1VCSA

Solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
GSSGSSGEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Vesicle transport through interaction with t-SNAREs homolog
total genus 30
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 1vcsA00
2V8SV 2QYWA 3ONJA 1VCSA 3ONLC
chains in the Genus database with same CATH superfamily
4PK4A 3SFEA 2ACXA 3EDVA 4YLHA 5ADXL 5CGMA 1YD8G 2D2SA 2E9XD 4C91A 4AKHA 3L09A 1X79A 3DTOA 2PJQA 3NRYA 4EXTA 2VKOA 4H9RC 2WU2A 3UFEA 5L3BB 4P0AA 1XMOT 2PTFA 2IMLA 2KINB 3ZEFB 4PJMA 3AEFA 5FY7A 3K8PC 4DR1T 2BG9B 2NTXA 4XZCA 1N32T 3GMIA 4IE5A 3QUJA 3AXJA 2DL1A 3EABA 2VASA 3TKLB 3TLVA 3C4ZA 4CQIA 1MMNA 5GONE 3B5MA 3V5SA 1G8XA 2LM9A 2YDQA 3LG7A 3RHWA 2B76A 1T98A 2KWIB 2XAJB 3ONXA 4Q25A 2C0SA 1VCTA 2CA5A 4LF8T 3RC3A 4DR6T 2ES0A 3FBLA 3S4UA 2D0TA 3D0TA 2V1DB 4UIGA 5AQLB 3RIUC 1BR0A 5LMNT 5HXRA 3PJAA 4CI2B 2Q9QB 4YTMA 3I0QA 5JTGA 4NXNT 3MZKB 3AE7A 5IHYA 5LJMA 1KEYA 1MNDA 3PUQA 4WBNE 5JDQA 3VR8A 5AQVB 4ZEYA 2N1GA 3CX6B 4IDZA 3C51A 3AA7B 1HS7A 1US7B 4OYKA 4ZI3D 2N9DA 4EAHA 2NTYA 4DV3T 3MA9A 2W66A 4HKAA 4EGWA 2KZ7B 3CX7B 5JQGE 3V5UA 1N34T 3TLTA 4LMJA 2ZM6T 1WYCA 2V5CA 5FY1A 4HFDA 3OYXA 4YTNA 5AQNB 1HG2A 2V7LA 4PW8A 4DUZT 3CVRA 3P7IA 4NUUA 5FYMA 2JQKA 3AE6A 1SE7A 4X1YE 3Q2MA 5LP6E 1YKEB 2X0YA 3WI3A 4YXDA 2LM2A 4LMLA 1XMQT 5L3EB 1OXZA 2WP9A 2VKDA 2X9WA 3B13A 3P4RA 1HG5A 4L9IA 4M1PA 1WLXA 2EHOC 3KFWX 4I55E 3N9PA 4QXHB 3U78A 2A9UA 2XY8B 2VL8A 2H89A 1OEDB 2Q9QD 2V7IA 4NIQA 5FXXA 1W0AA 4LF7T 2A3DA 3OVUA 4LFAT 2XQAA 2WQYA 2JQHA 5JDGA 4IE6A 2VVNA 2BG9C 2KXPB 1ZOYA 4A97A 2UUAT 4OK0A 1KK7A 2NW7A 5JDHA 3RGLA 3RH3A 3E22E 1CUNA 3Q5DA 4J2CA 3ZCIA 2XAGB 2CE7A 2PFVA 3RF1A 4DIDB 1XWMA 2FJEA 4EIWA 1MMDA 4YSYA 2E2AA 2BG9E 5J0ZA 2LRLA 2V7MA 2WSSV 1NAFA 3RYFE 1MNEA 5FNVE 2JJ9A 3TLUA 2LSJA 4YT0A 1HX1B 3CQCB 3AB3B 4C90A 2WMOA 4X66T 2BS4A 4LFCT 4EB6E 5HEUA 4OHFA 3PUVF 2HN2A 4PNIA 1OEDA 2NP9A 3AEEA 2Y8DA 3N9OA 4HWHA 2LOPA 5KXJA 5LCYA 4PJNA 3KBTA 5HEOA 4PFOA 4QXBB 3N9QA 4NUVA 3HKDE 1XDPA 4PFPA 2WB5A 3RIFA 4EZ4A 3IA3A 5HYAA 1KFYA 1UX4A 3KV6A 3KV9A 2NR4A 4IDOA 1WR6A 2KT9A 4MHCA 3F2EA 4HE8A 4CI1B 4CXXA 2MYSA 2W00A 4YFSA 2BDEA 2UXXB 4K0KT 2BS3A 2XTLA 2CM0A 3P8CD 4LF5T 3CWZB 1GQEA 5EK2A 2WDVA 4YJ3E 1LRZA 3IF8B 3EUHA 3N9MA 2OV9A 1D1CA 1NEKA 4AISA 4JUYA 5JDNA 4U74A 4JV5T 1FEWA 4CN6A 3UQ7A 2KSRA 4HWFA 3UUBA 1MMAA 4U2YA 3CQXC 4P09A 3PDYA 4TNVA 3VR9A 2QVAA 5HEGA 5LHGB 2R6GF 5H6RB 5FXZA 5IUXA 4MFRA 2W2UA 1HTJF 3HKEE 4UF0A 1I94T 3PUSA 1B7TA 4UF0B 4UVBB 3AEGA 2JIWA 4IL9A 3Q5EA 2WU5A 2CRBA 2CXDA 3PURA 4TWFA 4UV8B 4DR5T 2ODUA 3LJCA 3ETVA 4KBMB 4QX8B 4IDNA 2WAUA 4A56A 4TWHA 3N5LA 4DBRA 2DNXA 4X20E 2WCAA 2JPFA 2BVMA 4PAGA 3OYZA 4TUYE 2IIUA 4GK0E 4MBQA 2BVLA 2WBLA 2ODVA 4TWDA 1QLBA 2C5IT 4MLKA 4TX5A 3FZLB 4Z91A 4HFEA 1E2AA 3NZPA 5LBMA 3RPUA 4PJJA 3UTKA 3ZYLA 3JC6C 5C8YE 3JADA 3UU5A 5FXVA 4IREA 2HPJA 2FUPA 3M3ZB 1IAPA 2WMNA 3KV4A 4JLEA 5HWXA 3FZHB 2LJLA 2H7OA 2E5LT 4O4IE 2CMRA 2WDQA 3G06A 3ZMSB 2UXBT 2DHRA 4HFIA 4HN9A 4DV4T 4AI6A 4ERRA 2CEAA 5AQGB 4CZZB 3B57A 3IHRA 2E5VA 4OFZA 2CLYC 4DMVA 1BR1A 1UX5A 2CHNA 3C98B 2CBJA 3I0OA 4QH1A 4AQFC 4DNDA 3ZMZB 3RIAA 1UCUA 5A1LA 5JDLA 3A7MA 2QYWA 3ZYKA 4B3MT 4KHPT 4U7YA 2WWVA 4KUMB 4BJMA 5ABFB 4BA9A 3PUZF 5FP3A 1HFAA 2VB6A 4WYVA 4ZXLA 1MIWA 2B1EA 2MAWA 4PJLA 1KNZA 5JDFA 3LBXA 3IBPA 3QB5A 5L47A 4IDQA 2M6BA 4QHOA 3QNUA 2BKOA 4QWNB 4AKRB 2E8IA 4B3TT 4QX7B 2JMHA 3VKHA 3UU3A 3ZMVB 1DU2A 3AE5A 1FMWA 3I9YA 2LSIA 3NBXX 4EEDA 1XNQT 2CBIA 3RRCA 1QSDA 2IUBA 4UV9B 2V26A 3J9X1 4JBWF 5ABEA 3RYIE 3WAJA 1G73A 4ISTA 2M67A 3E08A 3N9NA 4GYRA 4H9SE 1EZ3A 1SA0E 2XQ3A 2Y48B 4I50E 1D1AA 3EDUA 3EI0A 3QC9A 4GOUA 4YY3T 5JDMA 3LK2B 1HNWT 3ZMUB 3P4SA 3FZKB 5AQUB 1D0ZA 2QRXA 4GKKT 2IC9A 1WR0A 2JQ9A 3AVRA 2LLYA 5BMVE 5HXEA 5JRCB 5AQHB 2W63A 3PU3A 3RKGA 4DV0T 1WCRA 3LDQB 5LG3A 1MIVA 4B3ST 4JI6T 2A72A 2YU2A 3K1SA 2W0GA 3OBVE 2J47A 3OKQA 1IZNB 4DR3T 3NZQA 4ZI2D 3PUAA 5DABA 3O1IA 3UUMA 3ONLC 5AQMB 4ZHQE 2BS2A 3ZLIA 5L3CB 1CHUA 2NW8A 3PUXF 3RX6A 4H9NC 2L3LA 5AQIB 4JI0T 5TAOA 2LKGA 4HTEA 4IE4A 4AIUA 3O9XA 1XZYA 3AAAB 2YINA 2XM1A 4HWDA 1UUSA 3CX8B 3FXEB 2V6YA 5CFBA 2XQYA 2E9XB 1IBLT 3SFDA 4OX9T 2LT3A 4ILAA 1IJ6A 1ZP0A 2CPTA 4G63A 4Z90A 2KWHA 2YDRA 3R6NA 3ZJ2A 2X9HA 1WFDA 4EEBA 3CK6A 4UELA 5AQTB 4IIJE 2CXFA 2NOXA 3GN5A 1HR0T 1HF8A 5HXHA 3RRWA 2I59A 3ANWA 5AQPB 4JI4T 4JEUB 3VU7H 5JH7E 2UUBT 2XASB 3SWHA 3PV0F 3T1HT 2FBWA 5CA1E 5FL0A 2IAKA 4ADZA 3T1YT 3AE8A 3IEEA 1VRBA 2UU9T 4LMKA 2DLRA 2XZEA 5L4HA 1OEDC 2XM2A 4ZI2C 1Z8UA 1D0YA 2IDOB 2SPCA 4JI2T 3QB5K 2EHOB 2V7JA 3MXZA 4HWCA 2ZLYA 3TLSA 2QGSA 2C5JA 1J1JA 5ETWA 3RQUA 3UT5E 2XSBA 3LBXB 5AQQB 2M6IA 2YK0A 1OEDE 3M65A 1N36T 1V9DA 3OJAA 5DJQC 5FY0A 5KX5E 2XQ7A 3NKZA 5J1GA 2LRKA 4CXWA 1T7SA 3HKBE 5EZYE 2RPAA 5KMGP 4TNWA 1SHZC 3ZN0B 5LGTB 3EAMA 4U7IA 2HH7A 4G2AA 4ZS2A 3UU8A 1W0BA 3U3IA 4BAYB 5HCMA 2BKNA 4DV1T 3AA0B 2WS3A 4AQFA 3RC8A 2WDRA 5LOVE 3R84B 3ZPOA 1ZKEA 2WY2A 3AEBA 4E7ZA 2W67A 3LK42 3UULA 4ZI3C 5M4YA 5FKYA 3AEDA 2MTQA 2UXDT 3W15B 5HXCA 1QUUA 3UU6A 2XUEA 2NWBA 2XJ7A 2LOSA 3AE2A 3MJXA 4L5GA 5HWYA 1FJGT 1BR4A 2X9XA 3H3MA 3N9LA 5HEHA 4MALA 2H3RA 5LHHB 3HA4A 2C5KT 2HPLA 3ANWB 4O4JE 3SS1A 5LNKA 4XBFB 5AQOB 5F3JA 3GN5B 2Z6EA 3WAKA 2D0UA 2XQ8A 2X66A 5FMNA 4ANJA 5L3GB 3UFGA 2X68A 2IC6A 5CB4E 1E1HB 3ZT5A 4F6RC 5LJNA 5AFUL 3A5XA 2G0UA 2I6HA 3E0ZA 3RKOA 1H7CA 3AA6B 3CMLA 5EK3A 2UXNB 2E9XA 3RI5A 4YSZA 4GKJT 2V6XA 4B3RT 2XAQB 4IDPA 2WM9A 1VOMA 3OTOT 5JR9B 2ACZA 4A5XA 4A98A 3PUYF 2VWAA 5HCJA 3X1DA 1R8IA 3KVBA 4P0BA 1U5PA 3UQ4A 5CJ5A 4GIWA 3RYHE 3DP7A 2LEHA 4HFCA 4UVCB 4XAXB 2CCQA 2V8SV 3KINB 2BBJA 4GYSA 3L39A 3K3QC 3ZMTB 2XQ4A 3AE1A 5AQKB 1AJ3A 4CXYA 4L0RA 4YSXA 2IHR1 3C4WA 5C2TA 2LHNA 3VHLA 2UUCT 3ZT6A 2X0LB 4EZHA 4V1Av 3BQIA 1LVFA 1VCSA 2LKHA 3DJBA 4WW0A 5AQRB 3ZN1B 4EYYR 5JRCA 2K5BB 4I0UA 4EV6A 1XDOA 1YW0A 4TV9E 4CN4A 2CXLA 4LFBT 2J1DG 1D1BA 2OLTA 2YOEA 3LFMA 1IBKT 1KF6A 1YKHB 4U72A 5BR8T 2HN1A 3HL6A 5LHIB 4U33A 1MIYA 4KHZF 1NENA 3HKCE 1M62A 4JYAT 2EHOD 2W4XA 2ZM2A 4ILCA 3Q5WA 4WBOA 4Z8XA 3ZSTA 4ZS3A 2Q9QC 3PTRB 4JI5T 1X9BA 5ABHA 1E7PA 3C4XA 4HEAA 2WZIA 2VL0A 2OA5A 5E0OA 5J2UE 5FXWA 5JR9C 1J5ET 4PK6A 2IW5B 2MOZA 4QH5A 3MKDA 4KP3C 1NWMX 2H88A 4X5TA 2N2NA 4CN1A 5FVLA 4HGAA 3PUGA 4IL4A 4AQGA 4JI8T 2K9AA 2VKHA 4DR4T 2JMKA 2VK9A 3AAIA 1HNZT 4AQYT 2XQ5A 4TV8E 2QA7A 2HHHT 4LF9T 4KI0F 4IE0A 4WNKA 5JR9A 3ZCJA 1I6ZA 4I4TE 4GK5E 4U3CA 3NRXA 4X1IE 5DQVA 1U4QA 5F5WA 3ZYMA 3GWHA 1UK5A 5AQSB 5ABFA 2E9XC 2X0HA 4ZOLE 5L3DB 4AKIA 2CHOA 5L2LA 4JEHB 3PJAJ 3ONJA 4JI1T 4UR9A 1ZEEA 4DMWA 3NWIA 3QOFA 3C50A 3JAEA 4UXNB 4EYUA 3ZC1A 5LG4A 2MPKA 2AXDS 4X64T 4JI3T 4BJNA 2KNDA 3MACA 4UVAB 2XAHB 4FJOA 5HAXA 2JRKA 3UUXB 3H3AA 4DBQA 1S35A 1FIOA 4DVDA 2X9YA 3F31A 2W61A 2YKSA 4ZI7E 1Y64B 4X65T 5FL1A 3N2OA 3HR0A 2ZM0A 5HEJA 3BQLA 3ZKRA 4DO0A 1YQ3A 2GK9A 2XPKA 3EVYA 4OYJA 2J62A 1UGOA 1ZV4X 2LSYA 4YTPA 2RP4A 3O1HA 4I43B 2J4GA 3CPZA 4QXCB 4HFHA 2DCFA 2PBIA 3FXDB 3J7Yq 2DWKA 3JAFA 4LF6T 3FZMB 1Y01A 2WWUA 2Q9QA 3A8YC 3BK9A 4U2ZA 2YEVC 2UXCT 2X67A 2LHRA 4H9QC 2LSGA 3ZSSA 1T8BA 4YHHT 1Z0PA 2XAFB 1M7KA 4AKLA 3ETUA 3F57A 2D9DA 1SUMB 2YU1A 1O3XA 4H63H 2JQQA 3BQKA 3KDSE 4QH4A 4ZZBA 3VKGA 5JVDE 3RYCE 5LBQB 2Y6XA 3P4WA 4YJ2E 3ESLA 3VRAA 4NXMT 3JC6D 5LYJE 3PU8A 3FBZA 3AXJB 4ASKA 3O4XE 1HX8A 2BG9A 2DWGA 2YN6A 3LK3B 2VQFT 1IJ5A 2XHEB 4EOZB 5CA0E 2VURA 3I9WA 3RIUA 3AAEB 4HFBA 2VVSA 4N78D 4X1KE 5F8PA 3UU4A 2XSAA 5AQFB 3K3NA 4IGUA 1MMGA 4IHJE 5L4EA 2MBGA 3L3PA 2KLQA 4O4HE 5LA6E 1JNZA 2K24A 3HI2A 4DR2T 1WRDA 2FJDA 3AA1B 2XQ9A 3VRBA 3O1JA 2DI4A 4PK5A 2LE8A 3N2GE 5LGNB 2K48A 2V6YB 3PE0A 4B6XA 4TZ4C 2BBHA 4WZXA 3KV5A 4H9OC 5AQJB 4COFA 4ISSA 2BZBA 2RA1A 4KX6A 4O2BE 4TN7B 2NW9A 3T8OA 5IWAT 3KVAA 4K0UA 5FVKA 2P9BA 4P1NA 1XNRT 3CKDA 3P4PA 3AEAA 1UURA 4ILBA 1YXRA 2FJAA 1OWAA 2ZMAA 4IE7A 3MK7C 2L8KA 1KNRA 3KBUA 3FB2A 1LVKA 5JREA 5ABGA 5HXSA 2AE9A 4ZZCA 3ZT7A 4DV7T 5C3JA 1FMVA 1IBMT 3Q9DA 3N2KE 1J5WA 3AE3A 3FHNA 4DR7T 4U31A 5EK4A 5H6QB 2H7VC 3AE9A 3C64A 2L9QA 3LSVA 4DV2T 4O4LE 3AE4A 1YQ4A 3AVSA 2LSKA 2F4VT 2CLYB 2A2FX 3ZJ1A 4HFVA 3I1AA 4HWIB 5KDMC 1ZHCA 4DV5T 4YHJA 4H63V 2VQET 1HNXT 4O8SA 5LGUB 2KMFA 4IT4A 4LF4T 2YDSA 3L8RA 1L0VA 1W9RA 4QKNA 4CI3B 3PUWF 3Q5XA 3P4QA 4NPPA 3EHZA 3TLWA 3K3OA 1W09A 4DV6T 1BR2A 2V5DA 3ZC0A 4JI7T 2FJBA 3AECA 2X51A 3CQGB 4ILUA 4UEMA 2ZM8A 3CIRA 2BKPA 3RQWA 4KMCA 5LMUT 2V7KA 5L3FB 2CWOA 2WZHA 4H9PC 3OPCA 5IYZE 2VKJA 3ABVA 1JNRA 1HCIA 3RLFF 1T72A 5LB7B 2I0MA 4FI5A 3H37A 3UUNA 1D0XA 4E7SA 2D5UA 5LXTE 2CWYA 1KNPA 4F8HA 2XQ6A 1N33T 3JCFA 5DQWA 5J2TE 4O2AE 3NVOA 3P50A 3SOLA 3GA8A 4AXPA 4DUYT 3FZFB 3QK6A 3SRZA 1WYBA 2PG8A 2K3WA 2EHOA 4X62T 1S94A 1LKXA 2W62A 4AKGA
chains in the Genus database with same CATH topology
2V8SV 2QYWA 3ONJA 1VCSA 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  2QYW A;  3ONJ A;  1VCS A;  3ONL C; 
#chains in the Genus database with same CATH topology
 4PK4 A;  3SFE A;  2ACX A;  3EDV A;  4YLH A;  5ADX L;  5CGM A;  1YD8 G;  2D2S A;  2E9X D;  4C91 A;  4AKH A;  3L09 A;  1X79 A;  3DTO A;  2PJQ A;  3NRY A;  4EXT A;  2VKO A;  4H9R C;  2WU2 A;  3UFE A;  5L3B B;  4P0A A;  1XMO T;  2PTF A;  2IML A;  2KIN B;  3ZEF B;  4PJM A;  3AEF A;  5FY7 A;  3K8P C;  4DR1 T;  2BG9 B;  2NTX A;  4XZC A;  1N32 T;  3GMI A;  4IE5 A;  3QUJ A;  3AXJ A;  2DL1 A;  3EAB A;  2VAS A;  3TKL B;  3TLV A;  3C4Z A;  4CQI A;  1MMN A;  5GON E;  3B5M A;  3V5S A;  1G8X A;  2LM9 A;  2YDQ A;  3LG7 A;  3RHW A;  2B76 A;  1T98 A;  2KWI B;  2XAJ B;  3ONX A;  4Q25 A;  2C0S A;  1VCT A;  2CA5 A;  4LF8 T;  3RC3 A;  4DR6 T;  2ES0 A;  3FBL A;  3S4U A;  2D0T A;  3D0T A;  2V1D B;  4UIG A;  5AQL B;  3RIU C;  1BR0 A;  5LMN T;  5HXR A;  3PJA A;  4CI2 B;  2Q9Q B;  4YTM A;  3I0Q A;  5JTG A;  4NXN T;  3MZK B;  3AE7 A;  5IHY A;  5LJM A;  1KEY A;  1MND A;  3PUQ A;  4WBN E;  5JDQ A;  3VR8 A;  5AQV B;  4ZEY A;  2N1G A;  3CX6 B;  4IDZ A;  3C51 A;  3AA7 B;  1HS7 A;  1US7 B;  4OYK A;  4ZI3 D;  2N9D A;  4EAH A;  2NTY A;  4DV3 T;  3MA9 A;  2W66 A;  4HKA A;  4EGW A;  2KZ7 B;  3CX7 B;  5JQG E;  3V5U A;  1N34 T;  3TLT A;  4LMJ A;  2ZM6 T;  1WYC A;  2V5C A;  5FY1 A;  4HFD A;  3OYX A;  4YTN A;  5AQN B;  1HG2 A;  2V7L A;  4PW8 A;  4DUZ T;  3CVR A;  3P7I A;  4NUU A;  5FYM A;  2JQK A;  3AE6 A;  1SE7 A;  4X1Y E;  3Q2M A;  5LP6 E;  1YKE B;  2X0Y A;  3WI3 A;  4YXD A;  2LM2 A;  4LML A;  1XMQ T;  5L3E B;  1OXZ A;  2WP9 A;  2VKD A;  2X9W A;  3B13 A;  3P4R A;  1HG5 A;  4L9I A;  4M1P A;  1WLX A;  2EHO C;  3KFW X;  4I55 E;  3N9P A;  4QXH B;  3U78 A;  2A9U A;  2XY8 B;  2VL8 A;  2H89 A;  1OED B;  2Q9Q D;  2V7I A;  4NIQ A;  5FXX A;  1W0A A;  4LF7 T;  2A3D A;  3OVU A;  4LFA T;  2XQA A;  2WQY A;  2JQH A;  5JDG A;  4IE6 A;  2VVN A;  2BG9 C;  2KXP B;  1ZOY A;  4A97 A;  2UUA T;  4OK0 A;  1KK7 A;  2NW7 A;  5JDH A;  3RGL A;  3RH3 A;  3E22 E;  1CUN A;  3Q5D A;  4J2C A;  3ZCI A;  2XAG B;  2CE7 A;  2PFV A;  3RF1 A;  4DID B;  1XWM A;  2FJE A;  4EIW A;  1MMD A;  4YSY A;  2E2A A;  2BG9 E;  5J0Z A;  2LRL A;  2V7M A;  2WSS V;  1NAF A;  3RYF E;  1MNE A;  5FNV E;  2JJ9 A;  3TLU A;  2LSJ A;  4YT0 A;  1HX1 B;  3CQC B;  3AB3 B;  4C90 A;  2WMO A;  4X66 T;  2BS4 A;  4LFC T;  4EB6 E;  5HEU A;  4OHF A;  3PUV F;  2HN2 A;  4PNI A;  1OED A;  2NP9 A;  3AEE A;  2Y8D A;  3N9O A;  4HWH A;  2LOP A;  5KXJ A;  5LCY A;  4PJN A;  3KBT A;  5HEO A;  4PFO A;  4QXB B;  3N9Q A;  4NUV A;  3HKD E;  1XDP A;  4PFP A;  2WB5 A;  3RIF A;  4EZ4 A;  3IA3 A;  5HYA A;  1KFY A;  1UX4 A;  3KV6 A;  3KV9 A;  2NR4 A;  4IDO A;  1WR6 A;  2KT9 A;  4MHC A;  3F2E A;  4HE8 A;  4CI1 B;  4CXX A;  2MYS A;  2W00 A;  4YFS A;  2BDE A;  2UXX B;  4K0K T;  2BS3 A;  2XTL A;  2CM0 A;  3P8C D;  4LF5 T;  3CWZ B;  1GQE A;  5EK2 A;  2WDV A;  4YJ3 E;  1LRZ A;  3IF8 B;  3EUH A;  3N9M A;  2OV9 A;  1D1C A;  1NEK A;  4AIS A;  4JUY A;  5JDN A;  4U74 A;  4JV5 T;  1FEW A;  4CN6 A;  3UQ7 A;  2KSR A;  4HWF A;  3UUB A;  1MMA A;  4U2Y A;  3CQX C;  4P09 A;  3PDY A;  4TNV A;  3VR9 A;  2QVA A;  5HEG A;  5LHG B;  2R6G F;  5H6R B;  5FXZ A;  5IUX A;  4MFR A;  2W2U A;  1HTJ F;  3HKE E;  4UF0 A;  1I94 T;  3PUS A;  1B7T A;  4UF0 B;  4UVB B;  3AEG A;  2JIW A;  4IL9 A;  3Q5E A;  2WU5 A;  2CRB A;  2CXD A;  3PUR A;  4TWF A;  4UV8 B;  4DR5 T;  2ODU A;  3LJC A;  3ETV A;  4KBM B;  4QX8 B;  4IDN A;  2WAU A;  4A56 A;  4TWH A;  3N5L A;  4DBR A;  2DNX A;  4X20 E;  2WCA A;  2JPF A;  2BVM A;  4PAG A;  3OYZ A;  4TUY E;  2IIU A;  4GK0 E;  4MBQ A;  2BVL A;  2WBL A;  2ODV A;  4TWD A;  1QLB A;  2C5I T;  4MLK A;  4TX5 A;  3FZL B;  4Z91 A;  4HFE A;  1E2A A;  3NZP A;  5LBM A;  3RPU A;  4PJJ A;  3UTK A;  3ZYL A;  3JC6 C;  5C8Y E;  3JAD A;  3UU5 A;  5FXV A;  4IRE A;  2HPJ A;  2FUP A;  3M3Z B;  1IAP A;  2WMN A;  3KV4 A;  4JLE A;  5HWX A;  3FZH B;  2LJL A;  2H7O A;  2E5L T;  4O4I E;  2CMR A;  2WDQ A;  3G06 A;  3ZMS B;  2UXB T;  2DHR A;  4HFI A;  4HN9 A;  4DV4 T;  4AI6 A;  4ERR A;  2CEA A;  5AQG B;  4CZZ B;  3B57 A;  3IHR A;  2E5V A;  4OFZ A;  2CLY C;  4DMV A;  1BR1 A;  1UX5 A;  2CHN A;  3C98 B;  2CBJ A;  3I0O A;  4QH1 A;  4AQF C;  4DND A;  3ZMZ B;  3RIA A;  1UCU A;  5A1L A;  5JDL A;  3A7M A;  2QYW A;  3ZYK A;  4B3M T;  4KHP T;  4U7Y A;  2WWV A;  4KUM B;  4BJM A;  5ABF B;  4BA9 A;  3PUZ F;  5FP3 A;  1HFA A;  2VB6 A;  4WYV A;  4ZXL A;  1MIW A;  2B1E A;  2MAW A;  4PJL A;  1KNZ A;  5JDF A;  3LBX A;  3IBP A;  3QB5 A;  5L47 A;  4IDQ A;  2M6B A;  4QHO A;  3QNU A;  2BKO A;  4QWN B;  4AKR B;  2E8I A;  4B3T T;  4QX7 B;  2JMH A;  3VKH A;  3UU3 A;  3ZMV B;  1DU2 A;  3AE5 A;  1FMW A;  3I9Y A;  2LSI A;  3NBX X;  4EED A;  1XNQ T;  2CBI A;  3RRC A;  1QSD A;  2IUB A;  4UV9 B;  2V26 A;  3J9X 1;  4JBW F;  5ABE A;  3RYI E;  3WAJ A;  1G73 A;  4IST A;  2M67 A;  3E08 A;  3N9N A;  4GYR A;  4H9S E;  1EZ3 A;  1SA0 E;  2XQ3 A;  2Y48 B;  4I50 E;  1D1A A;  3EDU A;  3EI0 A;  3QC9 A;  4GOU A;  4YY3 T;  5JDM A;  3LK2 B;  1HNW T;  3ZMU B;  3P4S A;  3FZK B;  5AQU B;  1D0Z A;  2QRX A;  4GKK T;  2IC9 A;  1WR0 A;  2JQ9 A;  3AVR A;  2LLY A;  5BMV E;  5HXE A;  5JRC B;  5AQH B;  2W63 A;  3PU3 A;  3RKG A;  4DV0 T;  1WCR A;  3LDQ B;  5LG3 A;  1MIV A;  4B3S T;  4JI6 T;  2A72 A;  2YU2 A;  3K1S A;  2W0G A;  3OBV E;  2J47 A;  3OKQ A;  1IZN B;  4DR3 T;  3NZQ A;  4ZI2 D;  3PUA A;  5DAB A;  3O1I A;  3UUM A;  3ONL C;  5AQM B;  4ZHQ E;  2BS2 A;  3ZLI A;  5L3C B;  1CHU A;  2NW8 A;  3PUX F;  3RX6 A;  4H9N C;  2L3L A;  5AQI B;  4JI0 T;  5TAO A;  2LKG A;  4HTE A;  4IE4 A;  4AIU A;  3O9X A;  1XZY A;  3AAA B;  2YIN A;  2XM1 A;  4HWD A;  1UUS A;  3CX8 B;  3FXE B;  2V6Y A;  5CFB A;  2XQY A;  2E9X B;  1IBL T;  3SFD A;  4OX9 T;  2LT3 A;  4ILA A;  1IJ6 A;  1ZP0 A;  2CPT A;  4G63 A;  4Z90 A;  2KWH A;  2YDR A;  3R6N A;  3ZJ2 A;  2X9H A;  1WFD A;  4EEB A;  3CK6 A;  4UEL A;  5AQT B;  4IIJ E;  2CXF A;  2NOX A;  3GN5 A;  1HR0 T;  1HF8 A;  5HXH A;  3RRW A;  2I59 A;  3ANW A;  5AQP B;  4JI4 T;  4JEU B;  3VU7 H;  5JH7 E;  2UUB T;  2XAS B;  3SWH A;  3PV0 F;  3T1H T;  2FBW A;  5CA1 E;  5FL0 A;  2IAK A;  4ADZ A;  3T1Y T;  3AE8 A;  3IEE A;  1VRB A;  2UU9 T;  4LMK A;  2DLR A;  2XZE A;  5L4H A;  1OED C;  2XM2 A;  4ZI2 C;  1Z8U A;  1D0Y A;  2IDO B;  2SPC A;  4JI2 T;  3QB5 K;  2EHO B;  2V7J A;  3MXZ A;  4HWC A;  2ZLY A;  3TLS A;  2QGS A;  2C5J A;  1J1J A;  5ETW A;  3RQU A;  3UT5 E;  2XSB A;  3LBX B;  5AQQ B;  2M6I A;  2YK0 A;  1OED E;  3M65 A;  1N36 T;  1V9D A;  3OJA A;  5DJQ C;  5FY0 A;  5KX5 E;  2XQ7 A;  3NKZ A;  5J1G A;  2LRK A;  4CXW A;  1T7S A;  3HKB E;  5EZY E;  2RPA A;  5KMG P;  4TNW A;  1SHZ C;  3ZN0 B;  5LGT B;  3EAM A;  4U7I A;  2HH7 A;  4G2A A;  4ZS2 A;  3UU8 A;  1W0B A;  3U3I A;  4BAY B;  5HCM A;  2BKN A;  4DV1 T;  3AA0 B;  2WS3 A;  4AQF A;  3RC8 A;  2WDR A;  5LOV E;  3R84 B;  3ZPO A;  1ZKE A;  2WY2 A;  3AEB A;  4E7Z A;  2W67 A;  3LK4 2;  3UUL A;  4ZI3 C;  5M4Y A;  5FKY A;  3AED A;  2MTQ A;  2UXD T;  3W15 B;  5HXC A;  1QUU A;  3UU6 A;  2XUE A;  2NWB A;  2XJ7 A;  2LOS A;  3AE2 A;  3MJX A;  4L5G A;  5HWY A;  1FJG T;  1BR4 A;  2X9X A;  3H3M A;  3N9L A;  5HEH A;  4MAL A;  2H3R A;  5LHH B;  3HA4 A;  2C5K T;  2HPL A;  3ANW B;  4O4J E;  3SS1 A;  5LNK A;  4XBF B;  5AQO B;  5F3J A;  3GN5 B;  2Z6E A;  3WAK A;  2D0U A;  2XQ8 A;  2X66 A;  5FMN A;  4ANJ A;  5L3G B;  3UFG A;  2X68 A;  2IC6 A;  5CB4 E;  1E1H B;  3ZT5 A;  4F6R C;  5LJN A;  5AFU L;  3A5X A;  2G0U A;  2I6H A;  3E0Z A;  3RKO A;  1H7C A;  3AA6 B;  3CML A;  5EK3 A;  2UXN B;  2E9X A;  3RI5 A;  4YSZ A;  4GKJ T;  2V6X A;  4B3R T;  2XAQ B;  4IDP A;  2WM9 A;  1VOM A;  3OTO T;  5JR9 B;  2ACZ A;  4A5X A;  4A98 A;  3PUY F;  2VWA A;  5HCJ A;  3X1D A;  1R8I A;  3KVB A;  4P0B A;  1U5P A;  3UQ4 A;  5CJ5 A;  4GIW A;  3RYH E;  3DP7 A;  2LEH A;  4HFC A;  4UVC B;  4XAX B;  2CCQ A;  2V8S V;  3KIN B;  2BBJ A;  4GYS A;  3L39 A;  3K3Q C;  3ZMT B;  2XQ4 A;  3AE1 A;  5AQK B;  1AJ3 A;  4CXY A;  4L0R A;  4YSX A;  2IHR 1;  3C4W A;  5C2T A;  2LHN A;  3VHL A;  2UUC T;  3ZT6 A;  2X0L B;  4EZH A;  4V1A v;  3BQI A;  1LVF A;  1VCS A;  2LKH A;  3DJB A;  4WW0 A;  5AQR B;  3ZN1 B;  4EYY R;  5JRC A;  2K5B B;  4I0U A;  4EV6 A;  1XDO A;  1YW0 A;  4TV9 E;  4CN4 A;  2CXL A;  4LFB T;  2J1D G;  1D1B A;  2OLT A;  2YOE A;  3LFM A;  1IBK T;  1KF6 A;  1YKH B;  4U72 A;  5BR8 T;  2HN1 A;  3HL6 A;  5LHI B;  4U33 A;  1MIY A;  4KHZ F;  1NEN A;  3HKC E;  1M62 A;  4JYA T;  2EHO D;  2W4X A;  2ZM2 A;  4ILC A;  3Q5W A;  4WBO A;  4Z8X A;  3ZST A;  4ZS3 A;  2Q9Q C;  3PTR B;  4JI5 T;  1X9B A;  5ABH A;  1E7P A;  3C4X A;  4HEA A;  2WZI A;  2VL0 A;  2OA5 A;  5E0O A;  5J2U E;  5FXW A;  5JR9 C;  1J5E T;  4PK6 A;  2IW5 B;  2MOZ A;  4QH5 A;  3MKD A;  4KP3 C;  1NWM X;  2H88 A;  4X5T A;  2N2N A;  4CN1 A;  5FVL A;  4HGA A;  3PUG A;  4IL4 A;  4AQG A;  4JI8 T;  2K9A A;  2VKH A;  4DR4 T;  2JMK A;  2VK9 A;  3AAI A;  1HNZ T;  4AQY T;  2XQ5 A;  4TV8 E;  2QA7 A;  2HHH T;  4LF9 T;  4KI0 F;  4IE0 A;  4WNK A;  5JR9 A;  3ZCJ A;  1I6Z A;  4I4T E;  4GK5 E;  4U3C A;  3NRX A;  4X1I E;  5DQV A;  1U4Q A;  5F5W A;  3ZYM A;  3GWH A;  1UK5 A;  5AQS B;  5ABF A;  2E9X C;  2X0H A;  4ZOL E;  5L3D B;  4AKI A;  2CHO A;  5L2L A;  4JEH B;  3PJA J;  3ONJ A;  4JI1 T;  4UR9 A;  1ZEE A;  4DMW A;  3NWI A;  3QOF A;  3C50 A;  3JAE A;  4UXN B;  4EYU A;  3ZC1 A;  5LG4 A;  2MPK A;  2AXD S;  4X64 T;  4JI3 T;  4BJN A;  2KND A;  3MAC A;  4UVA B;  2XAH B;  4FJO A;  5HAX A;  2JRK A;  3UUX B;  3H3A A;  4DBQ A;  1S35 A;  1FIO A;  4DVD A;  2X9Y A;  3F31 A;  2W61 A;  2YKS A;  4ZI7 E;  1Y64 B;  4X65 T;  5FL1 A;  3N2O A;  3HR0 A;  2ZM0 A;  5HEJ A;  3BQL A;  3ZKR A;  4DO0 A;  1YQ3 A;  2GK9 A;  2XPK A;  3EVY A;  4OYJ A;  2J62 A;  1UGO A;  1ZV4 X;  2LSY A;  4YTP A;  2RP4 A;  3O1H A;  4I43 B;  2J4G A;  3CPZ A;  4QXC B;  4HFH A;  2DCF A;  2PBI A;  3FXD B;  3J7Y q;  2DWK A;  3JAF A;  4LF6 T;  3FZM B;  1Y01 A;  2WWU A;  2Q9Q A;  3A8Y C;  3BK9 A;  4U2Z A;  2YEV C;  2UXC T;  2X67 A;  2LHR A;  4H9Q C;  2LSG A;  3ZSS A;  1T8B A;  4YHH T;  1Z0P A;  2XAF B;  1M7K A;  4AKL A;  3ETU A;  3F57 A;  2D9D A;  1SUM B;  2YU1 A;  1O3X A;  4H63 H;  2JQQ A;  3BQK A;  3KDS E;  4QH4 A;  4ZZB A;  3VKG A;  5JVD E;  3RYC E;  5LBQ B;  2Y6X A;  3P4W A;  4YJ2 E;  3ESL A;  3VRA A;  4NXM T;  3JC6 D;  5LYJ E;  3PU8 A;  3FBZ A;  3AXJ B;  4ASK A;  3O4X E;  1HX8 A;  2BG9 A;  2DWG A;  2YN6 A;  3LK3 B;  2VQF T;  1IJ5 A;  2XHE B;  4EOZ B;  5CA0 E;  2VUR A;  3I9W A;  3RIU A;  3AAE B;  4HFB A;  2VVS A;  4N78 D;  4X1K E;  5F8P A;  3UU4 A;  2XSA A;  5AQF B;  3K3N A;  4IGU A;  1MMG A;  4IHJ E;  5L4E A;  2MBG A;  3L3P A;  2KLQ A;  4O4H E;  5LA6 E;  1JNZ A;  2K24 A;  3HI2 A;  4DR2 T;  1WRD A;  2FJD A;  3AA1 B;  2XQ9 A;  3VRB A;  3O1J A;  2DI4 A;  4PK5 A;  2LE8 A;  3N2G E;  5LGN B;  2K48 A;  2V6Y B;  3PE0 A;  4B6X A;  4TZ4 C;  2BBH A;  4WZX A;  3KV5 A;  4H9O C;  5AQJ B;  4COF A;  4ISS A;  2BZB A;  2RA1 A;  4KX6 A;  4O2B E;  4TN7 B;  2NW9 A;  3T8O A;  5IWA T;  3KVA A;  4K0U A;  5FVK A;  2P9B A;  4P1N A;  1XNR T;  3CKD A;  3P4P A;  3AEA A;  1UUR A;  4ILB A;  1YXR A;  2FJA A;  1OWA A;  2ZMA A;  4IE7 A;  3MK7 C;  2L8K A;  1KNR A;  3KBU A;  3FB2 A;  1LVK A;  5JRE A;  5ABG A;  5HXS A;  2AE9 A;  4ZZC A;  3ZT7 A;  4DV7 T;  5C3J A;  1FMV A;  1IBM T;  3Q9D A;  3N2K E;  1J5W A;  3AE3 A;  3FHN A;  4DR7 T;  4U31 A;  5EK4 A;  5H6Q B;  2H7V C;  3AE9 A;  3C64 A;  2L9Q A;  3LSV A;  4DV2 T;  4O4L E;  3AE4 A;  1YQ4 A;  3AVS A;  2LSK A;  2F4V T;  2CLY B;  2A2F X;  3ZJ1 A;  4HFV A;  3I1A A;  4HWI B;  5KDM C;  1ZHC A;  4DV5 T;  4YHJ A;  4H63 V;  2VQE T;  1HNX T;  4O8S A;  5LGU B;  2KMF A;  4IT4 A;  4LF4 T;  2YDS A;  3L8R A;  1L0V A;  1W9R A;  4QKN A;  4CI3 B;  3PUW F;  3Q5X A;  3P4Q A;  4NPP A;  3EHZ A;  3TLW A;  3K3O A;  1W09 A;  4DV6 T;  1BR2 A;  2V5D A;  3ZC0 A;  4JI7 T;  2FJB A;  3AEC A;  2X51 A;  3CQG B;  4ILU A;  4UEM A;  2ZM8 A;  3CIR A;  2BKP A;  3RQW A;  4KMC A;  5LMU T;  2V7K A;  5L3F B;  2CWO A;  2WZH A;  4H9P C;  3OPC A;  5IYZ E;  2VKJ A;  3ABV A;  1JNR A;  1HCI A;  3RLF F;  1T72 A;  5LB7 B;  2I0M A;  4FI5 A;  3H37 A;  3UUN A;  1D0X A;  4E7S A;  2D5U A;  5LXT E;  2CWY A;  1KNP A;  4F8H A;  2XQ6 A;  1N33 T;  3JCF A;  5DQW A;  5J2T E;  4O2A E;  3NVO A;  3P50 A;  3SOL A;  3GA8 A;  4AXP A;  4DUY T;  3FZF B;  3QK6 A;  3SRZ A;  1WYB A;  2PG8 A;  2K3W A;  2EHO A;  4X62 T;  1S94 A;  1LKX A;  2W62 A;  4AKG A; 
#chains in the Genus database with same CATH homology
 2V8S V;  2QYW A;  3ONJ A;  1VCS A;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...