 1YITS 1RTJB 3SBMA 2MGZB 3JB9k 3S7RA 1U2RA 3VAIA 4WU2A 2MKKA 4HL9A 3SMZA 3GPAA 4CO1A 4DR2F 1FRIA 3M6UA 1I51B 5KFXA 4M8LA 2RRAA 1N54B 2L41A 1L3KA 1FE0A 3D2WA 2KJWA 4ZK7M 4RW6A 3J81j 1KRPA 3BR8A 2KB2A 3R7NB 2C2EA 2H4WB 1E6VB 1V6HA 5ETRA 4LFAJ 3HFVA 4GVLA 3EXYA 2DO0A 3TJAA 4ZIWA 1RGVA 2HVEA 5F8NA 5LMNF 4KGZB 2DCUB 2J0QD 4PG4A 3JAMU 3VCDA 4DV0J 4RBVA 2M2BA 2CYYA 2ZBCA 2IAJA 3WBZA 1GQEA 3HK2A 3HHLA 4BWJA 4M63A 2R7UA 3PR4A 3OHAA 3UDCA 3TEGA 2WAQD 1LK7A 3RAXA 1J5OB 4PQUB 3D6FB 4YB6A 4DV6J 1RWXB 1N5SA 4Q43A 2XCPA 2R2RA 3NY0A 5DRKA 3M7VA 1WNEA 4B3TJ 3GFYA 3MHYA 2UUBJ 2CQHA 4DU7A 3JYTB 1NJIT 2JFDA 4USHA 3OJSA 2MPUA 1WC4A 3KUHA 4DR7F 2VG7B 2OPPB 4C8NA 4PR6A 2GC8A 3D4JA 3KHRA 2RILA 4LJMA 4QYZK 2IC3A 3M8PA 3D3BJ 1JJHA 1YJUA 2FY1A 3QAUA 5DQIA 1WI8A 1VIXA 1OYDA 4I6YA 1C1CA 1QE1B 2FLNA 1R89A 1H6KX 3OHBA 2KM8C 1NZ8A 1WSRA 3MR6A 2HRUA 3SYZA 5DLGA 1RZMA 2YPYA 3KJVB 3C6TB 2MQOA 1RT5A 1N5YA 2OPRB 4ICLA 4ZJQA 2MHEA 1HQEA 5GAEU 2HGLA 3BSCA 5CH7B 3V4MA 3R5JB 4NI2B 3TZZA 3CDWA 3A8EA 1AZSA 1U4BA 3TW0A 1ZA2B 2WB4A 2GCFA 1HMVA 3MEDA 2GQQA 4I2QB 4URGA 1J5EF 2IYIA 5KFLA 3PRBA 3PYDA 1RAJA 4K4TA 1NKCA 3CUNA 4IG0B 2MZJA 4DHVA 2MDAA 3QYYA 2GFFA 2JL9A 3JTOA 3K58A 1IKYB 3SXLA 3F73A 5DDRC 1OPIA 2K1RA 2L08A 3KYLA 3QJPA 3IS9A 2CQ4A 2OMLA 4ZJOA 3MOZA 2VBXA 2V4QA 1R8PA 5A76A 2NPFA 3DI6B 3FMBA 2Y9HA 1KONA 4YEAA 2RQKA 1LW0A 5BYRA 4F2SA 3H59A 3M2VB 1UVIA 2Y0BB 4W98A 2QMUB 2HQGA 2VOOA 2OEMA 4ZLLA 3BYPA 5M2PA 1NK5A 2CQBA 1N4LA 1UVMA 1ZM3A 2HYIB 2V6AA 2DNYA 4PXBA 3OBIA 2ZFHA 4E2FB 1XR5A 4K8RA 1KNZA 1RE1B 3Q8VA 4FF1A 1RYRA 5KFTA 1JKHA 1IKVA 4P9SA 5DDPC 1NSPA 2EFPA 2E5LF 4DX7A 1SQEA 4PCQA 3AXKA 4JBCA 3CMAS 2LQBA 2C3OA 1EIYB 2RSQA 3G6ES 2EC2A 2DGXA 3OL9A 2M5YA 2HBQB 1SJ4P 2GX8A 2JWNA 2BJ1A 1RUSA 3ENAA 1IBKJ 4M5KA 5A8RB 5CABA 3LP0B 1EP4B 4DR6F 4C11A 3CCZA 1B99A 2CJBA 4ER8A 3TOQA 3W9JA 1WEXA 1WOSA 4EEYA 1F1BB 1L5UA 4DR5F 2U2FA 3TVZA 4PXDA 4OZ2A 4ATNA 4QOTA 3EDQB 4F04B 1SH3A 3H5XA 3F44A 3GU0A 3BN4A 2MTLA 3HF5A 4H4MA 2BR0A 1WSVA 3RRHA 3ICLA 1ZH5A 5ETQA 4WXOA 4RW6B 3DLBA 3NGUA 3KTQA 2NYIA 5K8PA 4KPYA 4JV2A 4H54A 1VGYA 2OUGA 1GMWD 3KHLA 1KVKA 2ZM6F 3PVXA 2DH9A 4IO9Q 2H4YB 5I4MA 2V4RA 2COLA 2BYCA 2BE2A 4X65F 2KTQA 2IAJB 1UZHA 4DPWA 3HHLB 3ZXWA 3MFHA 2C42A 5B0FA 1LK5A 5A8KA 2K3KA 3UNYA 4IRCA 3K5MA 4E8UA 4F25A 1FFGB 4KGMA 3EYZA 3UQSA 2HFSA 3PW4A 1MWYA 4F8RA 2RRNA 2WSCC 1C1BA 1Q4RA 1QM9A 2AJQA 3ZZUA 2F9JA 5K5MA 2JLEA 3CMES 2LXFA 2BRLA 1ULRA 2BJDA 4J9KA 3DLEA 3D68A 2IC3B 3DOLA 3M8PB 2GNKA 3US5A 3J80U 2D7SA 2CPFA 4U9RA 3FSXA 1C1CB 4J9MA 3CO9A 2K7KA 1D1UA 3GJQB 2DPIA 4KV8A 4UF4A 1ROFA 2J5AA 1RT5B 4DV5F 1N5YB 2GA7A 4ICLB 4QU6A 1R8BA 1HQEB 4KBIA 1KKHA 2YTCA 4RX6A 1XNQF 2VA3A 2J9DA 4IOAQ 1SJRA 5HROA 1B70B 4GKJF 1PJ7A 1IBMJ 1AZSB 2JEIA 3R3TA 1HI0P 1HMVB 1KHVA 3MEDB 3ENWA 1AW0A 5BR8F 4FPIA 3BS9A 5GAHI 2IJFA 2QLFB 3K89A 1JLCA 2XYPB 5EDWA 2B7BB 5HP1A 4URQU 1H2UX 2ZJQQ 5ETVA 3I9ZA 1WHWA 2VBWA 3Q89A 2DGTA 3POTA 1FFWB 2FLLA 2K1RB 3PXGa 2YQ3A 3IS9B 1RLCL 3CIZA 2C1EB 2UVVA 5C2GA 4WP8A 3BQ2A 3TUZC 1NPKA 2IYGA 2V2ZA 5I3UA 1LW0B 1VYAA 4N8NA 4KJIA 3W63A 1MMNA 4E0DA 3TA1A 2QTWA 1L3UA 2NLWA 5IT9U 1Q7LB 3ZTSA 1RWMB 1YDLA 1P27B 1VLYA 1L3SA 1Y5NB 3VGUA 4RWWA 2IBKA 4DR2J 4RLEA 2EI5A 1U02A 4MKBA 3KK2A 1NRKA 3CJSA 3CVKA 1UPMB 2H54B 3CD5A 1RWPB 4CP5A 1IKXA 4ZMMA 5HJYA 1Y3JA 4NLUA 2POKA 1S1TA 1LQ9A 3OTDA 3E51A 4TY8A 3ITHA 1KHWA 3MR5A 2LU2A 4YR0A 1WDDA 2UUTA 3QO9A 4I56A 3NEKA 3SFGA 5AXLA 2JNJA 4FBTA 2V9WA 2EG1A 1G4CA 1JKHB 1IKVB 3HVWA 3PFEA 1FRJA 4Z7YA 5LMNJ 1Z2ZA 2FC9A 5AE1A 1YK9A 1YBAA 2FHKA 3PV8A 4RNOA 1UZDA 2M3DA 2V8DA 1UEVA 1EAYC 2M88A 1JWWA 2RH3A 1UVJA 2GW8A 4ECRA 1Q5VA 2Z2YB 4PAAA 4C11B 1FJ7A 1X4DA 4MYUA 3PHEA 4DSFA 1WACA 4UZCA 3M6XA 1VS3A 3NS6A 1WKLA 4M95A 2DGOA 3HFZB 3AQOA 1LV5A 4RUBA 2V94A 2CNNB 2OFHX 2MZTA 2DJWA 1U2CA 4DR7J 5KFSA 2VDIA 1YBTA 2OD6A 4H4MB 4TN2A 4DR4F 4B9LA 5JVGQ 3M2UA 1VCTA 5KFZA 3U1NA 3B78A 5ETPA 3RYLA 2LDIA 3EPIA 3KWMA 2CZVC 5DQGA 2HZVA 1UVLA 5IQQA 3K7RA 4DL0C 3GWCA 1YVFA 5KFCA 4TQRA 1VHFA 2CPDA 2BE2B 4OX6A 2DGUA 5LSLA 2HHUA 1FRXA 4TY9A 3CCES 1S5ZA 4ANCA 1T3OA 2JFKA 5A8KB 1U1LA 1HL6A 3M8SA 1B3TA 3UO0A 4IDKA 4KSEB 4NEZA 2Z56B 3D0GE 4UTGA 5FIIA 4KT0C 1HHTP 3AOBA 4FYWB 1HHQA 1J5EJ 3Q0AA 2KL8A 2WW4A 5HL7Q 1RACB 1NMEB 1UP1A 3PYFA 3MXHP 5A6WA 2YWEA 5B0BA 6AT1B 5GADU 1C1BB 4NXMF 4DSJA 1Z2LA 4ECWA 1RAIB 4RNHA 1FEEA 1S6QA 1F9EB 1T9YA 1PJ5A 1FTRA 3DLEB 3PO5A 2ROGA 3DOLB 4OHZA 2XY6A 2PD1A 2NCKL 2HNZA 2Y1IA 2F4VF 1CJUA 3U1LA 1NNDA 4PXEA 4CCHA 2KRBA 4KV8B 2HRTA 4USWA 3WDOA 3RJMB 1HW8A 3V81A 3GONA 3L09A 3O5TB 2XY7A 3V5RA 3FCWA 4F4YA 1R0AA 5IC6B 4RJVA 1VQLS 3E8OA 2HWHA 4LRFA 1HLWA 4GC7A 2IRXA 1N8RT 2OP5A 4M5JA 5HROB 1EARA 4I69A 4ED3A 3RRGA 2MKYA 1FXRA 2L9WA 2V5HG 2KG0A 4RNMA 1QUPA 1KFDA 1JLCB 5HP1B 4LF7F 1R27B 3OUYA 3QT5A 5B0EA 4LF6F 5B08A 2ASYA 3AJ1A 3OTCA 4RKUC 2E5LJ 4WP3A 3EGWB 4DPOA 4DDFA 3POTB 1A9NB 1UFKA 2A18A 2BQ3A 3HZEA 1FTCA 4ALZA 3J81Y 3TP2A 3EUNA 3OSPA 3C15A 1TK5A 3QT7A 1X60A 3IR5B 2DNOA 5IWAF 4JI1F 3R5CA 3KG4A 4DUTA 2HNDA 4OI0A 5I3UB 1UJ5A 1C0TA 2ZKUA 4J5OA 2AYBA 5LSRA 2OSQA 2QA2A 3QSIA 1IQZA 3MPVA 3TRGA 1Z1ZA 4RUCA 2I5JA 4ZHRA 4DR5J 1S9EA 3MEGA 1AUSL 3AA8A 3WIUA 2CPJA 1Q8KA 4DL4A 1H74A 3KK2B 1H7WA 4P73A 2DRAA 1IKXB 1FXDA 1S76D 1RABB 4M5NA 2PI5A 1S1TB 4HT5A 4LVNP 2X3GA 3EGVA 4TY8B 2L3MA 3ITHB 2MKIA 1S49A 4ZPDA 3QO9B 2CG4A 1AB8A 1JLBA 1RHKB 4LREA 4QIWD 2ZM6J 1TELA 5KG7A 4ZN3A 4YN3B 3H40A 2C3YA 3NS7B 4CNZA 3ISND 4X65J 5D0HA 3QGPA 3DHXA 2RE1A 2CKWA 3M8QA 3ZZ0A 4Z2XA 1RCOB 2QYCA 3UR0A 4NX9A 1RSCA 3OR2A 1URNA 1VMBA 3KUEA 2E9TA 4QYZJ 4NYZA 4DWIA 2H51B 3CC4S 4EMDA 3SIPB 1VK8A 3RRKA 4WIQA 3JSRA 3MR3A 4OHXA 2XCAA 2B9WA 2MKCA 2DY1A 5EUHA 3NGTA 2KVIA 4DCPB 1T0TV 4ZVUB 2FHMA 2IVMA 4X4QA 5LXYA 2DTJA 5C24A 2RAQA 5KT6A 2RB7A 2ZHBA 1FI4A 1NPRA 1B4SA 3DDNA 5F41A 3M2UB 3W5YA 3QRQA 2BJ8A 2WVFA 1NJYA 2AGOA 4O3RA 3FK4A 3J7YI 2OEKA 1X8DA 4FS2A 3AB4B 5M2UA 4Q45A 3TUIC 3M6WA 2DITA 3PO4A 3CGIA 4WFAQ 4AL6A 4DV5J 1TAUA 3TARA 1IBCB 2UP1A 4Y2IA 1QTMA 1RU2A 3K8VA 1XNQJ 4W92B 2Y1LB 2VOPA 1DRZA 3CXCR 1Z4UA 4LFCF 1SJQA 3CW2C 3V4IA 4U8YA 4LBIA 4J9SA 4IDKB 4PABA 3D5MA 3KNAA 4J9NA 3ZZRA 3VQTA 4Q2MA 2XMUA 1W25A 2E7XA 2QN6B 2H3EB 3BH7B 2DEJA 2ZH6A 1FEHA 2OO4A 5DO2A 3CJ8A 3G82A 1S6QB 2AMCB 1REVA 4KB7A 1RWUA 3K57A 2ZZMA 2B9XA 5EX0A 2HLUA 3WHIA 1YWXA 4P71A 4K5RA 5KG1A 5F8MA 3G96A 3ELHA 3HHDA 2HNZB 2R7TA 1I6JA 3FQLA 2ZH3A 4JI4F 1NBEB 1CJUB 1DQAA 5D3GA 2YPZA 3FMWA 5C25A 4M5HA 4I4BA 1OY6A 1CJTA 4KR0B 3V81B 3UN5A 4NLOA 2A1BA 1R0AB 1C2PA 3BKUA 3CDEA 2E1RA 2E9ZA 2YKQA 2AP6A 1VIOA 3SSRA 1SKSA 3OW2R 1U0SA 3NGDA 1I94F 4EFAC 3WC2A 2W4DA 5EN1A 1GTHA 3TUJC 5DGAA 3OUYB 2R42A 3IGNA 3CJTA 4MT1A 2F40A 3BSOA 2D3OR 2BKNA 2CG8A 4OZ0A 2NREA 4K4XA 1SL0A 1J2VA 1T8EA 4NA1A 3HXMA 1YQHA 1NM2A 1TUWA 3C15B 1M5HA 3DOKA 1W2BR 5J2MA 5H9FK 2HNDB 2KU7A 2N3OA 1B7YB 4NLQA 4J91A 1C0TB 3ZZYA 1SC4B 1M5PC 4TU7A 1XC9A 4KHMA 2KI2A 4J9VA 3V6JA 2I5JB 2R2SA 4ZHRB 2YWGA 5LSOA 1Q0NA 1NKBA 5CZXA 1XK8A 1S9EB 3T9ZA 3MEGB 4FNIA 1ACMB 2ZBPA 4EWTA 1F3FA 3AJDA 2MB0B 4UY85 1NSQA 4DX8H 1EETA 1PYTA 4LR7A 3FZ2A 3EVOA 4DR4J 1CQNA 3LUYA 3Q22A 1YIJS 1DQ9A 3VF0B 1TKZA 2MQ8A 2DCLA 2CNOB 2AYEA 1JLBB 2BOPA 1UTAA 2LP4A 4PPDA 2KN4A 4C48A 3MAHA 1UETA 1HBOA 3AY0A 3OTBA 2W2MP 2BJEA 3H5UA 3M8QB 3UDLA 2Z57B 1SCJB 3ISZA 4MIAA 1BMQB 4Q44A 3OR2B 2XHCA 3AH6A 2JRSA 4OYOA 1YBUA 2RS2A 3RTVA 2J6TA 1S1WA 4HH0A 3MPWA 3BM7A 3CO0P 4KIAA 3HMJG 1TUGB 1VQNS 3NGRA 2RDIA 4L74A 3EE3A 4TXSA 4FDFA 2EPIA 4B9UA 4FYXB 3MUTP 2YY3A 4TLRA 2XGPA 4OYZA 5C24B 1HW9A 5B7WA 1R43A 2Z8QA 4Y2KA 1V9OA 2LKZA 4BCAA 2VIHA 3NWRA 2XI2A 1SH0A 2F4VJ 3H4BA 5DM7Q 2HQ3A 3HJFA 2UUCJ 4ITSA 1P6TA 2E5JA 2QLBB 1BY9A 2IRYA 2RHSB 4HTJA 1U24A 2WBRA 3DC2A 2EFOA 2P6TA 4H4KA 1YTYA 3M6VA 4F50A 4ZVSB 4ETZA 3V4IB 2Y8YA 1NK9A 2OTLS 3PY8A 1RHJB 5E0OA 3W8GA 1FWLA 2VL1A 4OJ3A 1P9YA 3RB4A 1QSLA 3D28A 1R3NA 4LF7J 1CVJA 1S59A 4LF6J 4YDDB 2D3ZA 4WXWA 4CDIA 2FYXA 2EBEA 4J90A 2UZAA 3MFIA 4UOCA 5HVFA 4J9QA 4GKKF 3G82B 4QIGA 5HMZA 4EO8A 1REVB 5E3PA 4AFFA 3AOCA 1FKPA 3V6DA 2VFVA 3ZTPA 3FCHA 2HAFA 2G4BA 3NCRA 2DXDA 2QFJA 4NE9C 4WF9Q 4JI1J 1WF1A 2AU0A 1PO6A 2XY5A 1AT1B 1HR0F 2EFVA 1PC5A 2E5HA 1REGX 5D3GB 4UOFA 4A46A 5C25B 4R5PA 1CJTB 3KLVA 2PA3A 1VBKA 2KKHA 2MKSA 3RBEA 5DLFA 5K14A 2E7WA 2BM0A 2AV5A 4LQ3A 2VPWB 4DV7F 3FDSA 4QWAA 4JI0F 1K0TA 1HARA 4ILMA 1VK3A 1Y4ZB 4CO4A 3CCJS 2HK2A 5DETA 3BO2A 3FEXB 3LH2S 2H5EA 5KFMA 4LF9F 2VICA 2MZ1A 4M1KA 4DFKA 4MH8A 2ZOMA 4WIIA 2ZH7A 3N5FA 4FKXA 4IO1A 2HIQA 1IJEB 3LO3A 3UDEA 3JS9A 4DLGA 3DOKB 2DEIA 4ES2A 5J2MB 3EGNA 1RQ0A 1Q1KA 1U6ZA 1QVFR 2K2PA 2HQIA 2V2VA 4ECTA 2EVZA 3JQMA 2QJ3A 3MM7A 4FXDA 4KTQA 3F41A 3H90A 3HZGA 2R8KA 1NUEA 3IC1A 4OZLA 2P9CA 2VODA 1W2IA 2B0GA 1EETB 4UZBA 3DLKA 3QAEA 2GIRA 2F5GA 4CO3A 2DPJA 3TA2A 2N3LA 1FRKA 2YNHA 1TKZB 1RT3A 1SI9A 2QZ8A 3MD1A 1KQSR 5D4PA 3B82A 1XTZA 3N5BA 1QTNB 1Q81T 2BZ2A 3GIRA 4ZPTR 1KR4A 3FC9A 1HBOB 3UVJA 1B0VA 3VAHA 4LF5J 3KLEA 3N01A 3GG0A 1JLAA 3QWPA 4LFCJ 4ZPVR 3BH6B 2JDJA 4P2SA 2W25A 3PJXA 2ZHAA 3RB0A 5HVGA 3IA0A 2ZOFA 4ZVOB 2PMWA 4R25A 2W7PA 1S1WB 3KNGA 5C5JA 1LFPA 4WTOB 5KOXA 2BOAA 4UY8T 3UI3A 5DG9A 2VBZA 1S9GA 5DJBA 3R6LB 1U25A 4HDHA 1V3SA 3S01A 3AD8C 2JX2A 2C3UA 1BWEA 4C8ZA 3DU5A 2CJKA 2J0WA 1YI2S 2DNRA 4OQJA 2WVBA 4JI4J 4CM0A 2A6OA 2OPSA 1Q8BA 1RISA 1EKRA 1JNZB 3THPA 3PG9A 4OHYA 2H48B 3SZ2A 3M9MB 5EGYA 5F8JA 3WZ0A 2MYFA 2V4JA 1NJZA 2AEJA 2F8MA 3HPOA 3PTWA 1U1RA 4IR1A 1I94J 3R2DJ 3TUPA 3D1QA 5CD4A 2CDQA 3JTNA 1FNOA 1SC6A 4WK1A 2HHHF 1X5TA 3FRZA 1CJKA 2U1AA 3IG1A 1WHVA 3NKYA 1XERA 3DDKA 1NEEA 5U47A 2F9DA 4NLTA 3E3XA 4UOHA 3IM9A 4NEYA 5ETSA 4JI8F 2XEXA 1EB0A 2IDEA 4A8SA 1SVDA 1FKPB 3V6DB 3WC0A 4USKA 3TX0A 3MF5A 1SJFA 1XWLA 2W8LA 4HT7A 4TYBA 1G2EA 1S12A 3G8SA 4QYRA 5IZHA 1ZETA 3GFXA 3SSSA 3BBFA 4ES3A 1WORA 2E66A 3CCRS 1I1GA 4ED0A 1EQMA 2QLXA 1F60B 1RTHA 5JMNA 4DQPA 4R5PB 4LF2A 1HNWF 1VQPS 3GB0A 4P2XA 1R8HA 4M5GA 2CADA 2BEFA 4PG6A 1K8AT 5HN0A 5K14B 5KFGA 3HULA 3RW7A 4D3GA 1U1MA 3CNQP 3KHGA 2XQCA 3P6YC 1IQTA 1FJGF 3RUBL 1FDAA 3HM9A 1ZM9A 4DPTA 5KFUA 2J9DE 1D8YA 4I7FA 3OPKA 2MSTA 3C16A 4J9LA 1F2HA 2DNPA 3H2LA 5DG8A 2HHXA 4NZ0A 5KFVA 2HLTA 4B17A 2XLKA 4ETXA 4WKRA 5CXTA 1A0OB 1GH8A 1K1QA 2C2NA 3UFCX 4AL5A 3KJQB 3AAWB 1X0FA 2D41A 1KTQA 4OZNA 3MM7B 5CCLA 4CIOA 3ZZTA 1CC8A 3LGNA 2GJIA 3J7ZT 2FLOA 2VFUA 3TAPA 1N36F 3BEGB 4EU0A 2DNLA 4C8KA 2FZCB 3Q86A 3DLKB 1M1GA 4U7UK 1R8AA 3PM9A 1NU4A 3MMJA 2YNHB 1P1TA 1VRUA 2HQFA 2RIJA 5A8WA 1RT3B 4CNYA 5M2RA 3CC7S 3LF0A 4ANDA 1O6XA 4C9DA 4QPXA 3P49B 4DV3F 5EWEA 4CYUA 1G1XA 2HPUA 3UW1A 2FPHX 3G4SS 4DMZA 3N9UC 4TKTA 4DQSA 3UVJB 3IM8A 3RAMA 1RBOB 2GVZA 3KLEB 1X31C 4QCLA 1JLAB 1RHUB 1HWUA 4YR3A 1PC4A 2ASDA 1QAXA 4OX9F 3W8PA 5BXIA 3OFGA 3TNVA 1YJRA 4DZDA 4C98A 2EBGA 2XM3A 3GE9A 1AFIA 1U26A 4JI6J 2XO6A 2CQDA 1S9GB 4CLKA 1GFWB 3HP6A 4GKKJ 3G9CA 3EGZA 1CS4A 2Z0GA 5D77A 3HVTA 2LLZA 3M1VA 3QPIA 3W1YC 2DR7A 5D0EA 2H9ZA 4MAKA 2ZZTA 3HLUA 3OXFA 2FLPA 4P10A 2BE9B 4I68A 4CH7A 2DGWA 2F4FA 6FD1A 2HHWA 5AXMA 1DBDA 5D4OA 1U1KA 5K20B 4G1QA 3MEKA 1YHQS 2IA0A 3NNCA 2K8GA 1NHKL 5T41A 2QE5A 2E44A 4ZOSA 2OPSB 2UVUA 1QDUB 5AXKA 2D3O1 4QJVA 2X1AA 3IN5A 3GMGA 2V4JB 3IRXA 4DV7J 1WC6A 3HHEA 4JI0J 1RADB 2V8PA 2V2KA 1N32F 4NLDA 3P5BP 4B02A 2G9OA 3OTEA 2YX4A 2OGUA 1JLQA 2ZITA 7FD1A 2JEGA 4ZITA 5H9FJ 2AIRB 2E7VA 2ZH9A 5I42A 4LFBF 3H4DA 5CHCB 1EQ0A 1CJKB 4V19X 3IG1B 2AJFE 3LTOA 4LF9J 3ISNC 1DHMA 2UV8A 3L4BC 3LANA 1VFJA 4JOUA 2QV6A 4XTTA 1TL1A 3I0RA 4CLWA 1RHQB 2YNFA 2NXJA 1WI6A 2AJ2A 3V6HA 3OVSA 1BE4A 3S8SA 2X1FA 2CNKB 4ZDNA 2FGCA 4NZ7A 4QW8A 1RBAA 3PIOQ 2WTFA 3E2EA 4FZVA 4PWDA 1MROA 4HYKA 3D54A 2CPXA 3HDSA 2HS4A 1FJEB 2FQQB 3V2UC 1CSJA 1UKUA 2OSRA 3GR1A 1F5CA 4ELTA 4LBPA 4USIA 3FNNA 1FKAF 3PIPQ 4EBCA 3CTRA 1RTHB 4YS2A 1RTDA 3N6MA 2FVRA 1F3VA 1HNVA 1ELOA 3PYEA 3I5AA 1R6VA 2AWZA 4HTIA 3A3PB 2LU1A 4OI1A 1LWEA 1HNXJ 4U96A 4DPXA 1LKZA 3MM6A 1S6OA 1RU1A 4DN0A 3CD6S 1DTQA 3QGHA 2J6UA 4CTAA 4KY3A 4DV1F 3PNIA 1PKUA 3I0SA 9RUBA 1PAUB 7FDRA 2JHEA 2DNQA 2VV5A 3QRRA 4I7FB 1OYEA 2FIUA 3C16B 3BR9A 1KQGB 1RB0A 4UUXA 4X66J 1NAQA 4DR3F 4HLBA 2C2KB 3KMQA 3KLFA 2XSJA 4QIVA 3QGIA 3GCXP 1KVIA 2XO7A 2HBYB 3VV2B 5HMYA 3O3LA 4OJHA 4NZ6A 3NG8A 1VC0A 1S97A 3LA0A 4BWMA 2NPIA 2DBBA 1UA1A 1KD1T 2ILZA 2BW7A 2F8EX 2YXLA 4LF4F 1LOUA 1ZOTA 3Q8QB 4B3SF 4DFMA 1FNMA 2QO3A 1VHIA 1HNZF 2AX0A 1W7WA 4PG5A 4IRDA 3PEJA 3CDUA 1XJWB 2RDDA 4X4PA 2M70A 1VRUB 5A8WB 3W2WA 5G4DA 3VAJA 1U0HA 3CMQA 4X4RA 1R8CA 3QLHA 4LBHA 3JQKA 4O3QA 4DBQA 5BJRA 4O3SA 1S0VA 5E41A 4CYUB 3BBBA 3FCVA 3P3DA 3EVWA 4E98A 5KFAA 4A8FA 3PRDA 2YWHA 1ZM4A 2QIFA 3MI7X 2GVZB 1TKXA 1KQKA 1Q8IA 2H5IB 3MZIA 2HGNA 2GIQA 2FVCA 3PW7A 2CQ2A 2RD5C 1JXVA 1OQ3A 3I9V9 4FBUA 1GK8A 3NXZA 1IM6A 3FBFA 2RUGA 1MN7A 1G3OA 1RT6A 1DLOA 1DARA 2VPZB 2ZH5A 4DUYF 2HHHJ 1U2FA 4PEOA 3ILLA 3CJQA 1M5VC 3IWLA 3BJYA 3N6NA 2D1CA 4JI8J 1CS4B 2CQ0A 2NUUG 3HVTB 4ELVA 4FXVA 3D3CJ 3M1VB 3LP1A 5GAHU 1ZM2A 5E3RA 3CCVS 4F2RA 4MK9A 3C19A 2QMXA 1GAOA 3O44A 4MKVA 3T3FA 1WC0A 2W9AA 4G1QB 3VALA 5SZTA 5CYJA 2BRKA 2A0FB 3T19A 5E2QA 1HNWJ 3A13A 2JEJA 4AL7A 3HHLC 2O5DA 4M5DA 5DM6Q 4RBUA 4IQXA 2MKJA 4B9NA 4LF1A 3NOCA 1LW2A 2BACA 1WG5A 5D0RA 3IRXB 3QBCA 1KFSA 2CQIA 3CJ2A 2IMWP 2IVYA 4PG8A 4WK3A 1DTTA 1FJGJ 1JLQB 2W1BA 2R7SA 1ZA1B 4EBDA 3A8IA 3T41A 3A1YG 5I42B 2HMIA 2V8GA 2NZCA 2I1RA 4C0HA 9ATCB 1MMDA 1NZAA 1NJWA 2KG1A 1ZAWA 4WYWA 3BPDA 4GVBA 5EWFA 2CPHA 1MSWD 2EKNA 1TL1B 2ZH8A 3I0RB 4P7VA 4C0OC 4OHVA 3VWSA 2YNFB 1BD6A 4K4SA 4EZ9A 4KHPF 4IR9A 4YP3A 1UA0A 1X4HA 1RKIA 2BXJA 5ADZA 2J8SA 4RNNA 3U02A 1VQ8S 4PWDB 1RWNB 1MROB 1FCAA 2IM0A 3QT6A 1U45A 2JJ4D 4LRBA 2Y8WA 3M8YA 4DU8A 1OWXA 4MIBA 5AT1B 1WTFA 4A48A 1RTDB 3ULHA 5DG7A 3GJSB 1HNVB 1Q5YA 1N36J 1LWXA 3R7SB 1LWEB 2RMLA 2C2DA 3MPYA 2AKWB 3H5YA 2Q43A 3MM6B 2MEWA 2LECA 2E1PA 3HKZD 1DTQB 4ZP7A 4IRKA 4CTAB 3KFWX 1RTIA 3D6HB 3SV3A 1NB2A 2UXCF 4DV3J 2ZNYA 3GFZA 1RTZA 3I0SB 3R8YA 4X4TA 5IT4A 2FHOB 1L3VA 4JV1A 1VJWA 1QD1A 1XMBA 2QL9B 3B4DA 4DLEA 1YGYA 4DS4A 4JV5F 1S6PA 5K8MA 3KLFB 4EBEA 1TKTA 2XSJB 1F5BA 1ZPVA 2J6SA 2HEKA 2APOA 2XS2A 4EZ6A 1R7IA 3HHNB 2MZQA 4CO0A 2BX6A 1GX6A 4OX9J 1Q7YT 4FP9A 4ZP6A 5F8IA 4FS1A 5LL6d 2ROEA 3EZOA 2WRMA 4IG3A 2DH8A 2FD2A 5KTQA 4OYWA 3KLIA 2FC8A 2H1YA 4DL3A 1R31A 2X51A 4CLSA 2IMOA 1A7GE 3NL0A 3QZ8A 4P2MA 4F4AA 1Y5IB 3THTA 2ZC3A 2KO1A 1T9XA 4O0IA 2HQCA 3VTIA 5HO4A 3L3CA 1NH8A 2N7YA 3W2WB 4ECSA 5MAOA 1U0HB 4G65A 4TLQA 3QLHB 2O3DA 2UVRA 3I96A 3IP0A 5DS7A 4JI3F 2FTRA 4O4GA 1APSA 4KQZA 2XYHB 3MR2A 3DLJA 5J1NA 1YJTA 1TKXB 4G6VB 2G2OA 1MLAA 5L1JA 3UPFA 1N32J 2J0SD 4FF3A 3D66A 4NA2A 1RT6B 1DLOB 5HK4A 3FQKA 1CC7A 1FKOA 2JSXA 5KFOA 3ZNUA 1TMMA 4LFBJ 2LEAA 2CVEA 1QAIA 4AQYJ 3M30A 3H7HB 4PPZA 2R4FA 1IKWA 2W2PP 5AJ3J 5F8GA 2UUAF 3OVBA 2PI4A 4RBTA 3DLHA 3G8TA 2YVSA 2O1PA 4ECXA 2R8JA 3S1TA 1GXLA 4NA3A 3BF4A 1RAEB 2RUSA 3LP1B 4LIRA 2ADCA 5HQLA 1HHSA 1R0BG 3X3UA 4XK8C 3KLHA 2L9DA 5KFWA 2LYVA 3R97A 1RA7A 4YB5A 1ZZFA 1ITPA 3GYXB 4DF8A 1YKWA 2JEFA 3CJKA 5B09A 4OI2A 2MMYA 1D3WA 2VASA 3BV8A 4NLSA 4Y28C 1Y5LB 2W4CA 2AGQA 1HIYA 4M5DB 1VR6A 1FDNA 1PCAA 3UD4P 2VU5A 3EICA 2FHJD 1JJCB 1LW2B 3EMTA 3IAS9 5IQ6A 1C0UA 3AFGA 2R7VA 4P6QA 4OYAA 4XIUA 1DTTB 2ZJRQ 3A8KA 2KJVA 4HVZA 2XNQA 4DV1J 2DKOB 2IFXA 4NL5A 5G0RA 1FWKA 2J7KA 2HMIB 2C22A 1M0SA 2BMBA 4RZRA 2J0XA 3CJ4A 4GVBB 4C8MA 4FVCA 1O51A 5IT0A 1AROP 3TYTA 4QZVB 4DR3J 3J80Y 4RU2A 5L38A 3QRPA 2KFNA 3C66A 2RJZA 2GS8A 1V3ZA 5KFBA 4EGLA 4KO0A 4AT1B 1HWJA 2ZJPQ 2PFDA 3H2VE 2JVOA 4JI2F 1FRLA 5CA5A 2RQCA 1TP7A 4P74A 4N76A 3EPGA 2DNKA 4OIXA 2JLGA 3OXLA 4C0BA 3IAM9 4XDCA 1SL2A 4XPEA 1N48A 4M94A 3W64A 5KFKA 4LF4J 3HKWA 3SV4A 5KG3A 2GAHC 4M5IA 2Z2MA 4B3SJ 2L48A 4UQTA 4JI5F 2J76E 3GG1A 5B0DA 3OFHA 1HNZJ 2HHQA 4XO0A 5L1IA 1JXEA 1RBLA 5FDLA 4KHRA 2BJ3A 2AJ1A 3DFEA 4CLUA 2FY8A 4Y6IA 3PRVA 1S77D 4K2JA 2NQPA 1RKJA 1KDNA 1RTIB 3T1HF 3MM8A 2XTJP 5F3ZA 1S4EA 4NRUA 5I3PA 5IS2A 2G0CA 4Z7CA 3NNHA 1BQMA 5KFDA 4XAKA 4MKYA 1Q16B 3PZPA 4A8WA 1S6PB 3ZNJ1 3TVYA 1OIAA 1VQ7S 4OV1A 1TKTB 2ZD1A 2EFGA 2MSSA 1EHWA 3VAKA 5THWA 1RWWB 3W5ZA 1ZYQA 1JQGA 3J7YU 4GMKA 4U67Q 5HQMA 4P72A 4DUYJ 1HWLA 3UCZP 3H25A 4IG3B 2P6SA 1H2VZ 3BKFA 5KFJA 3AA9A 3KLIB 4DG1A 2OEJA 2LVWA 3T5LA 4HR2A 4UW2A 2XSFA 2B8QA 1RT2A 4ZLJA 3HJVA 3QZ7A 4IFVA 4WWSA 1SQFA 1GX5A 2PDAA 4KYZA 5F8LA 5B0AA 4ID5A 4O3NA 3L9ZA 4WZMA 4A47A 3A8JA 5KFIA 3K8WA 1AA1B 2EK1A 4O4GB 1OSCA 3PJ9A 3GSIA 1MN9A 2GHVC 2HG4A 2AF6A 3PCOB 1R0CB 4NWBA 1N56A 3MM5A 1S6UA 1TL5A 3QSYB 1PYOB 2HFUA 3NWGA 2E1CA 1FKOB 5LMUF 2GZOA 1Q8LA 4DXLA 1D9FA 2O66A 2J9CA 3M30B 1PSDA 4QR0A 1JX4A 1IKWB 3BGRA 4RU9A 3BGFA 1FHTA 2NS1B 2NXUA 5ETKA 3W62A 3ZFVA 4OZ5A 2YKNA 1X5SA 3IGVA 5HVHA 1IBLF 2BM1A 4F3QA 4KHPJ 4F4WA 2GQCA 2MZRA 5EWGA 1XQIA 2BVZA 3KLHB 2VC0A 2HFVA 1RAOA 1M1HA 3QGGA 4ENOA 3JSYA 3CJKB 5E3AA 1Q86T 3U7JA 2ZWPA 1LWCA 1RAFB 3W61A 2ZH2A 1QY7A 3FKBA 1U09A 2LDYA 1C0UB 3PACA 3RAQA 4QWBA 2KDOA 2VONA 1UEKA 2F3JA 1O5JA 2VB6A 3DRSA 2M9KA 3PHTA 2LEBA 1GMUA 3N0VA 5G0RB 2KZZA 2UVWA 3K2YA 5GAGI 2UXCJ 3LALA 8AT1B 4KKOA 3FZBA 1RWVB 1U1QA 2HK3A 3HVAA 2KYZA 2PIIA 4DJBA 2Q6CA 4ELUA 5IM0A 4NYPA 2NUHA 1IVZA 5L8RC 3RBZA 4EO6A 4CLLA 1SIZA 3TZYA 2Q66A 4JV5J 4DV4F 3HFKA 2K3IA 3CCUS 2ILYA 1YJVA 1JK9B 5J2QA 2KVQE 3LW5C 4KO0B 2O01C 2OHDA 3KK1A 4XPCA 1CJVA 3KG1A 1VQSA 4DEZA 2ALYB 4C3MA 3VZIA 3PYGA 2WOMA 2E5IA 2ZE2A 4JUZA 3R5AA 1PAEX 1LEOA 2IM3A 5KT3A 2B7CB 2D3UA 4HHHA 1AXQA 2DIUA 5K8NA 2CJQA 3ET6A 4LQ9A 1WC5A 3SSQA 4F26A 8ATCB 4C8LA 4ZVFA 5FDLB 3MMAA 1EX8A 2OD4A 2CPZA 2QLWA 1I3OB 1BLUA 2LXUA 1VQOS 3IR7B 3G87A 3MM8B 3NLCA 3CWJA 3FVYA 2KZMA 5D78A 5JXSA 3ZTRA 3BB5A 5FJ4A 1RLDA 2DT9A 1SPBP 1N52B 3HI9A 1BQMB 4JI3J 2G1HA 4DQRA 2ZBIA 3I87A 5KG4A 2DISA 3CDBA 4ZVQB 1YRXA 2DRDA 2ZKTA 1UEUA 3MR7A 4UT4A 1X7VA 2UUCF 1WJ9A 2VH7A 2B6AA 3K5LA 3BO4A 4CWBA 1UAWA 1TL4A 2ROPA 2ZD1B 2FJVA 3Q8YA 4C97A 1YJWS 1FDBA 3MMCA 5IC4B 3UR3C 3HD2A 4Y34A 3CCSS 3GYGA 1Y00A 1YJNS 3D9BA 5C2CA 3OTOJ 3LPEA 2MHNA 3W9HA 2NZ4A 3HT0A 4O3PA 4AE5A 2UUAJ 2CJ9A 2BUNA 2FZGB 2CPYA 3TA0A 2BJ9A 1UW9A 2CQPA 4DG1B 1URRA 2BJ7A 1FVSA 4DL7A 3DN9A 4PUOA 3KUGA 3MTJA 3ONQA 2MY8A 4PWUA 3HO1A 1RT2B 3VAGA 1NDCA 2GHPA 3KDNA 2N82B 4KFBA 4IFVB 1RP5A 1FA0A 3I4HX 4IQMA 4K4VA 3R2CJ 4ID5B 4FNHA 4OYMA 4CI0B 4RL1A 3TEHB 4DSLA 3GZ7A 3W2VA 4WE1A 1HD1A 2LXIA 1NDLA 2Z2ZA 2KFYA 3RGIA 2JC1A 5D8HB 2NXCA 4KGKA 4U95A 2W7AA 1BQXA 2MJNA 4AUKA 4N8OA 3C46A 1RK8A 1NDPA 2KT5A 3MM5B 4B08A 2V9KA 1UPPA 3OVAA 3G6YA 4ED7A 3OT9A 4ECYA 2OKQA 2HIYA 2DHSA 3I32A 5J1PA 3UCUP 3BGRB 2MQLA 2LFVA 1H72C 2P9GA 2Q1LA 4L75A 3T9NA 2YKNB 1H7XA 1UFWA 5KFHA 4NCBA 3VAMA 3CJ3A 5KG2A 2AJ4A 2CUYA 3FFIA 3GFHA 2IJNA 2A2CA 2PN6A 2ACMA 4ZCMA 4JI2J 3R9LA 4ECZA 4B9MA 2R9LA 2XMJA 1VC6A 4X2BA 2HWIA 2QGFB 2M8HA 2E1MC 2WONA 3TWZA 1S48A 3U1MA 1LWCB 2DD8S 3LGMA 1DY3A 6FDRA 1S1UA 4OZ3A 5HSPA 3OJUA 5AXNA 3Q8UA 4OI6A 4JI5J 4K50A 2XMTA 2DO4A 2QSWA 1EKSA 2H65B 2LA4A 2J8AA 1HBNA 3K0JA 2R7QA 5GVQA 3VAFA 5A2QY 3MPUB 1UWBA 3DRSB 3EJMA 3ZO7A 3T1HJ 4JP8A 5DDQC 4LRAA 3T6JA 3KJFB 2FVQA 1SKUB 4GRSA 4LT6A 4KKOB 1F9HA 2OFGX 1KQFB 1DZ5A 5IM0B 3I31A 1TAQA 4YDXA 4U8VA 4BDPA 3R27A 1NPPA 1NSKL 1N34F 1EZZB 5A6PA 3M9NB 2HVDA 4PG7A 2VJVA 5T7LA 2AZ3A 5J2QB 1W26A 4AXIA 4WZQA 3KOAA 2HAIA 4LF5F 4DR1F 3KK1B 4N41A 2AJ0A 1CJVB 3TAQA 4ZLPA 2ZC4A 2VFTA 2WOMB 1QJHA 2ZE2B 1TU0B 1N33F 1FJCA 4FYVB 4I6WA 4USVA 1N6QA 3JSMA 3T6BA 3ET6B 1RAAB 1QUVA 1U48A 4F02A 4ZVRB 1HNIA 2MJUA 1SXLA 3MMAB 4CLTA 2IDLA 3FBCA 5H1SV 4LR8A 4LIWA 4S0MA 3W7BA 3LP2A 4FVMA 1Q53A 3MAAA 1YRTA 4FF4A 4ZPAA 7AT1B 4DN9A 4JYAJ 1BHNA 1SIWB 4MK8A 5ITHA 2DGSA 2OPQA 1NHUA 2LCWA 4PYAA 3BZQA 3FUYA 4OV6A 2HNYA 4X4SA 1T95A 3FGVA 3DMJA 3BQ1A 1NJXA 3QNWB 2B6AB 1RXOB 2CWXA 4DL2A 4B3OA 3R1LA 1H98A 2LQJA 3IWXA 3MMCB 1LWFA 2XWYA 1VQYA 4MIWA 4F4XA 5LMUJ 2KHDA 2OAUA 4IYQA 4RW9A 1P1LA 1UWAA 2W2QP 3D6TB 3S6EA 5L39A 5L9NA 4NMLA 2CAJA 1LXNA 1NH7A 4BLGA 5KFQA 2E9RX 4PUOB 1IBLJ 2LA6A 1RT4A 2W24A 1M5OC 3HSDA 1WTBA 4KFBB 2V8VA 4FPRA 4ID8A 1SL1A 1MNEA 4NLGA 1PBUA 4ZCKA 4GO5X 2EG2A 3W2VB 4WE1B 4ZCIA 1JIHA 2KH9A 3DNCA 4QIEA 5CQGA 8RUCA 3DGVA 3A3NB 1X4GA 3NGSA 2FJDB 4F0MA 4NCGA 3GIMA 1SC3B 5E5NA 2QFIA 3T5JA 4C2MA 2JC0A 4MYTA 2QA1A 3IBFB 4C4WA 4R0JA 5LXRA 2MQNA 4TVAB 1WOOA 1X9WA 5H9EK 2G1DA 2P2CB 1H0HB 3QIPA 4DZ6A 4DI6A 3PX6A 3O8WA 2BW2A 3N6LA 2XMAA 2E5GA 3W65A 4DV4J 1U47A 4R0EA 4NXNF 5DDOC 2PFFB 3CCLS 2ZNZA 3Q8RB 3CCMS 5LM7E 3FFIB 2R3VA 1D09B 3QT8A 3VVTA 4B3MF 2VFSA 3DYAA 1NXIA 2F1FA 2AZ1A 1KLMA 2KXFA 4MMOA 1B64A 1TL3A 5K8OA 4IH7A 3NNAA 2WONB 1UJ6A 4YB7A 1C4CA 2YBVA 4TNOA 2EEYA 1S1UB 4H4KC 3GSDA 2XZDB 2BABA 4U6PA 3H98A 5ETMA 3GV7B 4PYDA 1OQ6A 2VJUA 1BQNA 4NASA 4FF2A 4ED8A 3C14A 4X64F 2DR6A 4WFXA 1HBNB 2GV1A 4NLRA 2CJYB 2Y0SD 4ED1A 1VI7A 1UWBB 4A4JA 3LQVA 1S79A 1SUQA 3NGKA 1JB0C 4OYXA 3O2IA 1BC6A 2XB2D 4FYYB 4HHJA 3QFWA 1RHMB 3FJ2A 2G0IA 4PQAA 1TV6A 2KYXA 5HQ8A 2BQUA 4YR2A 1S7HA 1IWAA 2QEXS 5T7LB 4LSZB 4QR2A 5DZ6A 4DUZF 2AEMA 2AT1B 2YWFA 5KOWA 2O67A 4ECUA 4DSKA 1F0XA 3MURP 4B9TA 2HURA 2PEHA 1X4EA 4RNFA 3SQOP 1KC8T 3K59A 3H8YA 1DQ8A 5CYMA 2R7RA 4F0KA 1N6QB 1RT1A 2FJBB 3JSMB 2DH7A 2R8IA 4BS2A 3HD1A 2GHWA 1OO0B 1HNIB 4JI6F 2PE8A 1WKKA 4EYIB 3LP2B 3SCKE 2DRBA 1F5AA 2M0GB 2UV8G 3MAAB 3QJLA 1CEZA 3ENQA 4NOHA 2XS5A 5KT4A 3H20A 1SB6A 2OPQB 3TO8A 2AQ4A 3FSIA 4NLVA 5IV3A 3BBCA 4RWXA 3K5OA 2HNYB 2C3PA 3MMBA 4B3RF 2M52A 3DMJB 1NO8A 1F6TA 3JQJA 1WEZA 5JUMA 4B3OB 4L3NA 4ECQA 2VPXB 2KM8B 2XBPA 3LGHA 5IOLA 1LWFB 3BO3A 5HJXA 3J7Z5 1VOMA 3G6XA 3N4WA 5LJ3Y 4O3OA 2JOQA 1PBAA 1LFWA 4RW9B 4TU8A 1TK8A 1IR2A 4H4OA 2B56A 1UVNA 1U8SA 4Q8EA 1FX2A 4J9RA 5LOQA 3IO1A 1V3RA 1UW4A 3G6VA 3KJNB 3AODA 1TFYA 2RHQB 3R5BA 1RT4B 1O0PA 4WYLA 3MD3A 2UXBF 1HBMA 2YH0A 1KLNA 2HS0A 3L7UA 1GTEA 2NXEA 5HANA 2FGOA 2FHJA 2ZH4A 3T1YF 2CIMA 3DRYA 2HW3A 3F56A 3DXBA 2R8HA 3DCAA 2N4CA 2IVFB 2EFNA 3HSZA 3DRRA 2AHOB 4DFJA 5AE2A 2D69A 2FVSA 3DOMA 3B54A 2AD9A 4ED5A 1N0UA 2ZHOA 4NCGB 1N0VC 3H2UB 1SQGA 2ZWOA 4L73A 1F2GA 3ZZPA 4QW9A 1Y7PA 3K5PA 1WC3A 1Y9OA 5KFEA 2NR0A 1ICEB 3IBCB 3OQ2A 1HNXF 3EVMA 3DLLQ 3QATA 3F0NA 4USUA 3FRYA 1QSSA 5FD1A 3OSNA 3QIPB 1FESA 3CULA 2CQ3A 3W9IA 4X4OA 3GILA 3U27A 4DSEA 1N34J 3M8WA 4RW7A 3MCMA 2D74B 1WKJA 1MWZA 4CO2A 2IA6A 2MQPA 2ZBQA 3MCNA 5KT2A 4X66F 4DR1J 3DYAB 3NS5A 1GT8A 4TQSA 3DKDA 4HHUA 3RBXA 2K7JA 4ZIVA 1KLMB 3CD0A 2BBEA 1TL3B 2YKPA 1Q95G 5GAEI 1N33J 4OJ1A 3AOAA 4OYIA 2XYGB 3T1AA 2PEBA 1NK6A 1S0OA 1BQNB 1CG2A 1SV5A 4NLPA 3C14B 1U1NA 4OL8A 3D6MB 1HD0A 4G1IA 2E1AA 3M05A 1SUQB 4C7QA 3MOJB 1T9TA 2G2YA 2DIVA 3I4PA 1HWIA 2MLXA 1D9AA 1IJFB 1M5KC 5J2NA 1GXTA 1TV6B 4RPFA 1G6BA 2RT3A 4KE5A 4OMFG 2M8DB 4WCEQ 1YZ6A 3PW5A 2P9EA 4ILRA 2HSEB 2BDPA 3R5GA 1S99A 3ENVA 4ILLA 3CEDA 3NBPA 5J2PA 5FLXY 2G0JA 4OYPA 1NK7A 1ZTTA 2ADBA 4LRDA 3M8ZA 4GC6A 3PW0A 4X62F 5CYMB 4I64A 1ZBTA 3UNGC 1RT1B 4WPAA 1VISA 4WFNQ 2WHOA 4A8MP 2VQEF 5L1LA 3GIIA 2NSCA 3VVUA 4V19J 4O4RA 2DGVA 4QR1A 3CB4A 1G7CB 3DLGA 4J9UE 5MLCV 2IM1A 3N28A 4ECVA 2V50A 4DL5A 4ZVTB 3MMBB 2YQ1A 5HI7A 4I0WA 1TQLA 2ZEJA 1N5TA 4PXCA 5D0GA 1S4FA 3IXQA 1D9DA 2Z4PA 1VDHA 1DAXA 3R7BB 3J7AN 3IRWP 2FJAB 3L7OA 4RR5A 2RVJA 4ZPWR 2ZBRA 4DR6J 3TJ9A 4C3KA 3SCJE 3G8QA 4YMEA 2J7UA 2OIHA 4IFYA 2B9EA 1S1XA 3NP5A 5D4LA 3PFOA 4DS5A 1FT8A 1VC5A 1T9VA 3WQPA 1H3DA 4CT8A 1U1PA 3BKTA 1VQ5S 2X1GA 1RAHB 4H4OB 1JXLA 1GEHA 3OFEA 3EM1A 3MCOA 5KFNA 3PW2A 4NXNJ 2DY9A 2HBZB 4RW4A 2QL7B 1OS5A 1XN9A 1NCLA 4NYOA 1HBMB 3D1HA 1PGZA 2AYGA 4BC9A 4CLFA 1XMQF 3Q8PB 4B3MJ 4CLZA 1QVGR 2QL5B 3HX9A 3I5CA 2W9CA 5E3CA 3JTPA 2WZ1A 3DRXA 3CDAA 2CQ1A 1S1VA 3VGTA 3KG0A 1RT7A 3B6BA 3DRRB 2ERRA 3CD7A 2PMZD 3THVA 3J81U 4DFPA 1UL3A 3DOMB 2W2OP 2ZVSA 1CBKA 2ZDPA 2GJ2A 4X64J 2DNMA 3QIDA 3WX4A 3M2RA 2GO9A 2WVEA 4HI1A 4WFYA 2EK6A 1VQKS 2VF3A 3SEOA 2PC6A 2GGPA 2P8IA 1XR7A 3ILOA 3PJWA 1QSYA 4ERDA 3A12A 2V68A 1K9MT 4P7TA 2A6MA 1TR0A 4A8KA 3DDIA 1FRHA 1TFWA 2CZ4A 1RJJA 4B9VA 3RW6A 4UUWA 4IOCQ 4QIFA 4N77A 2ZUAA 4ZCLA 4RW7B 3W5XA 4PZVA 4HDGA 1WC1A 2R7XA 1B7FA 3ADAC 2A2DA 2RF2A 4NCAA 4DUZJ 1OPZA 2WW8A 4OX8A 4FYDA 2OLWA 2B4UA 2JH3A 1FDDA 2J9EA 2R2TA 2ATCB 4CZCA 1X4BA 3PX4A 3I5BA 4IKAA 3T5KA 2HFNA 2MZSA 2VPYB 4ANEA 3A4TA 3P8BB 3MUVP 3LWLA 2XMWA 1JLGA 1VQMS 2CPIA 1WWHA 4CLYA 3RR8A 4I2PA 4V1Ak 2VFRA 2V8HA 1KWMA 2PMHA 1TZ0A 4USJC 4MK7A 1SV5B 1X9SA 1FRMA 4Q8FA 3DHWC 2DB1A 2MXYA 3L95X 3D7SB 4K2XA 4GKJJ 3NCQA 1H38A 2CRLA 3PEHA 3BN7A 3VQSA 3MEEA 4OLPA 4K4UA 2MKHA 5BR8J 3SQGA 2CA9A 1U6BA 2XZTB 3GR0A 5KFRA 2WSEC 3M8RA 4GO7X 3OLBA 1RDRA 1HA1A 4WBFA 1HPZA 5A2QU 4K5SA 2IHR1 5J2NB 1OJ4A 4B3RJ 2Q3PA 3RG6A 2P5VA 4F36A 4ED6A 1RWKB 3UE2A 2LQ5A 1YSJA 3QMQA 5F9LA 3QWUA 1TTHB 2ZVIA 3R6GB 2C2OB 3EZUA 2W7OA 1HI1A 4AYBD 4YUDA 3NBPB 5J2PB 2HZAA 3OXGA 2C2RA 3BPSP 3MUMP 4RUAA 4YY3F 3TI0A 2AEFA 5A0YA 1S10A 2V0NA 2GJFA 3AD7C 1CPZA 2QA4S 4DL6A 3CF5Q 3GCWP 1FERA 1M90T 4AQYF 3P96A 5EX3A 3UCGA 5AJ3F 5DZ7A 3DM2A 4WFBQ 2ABYA 3GIJA 4HKQA 5C42A 4K59A 2UXBJ 3Q2SC 5F0WA 3HCXA 2HWTA 4O0NA 2HQDA 3SCLE 4CQ1A 4JI7F 1YJ7A 3TAMA 2YH1A 3BYRA 1S9FA 4CH1A 5GMDA 3T1YJ 2RKIA 3KKFA 3DLGB 2VG6A 3GQCA 3QQCD 4MJKA 1T9WA 2V63A 4ZA1A 5H9EJ 1XNRF 3D67A 5KFPA 3G2XA 2C28A 4ES1A 4L3KA 2XG8A 1J27A 3SDEA 3IFEA 4ZP9A 5IXUA 3TJ8A 1SJ3P 5ETTA 1M1KT 1FNXH 1HI8A 4ZPBA 2IY5B 2I0XA 3ZC4A 1IWGA 5T14A 5ETLA 2VZ9A 1K0VA 4TYAA 4K7QA 4L72B 4IFYB 3RB3A 4JB8B 1X9MA 3NMAA 1S1XB 4HACA 4CO5A 1Y0HA 1TUVA 3B4MA 2UUWA 2LEPA 1HYSA 5EHHA 4F3MA 2N7CA 3PX0A 5IFMA 4X4UA 4IH5A 2LQ9A 4RW4B 4DSIA 4RUHA 4MFBA 1JNRB 3CC2S 4YHHF 2W9BA 4ZKAA 2PT0A 4N56A 2HHTA 1SBRA 3HHLD 1DJ0A 5DGBA 2CQCA 2YKOA 1JLFA 2C2ZB 1HQ2A 1IXKA 2M4MA 2HHPA 3TX8A 2W9CB 1Y3KA 2AX1A 2HVZA 4NMXA 4G1PA 1ZS6A 1S1VB 3C8YA 1RT7B 1E6YA 2W2NP 1YZ7A 4ZS6A 1XBWA 3P5TL 2VHGA 1K73T 4N47A 2J7WA 2HHVA 4ZPCA 5HMXA 1KP6A 3G86A 4URSA 4KPCA 2XHWA 2K06A 4USMA 4QWEA 3EX7B 4Y65A 2B5JA 3BDPA 2QX0A 2FB0A 3M2RB 1VBZA 3AT1B 1IR1A 1NK4A 1XR6A 2BV3A 2R7OA 4KRWA 2GGPB 5GADI 2Y3YA 4DV2F 2PA8D 2V69A 2MQMA 2RS8A 1RCXB 1KN6A 1JJ2R 2UXDF 1OMSA 1GXUA 2XLIA 3W66A 5GMKa 3UWTA 2CWKA 5K9FA 1CQMA 1L3TA 3NAHA 4NXMJ 4K4ZA 3KMSA 3BGLA 4IH6A 3SFUA 2HVIA 5E33A 2MLZA 2RF2B 2YKAA 5IV4A 3MWBA 4ZVEA 2JVRA 2VQFF 4BC7A 3WIVA 5L1KA 3J7A1 3H0PA 4LF8F 3KK3A 2RU9A 4X62J 2DK2A 3UD3P 1TMJA 3MAQA 2A10A 4UQGA 4EI2A 1JLGB 4OHWA 2Z58B 3TQ1A 3DGPA 2VKZG 2YKMA 4I2PB 5HBMA 4O23A 2VQEJ 2JLFA 4ZP8A 2DXFA 5AE3A 1FO1A 4ZVHA 4KAIA 5KG0A 3RB6A 1FK9A 3GP9A 3ZZZA 3CJ5A 1U8WA 1RAGB 3MEEB 4YOEA 4USTA 3SQGB 1LNQA 2PSZA 1UFLA 2HBRB 1HPZB 4AXJA 3OD2A 1RWOB 2FVPA 5HMWA 2HGMA 4DPUA 4M5LA 4X4VA 3JAMY 3CPWR 2B4PA 5E7OB 1RA6A 2ZUGA 1BUXA 2ATLA 4DX6A 2CJAA 2MY7A 3H42A 5I3QA 1T9UA 3ZTQA 3D0HE 4Z37A 3T5HA 3HSJA 4JV0A 1TKDA 2B43A 3C3LA 4NPOA 1KBRA 4OJGA 1CLFA 3AJ2A 5IWAJ 1HQUA 3GV8B 1NKEA 3BGUA 3VGSA 2XWXA 2VD3A 3G71S 4FXWA 3CIMA 4QU7A 4EYHB 3MECA 3SI8A 5A0YB 3A3OB 1SC1B 2X7IA 5SUHA 2WSFC 2WB1D 2X1BA 4L6V3 2UU9F 2QT7A 3C6UA 3W3SA 1FF2A 3VZHA 1UVKA 3DM2B 5KG6A 1CULA 3TZWA 3HHKA 3P45B 2YX1A 5KFFA 5C42B 3P4UB 4OYBA 2XGQA 2BKOA 3AD9C 3AQPA 4WTYA 2JZ5A 3Q23A 1NDKA 1XMQJ 1F9FA 3O6QA 3TAMB 2FDNA 2GMLA 5RUBA 2CPEA 4FKYA 2MLYA 4OI3A 3I6PA 2RKIB 1WF2A 4LMZA 4C8OA 3EXCX 2VG6B 2ZZNA 2VG5A 3HSGA 4DCJB 4YB1P 1VBXA 4PKDB 2DHGA 4C3LA 2DHAA 2PO4A 2VA2A 2OTJS 1YX2A 1VJQA 1NK8A 4DOZA 3LPYA 5B0CA 3SDEB 5F8HA 1PG5B 4WP9A 4CRJA 1PIEA 2RDJA 3UN3A 2QA4G 3M4XA 5D6GA 3KXDA 2B4VA 3EZ5A 5L9XA 2V2QA 2HZCA 2ACYA 2GIFA 3RU0A 4HACB 2WVCA 4WKYA 2BQRA 1RI7A 1NSAA 4X4NA 5KG5A 1BGXT 1HYSB 1KTVA 4ED2A 3MPDA 1WDTA 2KRRA 3IBWA 4P75A 3BGOP 1NHVA 2F7VA 2DNGA 4UOGA 2KHCA 2XMKA 4MFBB 2W9BB 1GMWA 2IBOA 3B8HA 4A8YA 1JMTA 4U7UD 1WUUA 1JLFB 1NB7A 2YWWA 3FSYA 1KVJA 5GAGU 4HH1A 3RZAA 3BSNA 2V67A 1TK0A 1KSPA 5D4NA 2Y1JA 1WHYA 2NYHA 4Y2MA 3OV7A 1IUJA 2CNLB 1E6YB 1FFSB 2HS3A 4WJBA 4OX7A 1H2TZ 1ZAVA 3D1OA 1B0PA 5HAOA 3GV5B 3I82A 1X5PA 2FJXA 1T03A 2RQMA 2ZDOA 2I38A 1MG7A 4Q7AA 4K0KF 1IR0A 5D15A 1XMOF 4L76A 2NXNA 4D3HA 2B5JB 4C6AA 2FJEB 2HKEA 1MWQA 1A6LA 5GMEA 4ED4A 1N5QA 5ETNA 4NLXA 3CJ0A 4DQQA 3EDRB 5BYQA 2KXHA 3HVRA 2FJWA 1C4AA 4KH1B 4XDDA 2E29A 2BANA 5E3QA 5HLFA 1PJ6A 1N5VA 2B8PA 4F0HA 5CCMA 3LAKA 1VQ9S 2QSFA 1OY8A 4J9PA 2M7SA 3I56S 2KFZA 1D8ZA 1JLEA 1I5OB 1VRQC 4WFZA 3R1HA 3IR6B 1IM4A 1YLXA 1V5IB 3KK3B 2AW0A 4YY3J 4W90B 2G2ZA 5KT5A 4G3IA 1SJ1A 5CD4H 1KEKA 3JXOA 3BREA 1KOOA 3I55S 1PILA 3DGPB 2YKMB 3OTOF 3K5NA 1M5SA 3JSBA 5HBMB 1VLOA 2CJXB 3MDFA 2ALZA 3OL8A 4YQWA 2BKPA 4F7VA 1GNKA 2V34A 3IMQJ 4JI7J 3LAMA 1FK9B 3VR1A 1ZPWX 2Z30B 3VGVA 2Z2LA 1TL7A 3BQ0A 1EJ7L 2EKYA 4MTPA 1RHRB 3OFFA 1XNRJ 2QMWA 4Q0BA 3W60A 1NK0A 3FBBA 4EK2A 2EXUA 1FD8A 4QPTA 4EUVA 1B0TA 1O8BA 3TVKA 4LUBA 1MW7A 1T02A 4NLYA 1XIQA 2EW9A 3MGJA 1VQ6S 1T05A 3ILIA 1HQUB 4CM2A 1FVQA 1VRTA 3IWNC 1X4CA 1MU2A 1P8GA 3MECB 4OZJA 3Q24A 2OH2A 4Q5VA 5J1EA 3K17A 1S0MA 4ZVPB 4HI2A 5FLXU 1U49A 4LSLA 3C6UB 3TZXA 2GQ2A 2W4PA 2QG9B 4YHHJ 1YJ9S 2RRBA 1CULB 2YX7A 1DURA 1AUDA 3RBDA 5CYQA 2SXLA 3MM9A 1SH2A 2VBYA 4AD6A 1XEZA 3FBEA 2C2MB 3X1LB 2YNGA 3DRPA 2VG5B 3N79A 2GAGC 4ZN1A 2AYMA 5JJBA 4CLPA 2QRRA 1SKRA 3CCQS 4PWWA 2FUG9 3AB2B 2D9PA 4LFAF 4I67A 3M32A 1WEYA 1H73A 5LJ5Y 4NLWA 4QWCA 3KLGA 2H5JB 3TANA 2XNRA 4DV0F 4DV2J 1X4FA 2XMMA 2KT3A 1VQ4S 3R5DA 2UXDJ 1OY9A 3MCSA 4YFUA 2IRUA 2W8KA 4I6AA 2I6WA 3MTKA 2Q79A 2GVDA 3GLJA 3TQEA 4DV6F 2VC1A 1SKWA 1HWKA 2XC9A 5KFYA 1TVRA 2R7WA 4F3OA 4B3TF 1DFDA 2UUBF 2VQFJ 1WF0A 1HBUA 4P2FA 3V6KA 4Q2LA 3ILJA 2X3DA 4R8UA 3CCTA 3UDVA 3D0IE 2WVDA 4LF8J 4QBUA 4FN5A 4OZ1A 3OR1A 4KGXB 5IT9Y 5LT5A 4DQIA 2QC3A 1T11A 1S7IA 1T03B 3EWGA 3LOUA 1GMVA 4LSNA 3O1LA 2YWKA 2XMVA 4NRTA 3NOGA 2IIHA 4F4ZA 2IPOB 2YNIA 3PKMA 3KHHA 2I9SA 2DVIA 4X84A 3GIKA 2DNZA 5JVHQ 2ASLA 1U6FA 1S72S 1FD2A 1U7LA 3M9OB 3Q8SB 5BYSA 1YG0A 5B0GA 2Y1RI 2BANB 4ZLNA 5HLFB 3Q83A 4JYAF 4RW8A 4IOBA 5CAAA 3DU6A 1JLEB 2F65A 4Y2CA 4OI4A 2VUGA 1AFJA 2VKRA 1K44A 3UD5A 5KT7A 1HR0J 3CJRA 4KGVB 1JJ4A 4WU3A 4I1TA 2HVHA 4PRFA 4LVOP 4Y2AA 2OMOA 4O44A 3E01A 1FE4A 2UU9J 2GO8A 3NCPA 1RTJA 3L7PA 2L9NA 4W4MA 4QQBA 2I2YA 4N5SA 2MGZA 2B3TB 1HKAA 1S57A 1Q78A 1WD6A 4QWDA 2DR9A 1NLKL 4ZVGA 1AYEA 4P52A 1Y11A 2DGQA 1T7PA 2DR8A 1RYSA 4KH0B 2ASJA 1QAYA 3QJJA 1TL7B 2BE7D 2XULA 2HRYA 5F0UA 4Q0BB 5DQHA 2PGCA 5HATA 2HFZA 4J37A 2CQGA 2AGPA 1E6VA 1QLNA 1WG4A 2XZWA 4K4WA 2EC0A 3PR5B 4BBYA 4RO0A 4A8QA 5F9NA 1S0NA 4OFZA 2IM2A 1T05B 1QAJA 3H5SA 1P9QC 1UMJA 2CDRB 2DHXA 1VRTB 4ZJLA 1IBKF 1MU2B 2HHSA 2ZH1A 3RR7A 2ZOGA 5J1EB 4MKAA 1UCNA 5ETOA 1UJ4A 1J5OA 4PQUA 4LSLB 2EWHA 2LQ8A 3SCIE 2F8HA 4LR9A 3OL7A 3ETOA 5CYQB 2QYGA 3JYTA 2Q6BA 5F3TA 4U7CA 1R6YA 3MM9B 1Q79A 2LMIA 2VG7A 4OLOA 1BWVA 2OPPA 1K1SA 2OJ3A 2KT2A 2YNGB 4A8OA 3DRPB 1ZAXA 2DNNA 2IJRA 4F67A 3DXSX 3TR5A 4DX5A 1U1OA 4CH0S 1FXLA 2RQ4A 2F63A 4DCOB 2OI2A 3FEYB 4F4KA
chains in the Genus database with same CATH topology
3ZZYA 1GXTA 1M5PC 2B9YA 4TU7A 1QE1A 1IKWA 1TV6B 1XC9A 5F8GA 4KHMA 2UUAF 3Q2TC 2KI2A 3OVBA 2PI4A 3V6JA 1G6BA 2RT3A 3BSAA 4KE5A 4OMFG 2I5JB 2R2SA 3M32B 4ZHRB 2YWGA 4RBTA 5LSOA 3DLHA 3PDNA 2YVSA 3G8TA 2O1PA 1NKBA 2M8DB 4ECXA 5CZXA 4WCEQ 1XK8A 2R8JA 3S1TA 1GXLA 1S9EB 3T9ZA 1KS2A 3MEGB 4FNIA 3PW5A 4NA3A 3BF4A 2P9EA 4EWTA 4ILRA 2EFQA 3GYNA 2BDPA 2BA9A 2R2UA 3KJVA 3C6TA 2RNEA 3KLGB 1S99A 2OPRA 3ENVA 2MB0B 3LP1B 4UY85 1X0PA 4ILLA 4DX8H 4LIRA 1EETA 3ZZOA 4TU9A 2ADCA 1HHSA 3CEDA 3FZ2A 3X3UA 3NBPA 5J2PA 4XK8C 1KOHA 5FLXY 3KLHA 1CQNA 3LUYA 2L9DA 5KFWA 1NK7A 1ZTTA 2LYVA 1RA7A 4HEA9 2ADBA 4YB5A 3Q22A 1YIJS 1DQ9A 1ZZFA 3VF0B 1TKZA 3GYXB 4Y3CA 3OL6A 4DF8A 4GC6A 3PW0A 2JEFA 4X62F 2HFOA 5CYMB 3CJKA 2GMJA 2DCLA 2WBMA 5B09A 4OI2A 4I64A 1ZBTA 2MMYA 1YRUA 4I2QA 3UNGC 1D3WA 2VASA 2AYEA 1JLBB 3OLAA 4NLSA 4Y28C 1RT1B 1Y5LB 2W4CA 2BOPA 4WFNQ 2AGQA 1TVRB 4PPDA 4M5DB 2WHOA 4IG0A 1FDNA 1ZZNA 4A8MP 2KN4A 2A3JA 3MAHA 2VQEF 3UD4P 1UETA 5L1LA 1WELA 3GIIA 3NRBA 2FHJD 2NSCA 1HBUB 2DNHA 1LW2B 1HBOA 3AY0A 3IAS9 2N4DA 3OTBA 4V19J 1IKYA 2BJEA 5IQ6A 3H5UA 3M8QB 4O4RA 3UDLA 2DGVA 3ISZA 1C0UA 4MIAA 1T3NA 2R7VA 4R8UB 4Q44A 3NAIA 4P6QA 4C8YA 2RU3A 4IUFA 3OR2B 4QR1A 4DF4A 3CB4A 3CT9A 1DTTB 1G7CB 4XIUA 4A8XA 2ZJRQ 3DLGA 3AH6A 2JRSA 3CE8A 2KJVA 5MLCV 2IM1A 3OR1B 3N28A 4HVZA 2XNQA 2IFXA 4NL5A 4ECVA 4J9OA 5G0RA 2RS2A 4DL5A 1T94A 2J7KA 3DI6A 2WK4A 2HMIB 2C22A 1X4AA 1M0SA 3RTVA 2XI3A 2XS7A 2J6TA 4RZRA 3MMBB 1S1WA 2J0XA 4HH0A 4LSNB 3MPWA 3BM7A 4KIAA 3HMJG 3CJ4A 4K4YA 4C8MA 1IN0A 5HI7A 4I0WA 1TQLA 1VQNS 1N5TA 4FVCA 1O51A 2RDIA 4PXCA 5IT0A 4B9SA 3M2VA 1AROP 1S4FA 1VBYA 3IXQA 3TYTA 1D9DA 4TXSA 3LWMA 2Z4PA 3BDEA 4QZVB 2EPIA 4B9UA 1DAXA 3J80Y 3MUTP 2YY3A 3IRWP 2YNIB 4RU2A 1D0EA 2FJAB 2WCXA 5L38A 3FEZA 1X5OA 3L7OA 4TLRA 2XGPA 2RVJA 2KFNA 3C66A 4BHQA 2RJZA 4ZPWR 5C24B 5KFBA 1V3ZA 1HW9A 4EGLA 1MMLA 1WG1A 4KO0A 4C3KA 1HWJA 3SCJE 5B7WA 3HT3A 3G8QA 4YMEA 2ZJPQ 2J7UA 1LXJA 2JVOA 3H2VE 4IFYA 2CVIA 5CZVA 1FRLA 1HFEL 1R43A 2Z8QA 2CFXA 4Y2KA 4JI2F 5CA5A 2R8GA 2RQCA 1V9OA 2LKZA 3NMRA 1S1XA 1TP7A 4BCAA 4N76A 3NP5A 5D4LA 1OSDA 3EPGA 3PFOA 1IBMF 1WHXA 1FT8A 4DS5A 1VC5A 2XI2A 2MQQA 1H3DA 4CT8A 1U1PA 1SH0A 2DNKA 2B51A 4OIXA 3AHPA 1VQ5S 2X1GA 2JLGA 3OXLA 4C0BA 3IAM9 4XDCA 1SL2A 4XPEA 1N48A 3H4BA 4RW8B 4H4OB 5DM7Q 2HQ3A 1N88A 1JXLA 3HJFA 4M94A 3OFEA 5KFKA 3HKWA 5KFNA 4ITSA 3PW2A 1P6TA 4CT9A 3SV4A 2NSBA 4RW4A 2D9OA 5KG3A 2E5JA 2Z2MA 1OS5A 1XN9A 2L48A 4UQTA 4JI5F 1BY9A 2J76E 3GG1A 5B0DA 4Y00A 3PKYA 2IRYA 4NYOA 3OFHA 4HTJA 1U24A 2HHQA 2I8EA 4XO0A 2WBRA 5L1IA 1JXEA 1HBMB 3DC2A 5FDLA 3D1HA 4KHRA 1PGZA 2AJ1A 2EFOA 2G13A 2AYGA 2P6TA 3CCWA 4BC9A 1XMQF 4H4KA 3DFEA 2KXNB 3M6VA 3Q8PB 1YTYA 4F50A 4ETZA 1QVGR 3HX9A 3I5CA 2W9CA 3C2PA 2C3MA 4Y6IA 5E3CA 3V4IB 3JTPA 1NK9A 5KAKA 2XLJA 1ZTWA 1S77D 5A8RA 3DRXA 2NQPA 2OTLS 3PY8A 1RKJA 3CDAA 2CQ1A 1EP4A 1S1VA 2GMHA 3LP0A 3KG0A 1RTIB 4KC5A 3MM8A 1RT7A 3T1HF 5E0OA 5F3ZA 4Y0FA 4NRUA 3DRRB 4O44B 3CD7A 5I3PA 2ERRA 3E01B 2VL1A 2PMZD 3THVA 4OJ3A 3RB4A 1QSLA 3D28A 1R3NA 5IS2A 2G0CA 4DFPA 3CSKA 1CVJA 3NNHA 1BQMA 5KFDA 1UL3A 2B4OA 1YITS 4XAKA 1RTJB 2ZVSA 4YDDB 2D3ZA 4MKYA 1Q16B 2ZDPA 3PZPA 4A8WA 4WXWA 2MGZB 2EBEA 1S6PB 3JB9k 2GJ2A 2UZAA 3S7RA 3TVYA 3MFIA 2DNMA 4UOCA 1OIAA 1U2RA 3QIDA 4J9QA 1VQ7S 4GKKF 3WX4A 4OV1A 3VAIA 4QIGA 4WU2A 5HMZA 4EO8A 1REVB 1TKTB 3M2RA 2GO9A 4HL9A 2MKKA 4HI1A 3SMZA 5E3PA 2ZD1A 2EFGA 4AFFA 4CO1A 4DR2F 2MSSA 4WFYA 1FRIA 2EK6A 3M6UA 3VAKA 5THWA 1FKPA 3V6DA 1VQKS 3SEOA 5KFXA 2VFVA 1ZYQA 4M8LA 2PC6A 2GGPA 2RRAA 3FCHA 3J7YU 2G4BA 1N54B 3NCRA 4GMKA 1XR7A 1QSYA 3PJWA 2QFJA 2L41A 4ERDA 4WF9Q 1WF1A 1L3KA 4U67Q 1FE0A 2AU0A 1PO6A 3D2WA 1K9MT 2XY5A 2KJWA 4P7TA 4ZK7M 2OIHA 4RW6A 1TR0A 4A8KA 1HWLA 1KRPA 1FRHA 1HR0F 3BR8A 2KB2A 2EFVA 2CZ4A 1PC5A 1TFWA 1RJJA 2E5HA 2C2EA 4B9VA 3UCZP 1E6VB 3H25A 5D3GB 4UUWA 3RW6A 1V6HA 4IOCQ 4QIFA 4IG3B 4N77A 4A46A 2P6SA 4RW7B 4ZCLA 5C25B 4R5PA 1H2VZ 3KLVA 5KFJA 3AA9A 2PA3A 3EXYA 2DO0A 3KLIB 4HDGA 4DG1A 1RGVA 2R7XA 5F8NA 1B7FA 5LMNF 2A2DA 2RF2A 4NCAA 2KKHA 2MKSA 3RBEA 5DLFA 1OPZA 2DCUB 2J0QD 4PG4A 3VCDA 2LVWA 5K14A 3T5LA 2WW8A 4OX8A 2E7WA 4FYDA 2BM0A 2OLWA 4RBVA 4UW2A 2XSFA 2M2BA 2CYYA 1RT2A 2AV5A 4LQ3A 2VPWB 2ZBCA 2IAJA 4DV7F 2B4UA 3WBZA 1GQEA 3HK2A 3FDSA 4QWAA 3HHLA 4JI0F 2JH3A 1K0TA 4BWJA 1FDDA 2J9EA 1HARA 4M63A 2R7UA 3PR4A 3QZ7A 2R2TA 4IFVA 4CZCA 3OHAA 1X4BA 3UDCA 3PX4A 3I5BA 4IKAA 1GX5A 3T5KA 2PDAA 4ILMA 2HFNA 2MZSA 2WAQD 2VPYB 5F8LA 5B0AA 4ID5A 1LK7A 1VK3A 3RAXA 4O3NA 1Y4ZB 4CO4A 3CCJS 1J5OB 4PQUB 4WZMA 3MUVP 3LWLA 5DETA 3BO2A 4YB6A 2XMWA 4A47A 1JLGA 3FEXB 5KFIA 3K8WA 3LH2S 1VQMS 2EK1A 2CPIA 1N5SA 4O4GB 1OSCA 1WWHA 4Q43A 2H5EA 2XCPA 5KFMA 3RR8A 4I2PA 2R2RA 4LF9F 2VFRA 2V8HA 2PMHA