1VCSA

Solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
GSSGSSGEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Vesicle transport through interaction with t-SNAREs homolog
total genus 30
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 1vcsA00
3ONLC 2QYWA 3ONJA 2V8SV 1VCSA
chains in the Genus database with same CATH superfamily
4TX5A 5L3GB 3RIUC 2BG9C 4QX8B 5HXCA 3TLSA 4DR1T 5JRCB 2X66A 2XAGB 1HS7A 3VRBA 3X1DA 4Z91A 4IDNA 2J62A 2N2NA 2JPFA 3RYFE 3CWZB 2WS3A 4PJNA 4ISSA 5DQVA 3L09A 4IGUA 4PJJA 3FB2A 4L9IA 3AXJB 2CXFA 1UUSA 2E9XA 3C4WA 2E5VA 4HFVA 4CQIA 2JQQA 2YDSA 4C91A 2KMFA 1FJGT 2BBJA 3DP7A 1FMWA 4QXBB 4IE4A 4PK5A 3UQ4A 2YDRA 3I0OA 4AXPA 1AJ3A 3GN5B 2A3DA 3QNUA 5BR8T 5DJQC 3VR9A 3O1IA 2X9HA 2BDEA 2LSKA 2W63A 4DR4T 4DR2T 1SUMB 4ZZBA 2LSGA 4U74A 1U5PA 2C5KT 3FHNA 3N2OA 5AQJB 3RYIE 5IYZE 1NEKA 5HEJA 2LSJA 2A9UA 1Z8UA 2LKHA 2RPAA 2V7IA 4HWHA 4FI5A 2MYSA 2KWIB 4IREA 1OWAA 3QB5A 1JNRA 2IIUA 2XPKA 4LF8T 4IDZA 4I4TE 1UX5A 5ABFA 4O8SA 4P0BA 2VK9A 3FBLA 2WP9A 4YTNA 1N36T 1W9RA 2G0UA 3IEEA 4Z8XA 3IBPA 3EDUA 2K48A 1UURA 3H37A 3A5XA 2WAUA 4AKGA 4ILCA 4UVAB 4LFCT 1WLXA 2OLTA 3BQKA 3IHRA 1GQEA 2UUBT 2HH7A 3CX8B 2NOXA 4I43B 1NWMX 5KXJA 5CB4E 5LP6E 1XDOA 3NBXX 2ACXA 2NW8A 5AQIB 2CMRA 3N2KE 4QHOA 3NZQA 2N9DA 2V6YA 3AE5A 4NUUA 3ZC1A 4YSXA 4DBQA 4M1PA 1G8XA 2EHOB 2C0SA 4XAXB 1HTJF 5DQWA 4JBWF 3HR0A 3N9MA 4MHCA 2W67A 3UT5E 2CHOA 3LJCA 3K8PC 5F3JA 4JV5T 2E9XB 2V7KA 3K3NA 5HCMA 4ZI2D 3G06A 5CJ5A 1MIYA 5L3FB 4BA9A 4HFEA 3LK2B 1J5WA 3ZYLA 5C8YE 2UUAT 2OV9A 3J7Yq 4NUVA 4TNVA 2WDRA 2HHHT 2UU9T 2NW7A 1HCIA 3TKLB 2KNDA 4V1Av 2Q9QD 4IIJE 4WBOA 4QXCB 3U3IA 1XWMA 3M3ZB 4YT0A 5HXHA 2ZM6T 4EEBA 1U4QA 2LKGA 5C2TA 3BK9A 1W0BA 2VASA 5JVDE 2W61A 5FMNA 5LHIB 1Z0PA 2VKOA 5L3BB 3RC8A 1G73A 5CA0E 5CGMA 1R8IA 3AVSA 3NWIA 3ZSSA 4LF7T 3C4ZA 5HEOA 4DR3T 2XQ8A 3LK3B 4TZ4C 1B7TA 4EEDA 2CBIA 3VR8A 3I9WA 3KBUA 3PUVF 4OX9T 2CRBA 3ZC0A 3VKHA 4IHJE 4OYJA 1KEYA 3AAAB 2X9XA 1ZHCA 4X5TA 5FVLA 4TUYE 2Y8DA 5AQMB 4YY3T 4WZXA 3RQUA 4HWCA 3OYZA 5F8PA 5FY0A 4ADZA 4DBRA 1T7SA 1YXRA 2LEHA 4LMLA 2XM1A 5H6RB 3AE4A 4TV8E 2V26A 2YN6A 4Z90A 2XQ4A 4PJLA 1FEWA 4DO0A 1N32T 2WZHA 5JDLA 3JCFA 4CXYA 2WWUA 2XQ9A 3ZMTB 3HL6A 3ZLIA 4B3TT 2JJ9A 2X68A 2DCFA 5FKYA 2HPLA 2MBGA 3EI0A 2DHRA 2LRLA 2VKJA 2I0MA 3GN5A 4F8HA 4E7SA 4YJ2E 4QH1A 5AQFB 1IBMT 3PU8A 2BKNA 5J0ZA 3QUJA 1MNDA 3FXEB 4PAGA 4I0UA 1UCUA 2XQ6A 2WM9A 1ZOYA 4NPPA 1QUUA 2QRXA 3TLVA 2VWAA 2E9XD 3QK6A 3KV9A 1HNWT 1MMDA 3PURA 2XSAA 1IZNB 1D0XA 2LM9A 3K1SA 2KT9A 3Q5WA 4I55E 2ZM0A 4A98A 2VQET 2UXXB 1N34T 1YD8G 3EAMA 4MLKA 5L4HA 4NXMT 1IAPA 5TAOA 2NTYA 2XTLA 3AA6B 5LGNB 1JNZA 5FNVE 5J2TE 5AQLB 2UXBT 1WCRA 2VL0A 4TN7B 4JEUB 4O4JE 3JAEA 1J1JA 2YOEA 3ZMVB 3K3OA 4KP3C 1T8BA 4CN1A 1V9DA 5EK4A 2D0UA 1UGOA 3HA4A 2QA7A 3CKDA 4HWIB 3RPUA 4YLHA 5AQRB 5KX5E 5IHYA 4B3ST 4ZOLE 4EZ4A 3RIAA 4A56A 2KINB 1YW0A 3O1HA 3ZEFB 2A2FX 3O4XE 3OJAA 5FL1A 2LHRA 4XBFB 2WQYA 3EUHA 5JDFA 1CHUA 2LJLA 2MOZA 3AXJA 3CIRA 3LBXB 3UU8A 2X9YA 4JYAT 1DU2A 4X66T 1LVKA 2H88A 1WYBA 3OPCA 4HTEA 2F4VT 3CQCB 4UV9B 4WNKA 3Q2MA 2CWYA 3B5MA 3KV4A 2YU2A 4X20E 4EV6A 2I6HA 3N9PA 2J47A 3PUQA 5LGTB 3C98B 5J2UE 4AQFC 1J5ET 5JR9B 5HWYA 2CLYC 3ZJ1A 5E0OA 4QKNA 1MMNA 3H3AA 4PJMA 3UFGA 4H9PC 2M6IA 4COFA 1BR2A 5FVKA 2UUCT 4DV4T 1T72A 2CXLA 2WZIA 4BJNA 4YXDA 2WMNA 3I9YA 2J4GA 4OHFA 2DNXA 3S4UA 4LMJA 2YEVC 3NRYA 1IJ5A 5AQVB 3KBTA 3AE7A 3P8CD 2BS4A 2R6GF 2C5JA 3E0ZA 3FZHB 2V6YB 3UTKA 5HXSA 2XAFB 4EB6E 4HFDA 1E2AA 2WDVA 3C4XA 3VU7H 3GWHA 4ZS2A 3PUAA 4BAYB 1WR0A 5L3EB 2WU5A 1O3XA 2VVSA 3PE0A 4HGAA 3J9X1 1KK7A 1HX1B 2IW5B 3L8RA 5JR9C 3F57A 5LG3A 4H63H 4TWDA 4DUYT 2AE9A 3ZJ2A 4AKRB 4WBNE 4U7IA 4ZHQE 5AQKB 3RF1A 5ABFB 1OEDB 2L8KA 4UELA 5LYJE 5L4EA 2XQ5A 4X65T 2NW9A 3O9XA 1MIVA 3A7MA 3ZMZB 4AQGA 1D0YA 4UVCB 2HN2A 3CPZA 2XJ7A 3MZKB 3ZN0B 5HAXA 5M4YA 2WDQA 3UFEA 5JDQA 4B3RT 4QXHB 4KUMB 1T98A 2NWBA 2CE7A 3CMLA 4CZZB 4CI3B 4HFIA 2LSYA 1XMOT 1HNZT 2V5DA 2H7OA 2BS2A 4AISA 4O2BE 1KNPA 4WYVA 1S35A 4G2AA 4NXNT 4B3MT 3H3MA 1Y64B 5AFUL 4HWDA 3ZSTA 1M62A 5LMNT 3CQGB 3T1YT 4JI0T 3FZFB 1YKHB 1X79A 2RA1A 3E08A 1QLBA 4NIQA 4TWHA 3Q5EA 3ZT5A 4ZI7E 5LMUT 2CWOA 2YU1A 3OTOT 3P4QA 1HNXT 4K0KT 4QH5A 5ADXL 3VHLA 5AQSB 5IUXA 2Y48B 3K3QC 4KI0F 5LA6E 1BR4A 3CVRA 2E9XC 2ZM8A 3EABA 4X1IE 4UF0A 4H9RC 2UXNB 1LKXA 1SA0E 3AVRA 5JDMA 2KXPB 4DUZT 4JI7T 2X51A 3LFMA 2PBIA 2MTQA 4CXXA 3RKOA 4PNIA 4UV8B 2WWVA 2I59A 2NTXA 3PUSA 2K5BB 3TLTA 1XZYA 2VQFT 3AE3A 3UU5A 2E2AA 1OXZA 1QSDA 3AB3B 3BQIA 4L5GA 5FXXA 3ZMSB 4EGWA 5FL0A 4B6XA 1D1BA 4UF0B 4ANJA 1UK5A 3CQXC 3UU4A 3LK42 1FMVA 2PJQA 2XQAA 3P50A 4DV2T 3OKQA 1I94T 3D0TA 4X62T 3RGLA 3VRAA 2A72A 2BVLA 5ETWA 5JDHA 1NAFA 1WRDA 2LT3A 4IT4A 2SPCA 4JEHB 4YSYA 3FXDB 2BS3A 3RIUA 4DMVA 2XQ3A 1D0ZA 2BBHA 4EYYR 3NZPA 1L0VA 1HR0T 2DLRA 2XQ7A 2CXDA 3ONLC 2Y6XA 4DV6T 4DNDA 4DV0T 3IA3A 4U7YA 4X64T 3ZCJA 2IC6A 3E22E 3PUWF 4H9NC 4K0UA 4CI1B 2V8SV 5L47A 3SFEA 2K3WA 3P4WA 4G63A 4PK6A 3SS1A 3FZMB 4FJOA 1EZ3A 3HI2A 1ZP0A 3RIFA 4DIDB 1MIWA 2X0HA 2X0YA 3ZN1B 3KDSE 3HKDE 3JADA 5JTGA 5FP3A 4IDQA 5F5WA 5FY1A 4XZCA 4EAHA 4DVDA 3QB5K 2IUBA 3TLWA 5KMGP 5FY7A 3KVBA 4GK0E 1M7KA 4BJMA 4LF4T 4DV3T 1W0AA 3OVUA 5LHHB 2Q9QC 3PDYA 1IBLT 2GK9A 2BG9E 2DI4A 4UIGA 1E7PA 4DR6T 1S94A 2WMOA 3TLUA 1VCTA 3AA7B 3AEDA 2BKPA 3N9QA 4LFAT 1WR6A 2ODVA 4ILBA 4ERRA 3B57A 4MFRA 4QX7B 4GKKT 4HEAA 1UX4A 5HCJA 3CX7B 4CN6A 4GOUA 3EHZA 2M6BA 4ISTA 4GYRA 2LOSA 3CX6B 2CHNA 3NVOA 3NRXA 2JRKA 3O1JA 3Q5DA 3P4SA 2DL1A 4JI2T 3HKEE 4GIWA 2W66A 4ZI3D 1XNQT 4F6RC 3N9LA 5AQHB 2EHOD 2CBJA 3GMIA 5LJNA 3MK7C 4HFBA 3ONXA 4YTPA 5HYAA 3ZMUB 4ASKA 1OEDC 2V1DB 3V5SA 1XMQT 2XY8B 2YINA 2XHEB 2Q9QB 4WW0A 3WI3A 1OEDE 2FUPA 2IAKA 2PFVA 3ETVA 3IF8B 3AAIA 3L3PA 2D5UA 4TV9E 2ZLYA 1N33T 3VKGA 3UUMA 2KLQA 3RH3A 5H6QB 4MBQA 2JMKA 4CXWA 2WY2A 3GA8A 3L39A 4LFBT 4U2ZA 1ZKEA 4EXTA 4KMCA 4Q25A 3RKGA 2KWHA 3I0QA 5LNKA 2CPTA 1KFYA 2IHR1 2EHOC 4YSZA 4HFCA 2D9DA 4ZEYA 3UU6A 4DV1T 4KX6A 5LB7B 2JQHA 2WCAA 1MMAA 2KZ7B 4N78D 1BR1A 4AKHA 3P4PA 3N9NA 1D1CA 4IE5A 5EK2A 3HKBE 4ZI2C 2VKHA 5EZYE 5FXVA 3F31A 4C90A 2VB6A 2M67A 2LRKA 2CA5A 4O2AE 5HXEA 2ZM2A 5FXWA 4U33A 4YJ3E 4X1KE 3AEAA 3C64A 5JDNA 3UUNA 4AKLA 4P0AA 1X9BA 2ES0A 2W2UA 4AQFA 2CCQA 1CUNA 3AAEB 3AE2A 2AXDS 2QYWA 2HPJA 2LE8A 2K24A 4AQYT 1KNRA 3MJXA 5AQQB 5ABHA 4A5XA 4GKJT 2H3RA 5HEHA 4JLEA 3RRCA 1H7CA 2DWGA 3AE1A 4TWFA 3RX6A 2L3LA 5CA1E 4PW8A 3QOFA 4JI5T 1I6ZA 1MNEA 4CI2B 5LXTE 3PJAJ 3LSVA 3SRZA 3SWHA 4IDPA 2PTFA 2IMLA 4EYUA 2LLYA 2X9WA 2VKDA 3KV6A 5ABEA 2LSIA 4H9QC 1IJ6A 1LRZA 2E8IA 2V6XA 3ESLA 3NKZA 1XNRT 4OFZA 3MACA 4U3CA 3KV5A 3RHWA 3RYCE 4PK4A 4ILUA 5AQOB 5LGUB 5L2LA 4H9OC 2N1GA 4O4IE 1FIOA 4PFPA 4PFOA 3AEGA 3ETUA 4HKAA 5JH7E 3ABVA 2X67A 2X0LB 2XAHB 3N5LA 4YTMA 2XUEA 2JQ9A 5J1GA 4JI4T 2KSRA 2V5CA 3MKDA 4CN4A 5LHGB 3PJAA 1D1AA 3OBVE 3V5UA 1W09A 1Y01A 2RP4A 1SE7A 3FBZA 3AEBA 2WB5A 4ILAA 3SFDA 3ZKRA 2LHNA 3WAJA 3ANWA 4LMKA 2OA5A 2WBLA 5LJMA 2IDOB 4MALA 2CEAA 1HF8A 3UQ7A 3N2GE 3HKCE 2J1DG 2FBWA 2D2SA 5KDMC 3I1AA 3AA0B 3AEFA 3JC6C 4LF9T 1US7B 3PU3A 4AI6A 5GONE 4DV5T 4JI1T 5LG4A 4I50E 2XZEA 3PUZF 4IL9A 4QH4A 1HX8A 2JQKA 4J2CA 4OK0A 4ZI3C 3M65A 5L3CB 4O4HE 3PTRB 4HFHA 4YHJA 3B13A 3CK6A 2XM2A 3LG7A 3N9OA 3PV0F 3Q9DA 5JR9A 4JI8T 4HWFA 2YKSA 4IDOA 4EZHA 4TNWA 2Q9QA 4UR9A 5C3JA 1HG2A 5LOVE 2NR4A 2H89A 5HWXA 4KHZF 3Q5XA 4KBMB 3P4RA 1HG5A 2NP9A 3ZCIA 1E1HB 1HFAA 2CLYB 3PUGA 4L0RA 4OYKA 4ZS3A 2JIWA 1MMGA 2VL8A 2W0GA 4QWNB 2Z6EA 2ACZA 3KVAA 2MAWA 3MXZA 5AQTB 2FJEA 3PUYF 5AQGB 3WAKA 3RYHE 4DR5T 2UXDT 2IC9A 3PUXF 3FZKB 5AQNB 2EHOA 3ZT6A 2JMHA 3C50A 2YDQA 5FYMA 2V7JA 4IL4A 4P09A 5HXRA 5LBMA 4LF5T 5EK3A 1ZEEA 4UEMA 2UXCT 2E5LT 2D0TA 2XAQB 3LDQB 3P7IA 3ZYKA 4A97A 4H9SE 3ONJA 1VRBA 2K9AA 4UVBB 4DMWA 3UUBA 2ODUA 3C51A 5CFBA 1VOMA 5L3DB 1OEDA 3AA1B 2BZBA 2C5IT 2MPKA 1XDPA 2XASB 4LF6T 5ABGA 4IE6A 3AE6A 4X1YE 4JI6T 5HEGA 1ZV4X 3T8OA 5A1LA 2LOPA 4UXNB 3OYXA 3ZYMA 2BG9A 2YK0A 3FZLB 4HN9A 4ZZCA 3F2EA 4HE8A 5JREA 4U31A 4JI3T 4JUYA 2V7MA 2B76A 2WSSV 2FJAA 2HN1A 4H63V 4GYSA 5DABA 3ZPOA 4YFSA 4E7ZA 3MA9A 2H7VC 2V7LA 3UUXB 2L9QA 1NENA 5JQGE 4YHHT 1KNZA 2BKOA 5LCYA 2FJBA 4AKIA 4GK5E 3QC9A 2QVAA 3RI5A 3RQWA 2W62A 3ZT7A 4EOZB 3DTOA 3R6NA 1YKEB 3UU3A 2XAJB 2BG9B 1IBKT 1YQ3A 2ZMAA 1VCSA 4U2YA 4IE0A 4AIUA 3UULA 2CM0A 3R84B 1WFDA 3RLFF 4O4LE 4EIWA 3U78A 3JAFA 1SHZC 3RC3A 3T1HT 2VURA 5BMVE 2W4XA 1LVFA 5IWAT 2QGSA 3LBXA 3AEEA 3EVYA 5HEUA 5JRCA 2FJDA 2BVMA 3RRWA 1WYCA 4DV7T 2B1EA 2P9BA 5LBQB 2W00A 3KFWX 5FXZA 4P1NA 4DR7T 4U72A 3BQLA 2WU2A 4KHPT 3EDVA 3AECA 4ZXLA 3SOLA 1YQ4A 5AQUB 2VVNA 2LM2A 2XQYA 3KINB 3W15B 5JDGA 2XSBA 3ANWB 3JC6D 2PG8A 3AE8A 1KF6A 3A8YC 4IE7A 2DWKA 1BR0A 5AQPB 3DJBA 3AE9A
chains in the Genus database with same CATH topology
3ONLC 2QYWA 3ONJA 2V8SV 1VCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2QYW A;  3ONJ A;  2V8S V;  1VCS A; 
#chains in the Genus database with same CATH topology
 4TX5 A;  5L3G B;  3RIU C;  2BG9 C;  4QX8 B;  5HXC A;  3TLS A;  4DR1 T;  5JRC B;  2X66 A;  2XAG B;  1HS7 A;  3VRB A;  3X1D A;  4Z91 A;  4IDN A;  2J62 A;  2N2N A;  2JPF A;  3RYF E;  3CWZ B;  2WS3 A;  4PJN A;  4ISS A;  5DQV A;  3L09 A;  4IGU A;  4PJJ A;  3FB2 A;  4L9I A;  3AXJ B;  2CXF A;  1UUS A;  2E9X A;  3C4W A;  2E5V A;  4HFV A;  4CQI A;  2JQQ A;  2YDS A;  4C91 A;  2KMF A;  1FJG T;  2BBJ A;  3DP7 A;  1FMW A;  4QXB B;  4IE4 A;  4PK5 A;  3UQ4 A;  2YDR A;  3I0O A;  4AXP A;  1AJ3 A;  3GN5 B;  2A3D A;  3QNU A;  5BR8 T;  5DJQ C;  3VR9 A;  3O1I A;  2X9H A;  2BDE A;  2LSK A;  2W63 A;  4DR4 T;  4DR2 T;  1SUM B;  4ZZB A;  2LSG A;  4U74 A;  1U5P A;  2C5K T;  3FHN A;  3N2O A;  5AQJ B;  3RYI E;  5IYZ E;  1NEK A;  5HEJ A;  2LSJ A;  2A9U A;  1Z8U A;  2LKH A;  2RPA A;  2V7I A;  4HWH A;  4FI5 A;  2MYS A;  2KWI B;  4IRE A;  1OWA A;  3QB5 A;  1JNR A;  2IIU A;  2XPK A;  4LF8 T;  4IDZ A;  4I4T E;  1UX5 A;  5ABF A;  4O8S A;  4P0B A;  2VK9 A;  3FBL A;  2WP9 A;  4YTN A;  1N36 T;  1W9R A;  2G0U A;  3IEE A;  4Z8X A;  3IBP A;  3EDU A;  2K48 A;  1UUR A;  3H37 A;  3A5X A;  2WAU A;  4AKG A;  4ILC A;  4UVA B;  4LFC T;  1WLX A;  2OLT A;  3BQK A;  3IHR A;  1GQE A;  2UUB T;  2HH7 A;  3CX8 B;  2NOX A;  4I43 B;  1NWM X;  5KXJ A;  5CB4 E;  5LP6 E;  1XDO A;  3NBX X;  2ACX A;  2NW8 A;  5AQI B;  2CMR A;  3N2K E;  4QHO A;  3NZQ A;  2N9D A;  2V6Y A;  3AE5 A;  4NUU A;  3ZC1 A;  4YSX A;  4DBQ A;  4M1P A;  1G8X A;  2EHO B;  2C0S A;  4XAX B;  1HTJ F;  5DQW A;  4JBW F;  3HR0 A;  3N9M A;  4MHC A;  2W67 A;  3UT5 E;  2CHO A;  3LJC A;  3K8P C;  5F3J A;  4JV5 T;  2E9X B;  2V7K A;  3K3N A;  5HCM A;  4ZI2 D;  3G06 A;  5CJ5 A;  1MIY A;  5L3F B;  4BA9 A;  4HFE A;  3LK2 B;  1J5W A;  3ZYL A;  5C8Y E;  2UUA T;  2OV9 A;  3J7Y q;  4NUV A;  4TNV A;  2WDR A;  2HHH T;  2UU9 T;  2NW7 A;  1HCI A;  3TKL B;  2KND A;  4V1A v;  2Q9Q D;  4IIJ E;  4WBO A;  4QXC B;  3U3I A;  1XWM A;  3M3Z B;  4YT0 A;  5HXH A;  2ZM6 T;  4EEB A;  1U4Q A;  2LKG A;  5C2T A;  3BK9 A;  1W0B A;  2VAS A;  5JVD E;  2W61 A;  5FMN A;  5LHI B;  1Z0P A;  2VKO A;  5L3B B;  3RC8 A;  1G73 A;  5CA0 E;  5CGM A;  1R8I A;  3AVS A;  3NWI A;  3ZSS A;  4LF7 T;  3C4Z A;  5HEO A;  4DR3 T;  2XQ8 A;  3LK3 B;  4TZ4 C;  1B7T A;  4EED A;  2CBI A;  3VR8 A;  3I9W A;  3KBU A;  3PUV F;  4OX9 T;  2CRB A;  3ZC0 A;  3VKH A;  4IHJ E;  4OYJ A;  1KEY A;  3AAA B;  2X9X A;  1ZHC A;  4X5T A;  5FVL A;  4TUY E;  2Y8D A;  5AQM B;  4YY3 T;  4WZX A;  3RQU A;  4HWC A;  3OYZ A;  5F8P A;  5FY0 A;  4ADZ A;  4DBR A;  1T7S A;  1YXR A;  2LEH A;  4LML A;  2XM1 A;  5H6R B;  3AE4 A;  4TV8 E;  2V26 A;  2YN6 A;  4Z90 A;  2XQ4 A;  4PJL A;  1FEW A;  4DO0 A;  1N32 T;  2WZH A;  5JDL A;  3JCF A;  4CXY A;  2WWU A;  2XQ9 A;  3ZMT B;  3HL6 A;  3ZLI A;  4B3T T;  2JJ9 A;  2X68 A;  2DCF A;  5FKY A;  2HPL A;  2MBG A;  3EI0 A;  2DHR A;  2LRL A;  2VKJ A;  2I0M A;  3GN5 A;  4F8H A;  4E7S A;  4YJ2 E;  4QH1 A;  5AQF B;  1IBM T;  3PU8 A;  2BKN A;  5J0Z A;  3QUJ A;  1MND A;  3FXE B;  4PAG A;  4I0U A;  1UCU A;  2XQ6 A;  2WM9 A;  1ZOY A;  4NPP A;  1QUU A;  2QRX A;  3TLV A;  2VWA A;  2E9X D;  3QK6 A;  3KV9 A;  1HNW T;  1MMD A;  3PUR A;  2XSA A;  1IZN B;  1D0X A;  2LM9 A;  3K1S A;  2KT9 A;  3Q5W A;  4I55 E;  2ZM0 A;  4A98 A;  2VQE T;  2UXX B;  1N34 T;  1YD8 G;  3EAM A;  4MLK A;  5L4H A;  4NXM T;  1IAP A;  5TAO A;  2NTY A;  2XTL A;  3AA6 B;  5LGN B;  1JNZ A;  5FNV E;  5J2T E;  5AQL B;  2UXB T;  1WCR A;  2VL0 A;  4TN7 B;  4JEU B;  4O4J E;  3JAE A;  1J1J A;  2YOE A;  3ZMV B;  3K3O A;  4KP3 C;  1T8B A;  4CN1 A;  1V9D A;  5EK4 A;  2D0U A;  1UGO A;  3HA4 A;  2QA7 A;  3CKD A;  4HWI B;  3RPU A;  4YLH A;  5AQR B;  5KX5 E;  5IHY A;  4B3S T;  4ZOL E;  4EZ4 A;  3RIA A;  4A56 A;  2KIN B;  1YW0 A;  3O1H A;  3ZEF B;  2A2F X;  3O4X E;  3OJA A;  5FL1 A;  2LHR A;  4XBF B;  2WQY A;  3EUH A;  5JDF A;  1CHU A;  2LJL A;  2MOZ A;  3AXJ A;  3CIR A;  3LBX B;  3UU8 A;  2X9Y A;  4JYA T;  1DU2 A;  4X66 T;  1LVK A;  2H88 A;  1WYB A;  3OPC A;  4HTE A;  2F4V T;  3CQC B;  4UV9 B;  4WNK A;  3Q2M A;  2CWY A;  3B5M A;  3KV4 A;  2YU2 A;  4X20 E;  4EV6 A;  2I6H A;  3N9P A;  2J47 A;  3PUQ A;  5LGT B;  3C98 B;  5J2U E;  4AQF C;  1J5E T;  5JR9 B;  5HWY A;  2CLY C;  3ZJ1 A;  5E0O A;  4QKN A;  1MMN A;  3H3A A;  4PJM A;  3UFG A;  4H9P C;  2M6I A;  4COF A;  1BR2 A;  5FVK A;  2UUC T;  4DV4 T;  1T72 A;  2CXL A;  2WZI A;  4BJN A;  4YXD A;  2WMN A;  3I9Y A;  2J4G A;  4OHF A;  2DNX A;  3S4U A;  4LMJ A;  2YEV C;  3NRY A;  1IJ5 A;  5AQV B;  3KBT A;  3AE7 A;  3P8C D;  2BS4 A;  2R6G F;  2C5J A;  3E0Z A;  3FZH B;  2V6Y B;  3UTK A;  5HXS A;  2XAF B;  4EB6 E;  4HFD A;  1E2A A;  2WDV A;  3C4X A;  3VU7 H;  3GWH A;  4ZS2 A;  3PUA A;  4BAY B;  1WR0 A;  5L3E B;  2WU5 A;  1O3X A;  2VVS A;  3PE0 A;  4HGA A;  3J9X 1;  1KK7 A;  1HX1 B;  2IW5 B;  3L8R A;  5JR9 C;  3F57 A;  5LG3 A;  4H63 H;  4TWD A;  4DUY T;  2AE9 A;  3ZJ2 A;  4AKR B;  4WBN E;  4U7I A;  4ZHQ E;  5AQK B;  3RF1 A;  5ABF B;  1OED B;  2L8K A;  4UEL A;  5LYJ E;  5L4E A;  2XQ5 A;  4X65 T;  2NW9 A;  3O9X A;  1MIV A;  3A7M A;  3ZMZ B;  4AQG A;  1D0Y A;  4UVC B;  2HN2 A;  3CPZ A;  2XJ7 A;  3MZK B;  3ZN0 B;  5HAX A;  5M4Y A;  2WDQ A;  3UFE A;  5JDQ A;  4B3R T;  4QXH B;  4KUM B;  1T98 A;  2NWB A;  2CE7 A;  3CML A;  4CZZ B;  4CI3 B;  4HFI A;  2LSY A;  1XMO T;  1HNZ T;  2V5D A;  2H7O A;  2BS2 A;  4AIS A;  4O2B E;  1KNP A;  4WYV A;  1S35 A;  4G2A A;  4NXN T;  4B3M T;  3H3M A;  1Y64 B;  5AFU L;  4HWD A;  3ZST A;  1M62 A;  5LMN T;  3CQG B;  3T1Y T;  4JI0 T;  3FZF B;  1YKH B;  1X79 A;  2RA1 A;  3E08 A;  1QLB A;  4NIQ A;  4TWH A;  3Q5E A;  3ZT5 A;  4ZI7 E;  5LMU T;  2CWO A;  2YU1 A;  3OTO T;  3P4Q A;  1HNX T;  4K0K T;  4QH5 A;  5ADX L;  3VHL A;  5AQS B;  5IUX A;  2Y48 B;  3K3Q C;  4KI0 F;  5LA6 E;  1BR4 A;  3CVR A;  2E9X C;  2ZM8 A;  3EAB A;  4X1I E;  4UF0 A;  4H9R C;  2UXN B;  1LKX A;  1SA0 E;  3AVR A;  5JDM A;  2KXP B;  4DUZ T;  4JI7 T;  2X51 A;  3LFM A;  2PBI A;  2MTQ A;  4CXX A;  3RKO A;  4PNI A;  4UV8 B;  2WWV A;  2I59 A;  2NTX A;  3PUS A;  2K5B B;  3TLT A;  1XZY A;  2VQF T;  3AE3 A;  3UU5 A;  2E2A A;  1OXZ A;  1QSD A;  3AB3 B;  3BQI A;  4L5G A;  5FXX A;  3ZMS B;  4EGW A;  5FL0 A;  4B6X A;  1D1B A;  4UF0 B;  4ANJ A;  1UK5 A;  3CQX C;  3UU4 A;  3LK4 2;  1FMV A;  2PJQ A;  2XQA A;  3P50 A;  4DV2 T;  3OKQ A;  1I94 T;  3D0T A;  4X62 T;  3RGL A;  3VRA A;  2A72 A;  2BVL A;  5ETW A;  5JDH A;  1NAF A;  1WRD A;  2LT3 A;  4IT4 A;  2SPC A;  4JEH B;  4YSY A;  3FXD B;  2BS3 A;  3RIU A;  4DMV A;  2XQ3 A;  1D0Z A;  2BBH A;  4EYY R;  3NZP A;  1L0V A;  1HR0 T;  2DLR A;  2XQ7 A;  2CXD A;  3ONL C;  2Y6X A;  4DV6 T;  4DND A;  4DV0 T;  3IA3 A;  4U7Y A;  4X64 T;  3ZCJ A;  2IC6 A;  3E22 E;  3PUW F;  4H9N C;  4K0U A;  4CI1 B;  2V8S V;  5L47 A;  3SFE A;  2K3W A;  3P4W A;  4G63 A;  4PK6 A;  3SS1 A;  3FZM B;  4FJO A;  1EZ3 A;  3HI2 A;  1ZP0 A;  3RIF A;  4DID B;  1MIW A;  2X0H A;  2X0Y A;  3ZN1 B;  3KDS E;  3HKD E;  3JAD A;  5JTG A;  5FP3 A;  4IDQ A;  5F5W A;  5FY1 A;  4XZC A;  4EAH A;  4DVD A;  3QB5 K;  2IUB A;  3TLW A;  5KMG P;  5FY7 A;  3KVB A;  4GK0 E;  1M7K A;  4BJM A;  4LF4 T;  4DV3 T;  1W0A A;  3OVU A;  5LHH B;  2Q9Q C;  3PDY A;  1IBL T;  2GK9 A;  2BG9 E;  2DI4 A;  4UIG A;  1E7P A;  4DR6 T;  1S94 A;  2WMO A;  3TLU A;  1VCT A;  3AA7 B;  3AED A;  2BKP A;  3N9Q A;  4LFA T;  1WR6 A;  2ODV A;  4ILB A;  4ERR A;  3B57 A;  4MFR A;  4QX7 B;  4GKK T;  4HEA A;  1UX4 A;  5HCJ A;  3CX7 B;  4CN6 A;  4GOU A;  3EHZ A;  2M6B A;  4IST A;  4GYR A;  2LOS A;  3CX6 B;  2CHN A;  3NVO A;  3NRX A;  2JRK A;  3O1J A;  3Q5D A;  3P4S A;  2DL1 A;  4JI2 T;  3HKE E;  4GIW A;  2W66 A;  4ZI3 D;  1XNQ T;  4F6R C;  3N9L A;  5AQH B;  2EHO D;  2CBJ A;  3GMI A;  5LJN A;  3MK7 C;  4HFB A;  3ONX A;  4YTP A;  5HYA A;  3ZMU B;  4ASK A;  1OED C;  2V1D B;  3V5S A;  1XMQ T;  2XY8 B;  2YIN A;  2XHE B;  2Q9Q B;  4WW0 A;  3WI3 A;  1OED E;  2FUP A;  2IAK A;  2PFV A;  3ETV A;  3IF8 B;  3AAI A;  3L3P A;  2D5U A;  4TV9 E;  2ZLY A;  1N33 T;  3VKG A;  3UUM A;  2KLQ A;  3RH3 A;  5H6Q B;  4MBQ A;  2JMK A;  4CXW A;  2WY2 A;  3GA8 A;  3L39 A;  4LFB T;  4U2Z A;  1ZKE A;  4EXT A;  4KMC A;  4Q25 A;  3RKG A;  2KWH A;  3I0Q A;  5LNK A;  2CPT A;  1KFY A;  2IHR 1;  2EHO C;  4YSZ A;  4HFC A;  2D9D A;  4ZEY A;  3UU6 A;  4DV1 T;  4KX6 A;  5LB7 B;  2JQH A;  2WCA A;  1MMA A;  2KZ7 B;  4N78 D;  1BR1 A;  4AKH A;  3P4P A;  3N9N A;  1D1C A;  4IE5 A;  5EK2 A;  3HKB E;  4ZI2 C;  2VKH A;  5EZY E;  5FXV A;  3F31 A;  4C90 A;  2VB6 A;  2M67 A;  2LRK A;  2CA5 A;  4O2A E;  5HXE A;  2ZM2 A;  5FXW A;  4U33 A;  4YJ3 E;  4X1K E;  3AEA A;  3C64 A;  5JDN A;  3UUN A;  4AKL A;  4P0A A;  1X9B A;  2ES0 A;  2W2U A;  4AQF A;  2CCQ A;  1CUN A;  3AAE B;  3AE2 A;  2AXD S;  2QYW A;  2HPJ A;  2LE8 A;  2K24 A;  4AQY T;  1KNR A;  3MJX A;  5AQQ B;  5ABH A;  4A5X A;  4GKJ T;  2H3R A;  5HEH A;  4JLE A;  3RRC A;  1H7C A;  2DWG A;  3AE1 A;  4TWF A;  3RX6 A;  2L3L A;  5CA1 E;  4PW8 A;  3QOF A;  4JI5 T;  1I6Z A;  1MNE A;  4CI2 B;  5LXT E;  3PJA J;  3LSV A;  3SRZ A;  3SWH A;  4IDP A;  2PTF A;  2IML A;  4EYU A;  2LLY A;  2X9W A;  2VKD A;  3KV6 A;  5ABE A;  2LSI A;  4H9Q C;  1IJ6 A;  1LRZ A;  2E8I A;  2V6X A;  3ESL A;  3NKZ A;  1XNR T;  4OFZ A;  3MAC A;  4U3C A;  3KV5 A;  3RHW A;  3RYC E;  4PK4 A;  4ILU A;  5AQO B;  5LGU B;  5L2L A;  4H9O C;  2N1G A;  4O4I E;  1FIO A;  4PFP A;  4PFO A;  3AEG A;  3ETU A;  4HKA A;  5JH7 E;  3ABV A;  2X67 A;  2X0L B;  2XAH B;  3N5L A;  4YTM A;  2XUE A;  2JQ9 A;  5J1G A;  4JI4 T;  2KSR A;  2V5C A;  3MKD A;  4CN4 A;  5LHG B;  3PJA A;  1D1A A;  3OBV E;  3V5U A;  1W09 A;  1Y01 A;  2RP4 A;  1SE7 A;  3FBZ A;  3AEB A;  2WB5 A;  4ILA A;  3SFD A;  3ZKR A;  2LHN A;  3WAJ A;  3ANW A;  4LMK A;  2OA5 A;  2WBL A;  5LJM A;  2IDO B;  4MAL A;  2CEA A;  1HF8 A;  3UQ7 A;  3N2G E;  3HKC E;  2J1D G;  2FBW A;  2D2S A;  5KDM C;  3I1A A;  3AA0 B;  3AEF A;  3JC6 C;  4LF9 T;  1US7 B;  3PU3 A;  4AI6 A;  5GON E;  4DV5 T;  4JI1 T;  5LG4 A;  4I50 E;  2XZE A;  3PUZ F;  4IL9 A;  4QH4 A;  1HX8 A;  2JQK A;  4J2C A;  4OK0 A;  4ZI3 C;  3M65 A;  5L3C B;  4O4H E;  3PTR B;  4HFH A;  4YHJ A;  3B13 A;  3CK6 A;  2XM2 A;  3LG7 A;  3N9O A;  3PV0 F;  3Q9D A;  5JR9 A;  4JI8 T;  4HWF A;  2YKS A;  4IDO A;  4EZH A;  4TNW A;  2Q9Q A;  4UR9 A;  5C3J A;  1HG2 A;  5LOV E;  2NR4 A;  2H89 A;  5HWX A;  4KHZ F;  3Q5X A;  4KBM B;  3P4R A;  1HG5 A;  2NP9 A;  3ZCI A;  1E1H B;  1HFA A;  2CLY B;  3PUG A;  4L0R A;  4OYK A;  4ZS3 A;  2JIW A;  1MMG A;  2VL8 A;  2W0G A;  4QWN B;  2Z6E A;  2ACZ A;  3KVA A;  2MAW A;  3MXZ A;  5AQT B;  2FJE A;  3PUY F;  5AQG B;  3WAK A;  3RYH E;  4DR5 T;  2UXD T;  2IC9 A;  3PUX F;  3FZK B;  5AQN B;  2EHO A;  3ZT6 A;  2JMH A;  3C50 A;  2YDQ A;  5FYM A;  2V7J A;  4IL4 A;  4P09 A;  5HXR A;  5LBM A;  4LF5 T;  5EK3 A;  1ZEE A;  4UEM A;  2UXC T;  2E5L T;  2D0T A;  2XAQ B;  3LDQ B;  3P7I A;  3ZYK A;  4A97 A;  4H9S E;  3ONJ A;  1VRB A;  2K9A A;  4UVB B;  4DMW A;  3UUB A;  2ODU A;  3C51 A;  5CFB A;  1VOM A;  5L3D B;  1OED A;  3AA1 B;  2BZB A;  2C5I T;  2MPK A;  1XDP A;  2XAS B;  4LF6 T;  5ABG A;  4IE6 A;  3AE6 A;  4X1Y E;  4JI6 T;  5HEG A;  1ZV4 X;  3T8O A;  5A1L A;  2LOP A;  4UXN B;  3OYX A;  3ZYM A;  2BG9 A;  2YK0 A;  3FZL B;  4HN9 A;  4ZZC A;  3F2E A;  4HE8 A;  5JRE A;  4U31 A;  4JI3 T;  4JUY A;  2V7M A;  2B76 A;  2WSS V;  2FJA A;  2HN1 A;  4H63 V;  4GYS A;  5DAB A;  3ZPO A;  4YFS A;  4E7Z A;  3MA9 A;  2H7V C;  2V7L A;  3UUX B;  2L9Q A;  1NEN A;  5JQG E;  4YHH T;  1KNZ A;  2BKO A;  5LCY A;  2FJB A;  4AKI A;  4GK5 E;  3QC9 A;  2QVA A;  3RI5 A;  3RQW A;  2W62 A;  3ZT7 A;  4EOZ B;  3DTO A;  3R6N A;  1YKE B;  3UU3 A;  2XAJ B;  2BG9 B;  1IBK T;  1YQ3 A;  2ZMA A;  1VCS A;  4U2Y A;  4IE0 A;  4AIU A;  3UUL A;  2CM0 A;  3R84 B;  1WFD A;  3RLF F;  4O4L E;  4EIW A;  3U78 A;  3JAF A;  1SHZ C;  3RC3 A;  3T1H T;  2VUR A;  5BMV E;  2W4X A;  1LVF A;  5IWA T;  2QGS A;  3LBX A;  3AEE A;  3EVY A;  5HEU A;  5JRC A;  2FJD A;  2BVM A;  3RRW A;  1WYC A;  4DV7 T;  2B1E A;  2P9B A;  5LBQ B;  2W00 A;  3KFW X;  5FXZ A;  4P1N A;  4DR7 T;  4U72 A;  3BQL A;  2WU2 A;  4KHP T;  3EDV A;  3AEC A;  4ZXL A;  3SOL A;  1YQ4 A;  5AQU B;  2VVN A;  2LM2 A;  2XQY A;  3KIN B;  3W15 B;  5JDG A;  2XSB A;  3ANW B;  3JC6 D;  2PG8 A;  3AE8 A;  1KF6 A;  3A8Y C;  4IE7 A;  2DWK A;  1BR0 A;  5AQP B;  3DJB A;  3AE9 A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2QYW A;  3ONJ A;  2V8S V;  1VCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...