1VCCA

Amino terminal 9kda domain of vaccinia virus dna topoisomerase i residues 1-77, experimental electron density for residues 1-77
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the amino-terminal fragment of vaccinia virus DNA topoisomerase I at 1.6 A resolution.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Dna binding
molecule keywords DNA TOPOISOMERASE I
total genus 14
structure length 77
sequence length 77
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1995-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09266 VirDNA-topo-I_N Viral DNA topoisomerase I, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.66.10 Alpha Beta 2-Layer Sandwich Viral Topoisomerase I DNA topoisomerase I domain 1vccA00
1VCCA 3IGCA 2H7GX 2H7FX 3M4AA 2F4QA
chains in the Genus database with same CATH superfamily
1VCCA 3IGCA 2H7GX 2H7FX 3M4AA 2F4QA
chains in the Genus database with same CATH topology
1VCCA 3IGCA 2H7GX 2H7FX 3M4AA 2F4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCC A;  3IGC A;  2H7G X;  2H7F X;  3M4A A;  2F4Q A; 
#chains in the Genus database with same CATH topology
 1VCC A;  3IGC A;  2H7G X;  2H7F X;  3M4A A;  2F4Q A; 
#chains in the Genus database with same CATH homology
 1VCC A;  3IGC A;  2H7G X;  2H7F X;  3M4A A;  2F4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...