1VCSA

Solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
GSSGSSGEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle transport through interaction with t-SNAREs homolog
publication title Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 30
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 1vcsA00
3ONLC 3ONJA 2QYWA 2V8SV 1VCSA
chains in the Genus database with same CATH superfamily
4ZS3A 5HCMA 4U2YA 5FL1A 2M6BA 4ZI2D 2V7LA 3GA8A 4LF7T 1U5PA 5JR9B 3NBXX 1SUMB 3AE9A 2I6HA 1MMGA 5KMGP 4B3RT 4JI2T 1WYBA 5JDFA 3LBXB 4O2BE 5DQVA 1VOMA 1H7CA 5ABEA 4CXYA 4XBFB 3BQKA 1E1HB 2LOPA 1WRDA 3DP7A 4X62T 1Z8UA 2V7IA 1KNZA 1HTJF 4DV1T 3V5UA 2LSYA 2DLRA 5LYJE 1QSDA 3W15B 2YEVC 2E9XB 3EUHA 4YY3T 3C51A 5FYMA 4WW0A 1XWMA 4N78D 2VWAA 4CQIA 1MNDA 4C91A 4ZXLA 4IE6A 3KV6A 1O3XA 2WZHA 3I1AA 1UCUA 4B3ST 4U3CA 2YKSA 1BR0A 2MBGA 3ZN0B 4IL9A 4ISSA 2WAUA 3L8RA 4IREA 2D0TA 5LGNB 2LJLA 3RC8A 2FJDA 4JBWF 3OBVE 4JI0T 4H9OC 4ANJA 5LBMA 2WMNA 4IDNA 2KWHA 2EHOD 4O4HE 4EYYR 1D1BA 2H7VC 4HWHA 5AQQB 3Q5XA 2LE8A 2W4XA 3AEEA 2V8SV 5CB4E 4UF0A 1BR1A 2NW9A 3ZCIA 3RYCE 2LSKA 2Q9QD 4UXNB 2IDOB 4YHJA 4PW8A 5ABFA 5C2TA 4HFHA 5AQRB 2IC6A 5JDQA 2UUBT 3NWIA 3AEAA 3ONJA 3BQIA 4YJ3E 4LF4T 1N34T 2IW5B 1JNRA 1N32T 2EHOC 3AE3A 3FHNA 3PUQA 4NIQA 5J2TE 4MFRA 3ZKRA 3VKGA 3FZFB 2F4VT 1OXZA 2XASB 4QXBB 3HKBE 5LB7B 5E0OA 3PJAJ 4LMJA 4M1PA 2Q9QC 1UGOA 5JREA 3N5LA 4YT0A 4P0BA 2E2AA 2V6XA 3SOLA 4WNKA 3RRWA 1LRZA 3JADA 4CI3B 3UFEA 1I94T 4IDOA 3X1DA 2K9AA 1JNZA 4WBNE 5IWAT 3LSVA 1SHZC 4OYJA 3N9MA 5HEHA 4X5TA 4PJMA 2XM2A 4ADZA 3ANWA 3C4ZA 5L2LA 3FBLA 3R6NA 5JR9C 2CA5A 3P8CD 5IUXA 2NW8A 2WDRA 4UF0B 4H63V 1MIWA 5FY1A 4AI6A 4P1NA 3IF8B 2VASA 5AFUL 4HFVA 1FMWA 5ABFB 4IE7A 2BS2A 3KVBA 4BA9A 2B76A 3CVRA 2L3LA 2I59A 3CIRA 5JH7E 1NWMX 5EK2A 5IYZE 2BKNA 4DUYT 3MACA 1YW0A 3ZT6A 4HE8A 1J1JA 5CA1E 4JI1T 1ZKEA 1Y01A 3KV4A 1S94A 3AE6A 2J4GA 1IJ5A 4I4TE 3BQLA 4KI0F 3UU8A 2W0GA 3ZT7A 3K1SA 4UEMA 2LKHA 1KFYA 4DBQA 3L09A 2BS3A 2XQ3A 2CEAA 4LF9T 2VB6A 4DUZT 2V6YA 4EB6E 3VR9A 3SFEA 2Y8DA 2NW7A 2V7MA 1YD8G 5F3JA 5AQTB 3UU3A 2B1EA 2IUBA 1UX5A 2X51A 3AEGA 3JAFA 1CUNA 2X9HA 4QWNB 5C3JA 2IC9A 2W63A 1ZOYA 2H3RA 4YSXA 2WDQA 3JCFA 4YSYA 4DV0T 3ANWB 3H37A 5LHIB 4TNVA 2R6GF 2KZ7B 4HFBA 2J62A 1VRBA 4LMKA 5DJQC 3JC6C 2X66A 2LEHA 3VKHA 2EHOA 2C5IT 2K5BB 3RPUA 3C50A 3PJAA 5LGTB 2QVAA 4CXWA 2KWIB 4PFOA 1B7TA 4DV2T 4L9IA 3AE2A 3UUNA 2Q9QA 4PJLA 2X68A 4QX7B 5AQNB 5L3EB 2NWBA 5HXHA 1AJ3A 5KX5E 1OWAA 4V1Av 3QC9A 3OPCA 2X0HA 2UXXB 3MZKB 4AISA 5JRCA 2OLTA 4AQGA 3TLVA 5HAXA 4EOZB 5LMNT 3AEBA 1HS7A 4DMWA 3KV9A 3AA7B 4HEAA 1KNPA 5DABA 4FI5A 2V6YB 3RIUC 2WY2A 3CPZA 4PNIA 4LF8T 4PFPA 4MHCA 3EABA 4TNWA 1HG5A 2DHRA 3NVOA 2LHNA 1HCIA 5FY0A 2BKOA 3K8PC 5FXWA 5LP6E 4LF6T 1R8IA 2DNXA 3FB2A 4U72A 2VKJA 5JQGE 2E5LT 1ZHCA 4DIDB 4EAHA 3PV0F 1DU2A 2DL1A 3GWHA 4L5GA 4XAXB 4QH1A 1FMVA 4O2AE 3RH3A 3N9OA 5AQUB 2EHOB 4HWIB 4YFSA 5ABHA 1J5WA 5JDGA 3L39A 2IMLA 2KNDA 1HFAA 3WAJA 5JVDE 2XTLA 3N2KE 2ACXA 2V1DB 4CI2B 2LT3A 5GONE 3PU3A 2Q9QB 2XZEA 5LHGB 3LDQB 2LRLA 3UQ4A 3NKZA 3T1HT 1XNRT 3DTOA 2DI4A 3RLFF 2WDVA 4NUUA 2BVLA 4B3MT 3RYHE 4GIWA 5JRCB 2VKDA 3O9XA 4DR2T 2X9WA 2MAWA 4TV9E 3CQCB 3PUYF 1FIOA 1W0AA 1HNWT 2MPKA 3CX6B 5FXVA 5LGUB 4U2ZA 3ZCJA 3SWHA 1NEKA 2WQYA 3M3ZB 1D1CA 4F8HA 3PDYA 4EEDA 4ZZBA 3VRAA 4IT4A 2WU5A 3TLWA 2JMHA 2V5CA 4ZI3C 2ES0A 2X67A 2H7OA 1Z0PA 4OK0A 4ZZCA 1VCSA 3P4WA 3A8YC 3O4XE 3QB5K 2XQ4A 1OEDE 5AQOB 4NXNT 4IE0A 2YDRA 4IDZA 3CQGB 3H3AA 2V7JA 3FXDB 5AQGB 2QA7A 1V9DA 4OYKA 5JDLA 4U31A 5AQIB 4ZI2C 3RC3A 4F6RC 4TN7B 3QB5A 3ZSSA 4YXDA 4JUYA 4PK4A 2MOZA 4OX9T 3ABVA 4U7IA 2XAFB 3TLSA 3ZT5A 1XDPA 5JDNA 1T7SA 5ETWA 1X79A 3RF1A 3NZPA 2YN6A 5FNVE 4A56A 3ZMTB 3PE0A 3AA1B 4LFBT 1N33T 2A9UA 5AQJB 3RIUA 1OEDC 2X0LB 2XY8B 4YTNA 5J1GA 3A5XA 2KT9A 1ZEEA 2WM9A 3ONXA 4HWCA 1J5ET 2MTQA 2NOXA 3E22E 3AVRA 1T72A 5CFBA 1M62A 1YQ4A 4OHFA 4HGAA 4PJJA 1SA0E 3ZLIA 3AEDA 2QRXA 3RQUA 3UU5A 4L0RA 3UUXB 3UUBA 4QX8B 2VL8A 3P7IA 5H6RB 2UXNB 1IBKT 3UULA 4QH4A 1YKHB 2CLYB 2XM1A 4X1IE 2CHNA 4EIWA 1MIYA 2YDSA 3P4PA 4G2AA 3RX6A 3EDVA 3B5MA 3ZJ1A 4UV9B 3PURA 4PK6A 4E7ZA 3AAEB 2YDQA 4GYSA 3EDUA 1NENA 3PUXF 1YXRA 3DJBA 5DQWA 5FXZA 2VURA 2A2FX 1XNQT 5BMVE 4LMLA 5AQSB 3QOFA 2MYSA 4AQFC 1WFDA 3ZC1A 5CJ5A 3ZC0A 3UU4A 2FUPA 3RKGA 4TWHA 4TX5A 2DWGA 5KDMC 5HXCA 2CXLA 3RKOA 3AAIA 2NP9A 4JV5T 3HI2A 2E9XD 3J7Yq 4UVCB 3ZYKA 3Q9DA 4DR3T 2UXDT 2CRBA 3ZMVB 3RHWA 3FZLB 4DV3T 4UELA 4JYAT 4DO0A 1UX4A 2WB5A 2W61A 3AA0B 2WSSV 4CXXA 1IBLT 2C5KT 5AQKB 4JI6T 2CCQA 2DCFA 1IAPA 3CX8B 5FP3A 1HR0T 5J0ZA 1IJ6A 5F8PA 1GQEA 2K48A 3FXEB 2M67A 2XAJB 2BS4A 2DWKA 4COFA 3CK6A 2SPCA 3OVUA 2P9BA 3GMIA 4DV6T 4QXHB 3QK6A 4ILAA 2X0YA 2NTYA 3MJXA 1N36T 2XQ7A 3JAEA 1LVFA 4HTEA 2VVSA 2KINB 5LMUT 4IIJE 4WZXA 1BR2A 4IE5A 1OEDA 4ZOLE 5FVKA 2E8IA 2JQQA 3IHRA 3AEFA 3ZYLA 2IHR1 5JDHA 4A98A 5HWXA 3HKCE 3RYFE 3K3QC 4K0UA 4JI5T 2FJAA 2L9QA 3L3PA 2LKGA 2FJBA 3O1HA 4MLKA 2X9XA 1IZNB 3J9X1 1IBMT 3AA6B 5FY7A 3K3NA 2UXBT 5LG3A 2QYWA 3TLTA 2N2NA 2WMOA 3F2EA 4YHHT 2CLYC 4O8SA 3HR0A 4ZEYA 3NRXA 3GN5A 5L3GB 4U33A 2J47A 5LCYA 4TWDA 2N9DA 1WLXA 4DR1T 3EI0A 2K24A 4HFIA 3UU6A 4DVDA 1E2AA 3B57A 4U74A 4UVBB 2CWOA 5LJMA 2IAKA 2L8KA 5AQFB 5AQPB 2X9YA 3HL6A 4H9PC 3PUWF 4LF5T 2XHEB 3ZMUB 3PUGA 3OTOT 2AE9A 1L0VA 4YTMA 4E7SA 3QUJA 4QH5A 2XJ7A 3KFWX 4UVAB 3KBTA 2ZM2A 1OEDB 4AQFA 3AE7A 2XQ8A 2UUAT 2LSGA 4NUVA 3RGLA 2XAQB 5M4YA 4MBQA 1KF6A 3Q5DA 5A1LA 3Q2MA 1LKXA 3ZEFB 5FL0A 4JI4T 3HA4A 2JIWA 3SS1A 2PJQA 3RQWA 2I0MA 3NZQA 4O4LE 3I9YA 4EZHA 1XDOA 3C64A 1WYCA 3FZKB 3Q5WA 3ZN1B 3O1IA 2C0SA 4AIUA 1U4QA 1UURA 3N2OA 4DBRA 1MMDA 3UFGA 3WI3A 5H6QB 3HKDE 2NR4A 2BVMA 3MA9A 3N9LA 4GK0E 5HWYA 5LHHB 3GN5B 2CBIA 3AVSA 2HN1A 2ODUA 4JI8T 2E5VA 2BBJA 3D0TA 3N2GE 3LK2B 3V5SA 2HPLA 5AQMB 3A7MA 4X65T 2J1DG 3P4RA 4H9NC 3RIFA 3K3OA 4DMVA 2ZLYA 4EYUA 4BJMA 3AE8A 3OYXA 4CN6A 4EZ4A 3EVYA 1KEYA 4WYVA 4KX6A 1MIVA 4Z8XA 4ERRA 3VR8A 2CMRA 2CBJA 4HWFA 4ZI7E 3Q5EA 3N9PA 3RYIE 3ZMSB 4H9RC 4KHZF 3BK9A 1UUSA 2KMFA 1W09A 2KLQA 1EZ3A 2W67A 3MKDA 1SE7A 3O1JA 3CX7B 3WAKA 3N9NA 2PFVA 4EEBA 4P0AA 1UK5A 4AKGA 4HFCA 4KHPT 4OFZA 4UR9A 3MXZA 1BR4A 3C98B 1NAFA 3RRCA 5IHYA 4GKJT 2YU1A 2XQ9A 5TAOA 2YINA 2BG9E 2UU9T 4YJ2E 4CN1A 4JI3T 5LXTE 4I0UA 3AECA 2JQ9A 4ISTA 3I0OA 2CE7A 4IHJE 1D0XA 2ODVA 2V26A 3FBZA 5L47A 4IGUA 4MALA 4EXTA 4Z90A 4KP3C 1I6ZA 4UIGA 3SFDA 3G06A 3KINB 4H9QC 3UUMA 1MMAA 2VKOA 3E08A 5HEGA 1MNEA 3HKEE 4HKAA 3IA3A 3B13A 4AKIA 5L3FB 3ZMZB 3UQ7A 1T8BA 5LNKA 2W66A 3ETVA 1T98A 5CGMA 4AQYT 5J2UE 3U78A 3EHZA 2PTFA 4A5XA 2BG9C 3KDSE 5AQVB 3PU8A 2PBIA 3P4QA 4H9SE 2ACZA 4X66T 4QXCB 4EGWA 2D5UA 4DR4T 4GK5E 4I43B 2VL0A 2H89A 4K0KT 5FVLA 3SRZA 3N9QA 2JJ9A 2D2SA 4JEUB 1CHUA 5FKYA 2A72A 4X1YE 4TZ4C 3ZYMA 1KK7A 2ZM8A 5C8YE 1KNRA 4Q25A 2VKHA 5JTGA 3E0ZA 3OKQA 5HEUA 2CXDA 1QLBA 5LA6E 2BDEA 2LSJA 2XQ6A 3S4UA 4QHOA 4O4IE 2Y48B 4QKNA 2LSIA 1D0ZA 3AE4A 4IL4A 2KXPB 5EK3A 1ZV4X 4ASKA 3CQXC 4GYRA 1FJGT 2JPFA 2FBWA 2LRKA 4JLEA 4PAGA 3T1YT 3CMLA 2WS3A 5ADXL 4HFEA 1G73A 3AAAB 4CN4A 4CZZB 4XZCA 5KXJA 5F5WA 5L3BB 3EAMA 1YKEB 1S35A 2BZBA 2A3DA 5HCJA 5L4EA 4GKKT 5LBQB 2WWVA 2XQ5A 4TV8E 4X64T 1VCTA 2AXDS 1ZP0A 2CPTA 2FJEA 5L3DB 2VK9A 2UXCT 2D0UA 4AKRB 4ILCA 2RPAA 2OV9A 3LK42 3OYZA 2V5DA 5EZYE 3VU7H 3VRBA 4YSZA 3PUZF 2YU2A 1WR6A 2XUEA 3TLUA 4B6XA 2JQHA 3CKDA 2E9XC 1W0BA 2HN2A 3KBUA 3H3MA 2XSBA 5JDMA 4C90A 2K3WA 3FZHB 1D1AA 1FEWA 1X9BA 4ILUA 4KBMB 2WCAA 5EK4A 4A97A 3QNUA 5FMNA 4DR6T 4FJOA 3NRYA 5L3CB 4B3TT 5HXSA 5BR8T 2LM9A 2WWUA 2UUCT 2BKPA 2XAGB 4IDPA 2XQAA 4KUMB 4I55E 4X1KE 1D0YA 4JEHB 4TWFA 1HNZT 2IIUA 1HX8A 3IBPA 2WU2A 4HWDA 2HPJA 4UV8B 3JC6D 2XAHB 3OJAA 2M6IA 5LJNA 3C4XA 2BG9A 5AQLB 5LG4A 2ZMAA 5HXRA 4CI1B 3P50A 3I0QA 4ZHQE 4EV6A 4TUYE 4GOUA 2HHHT 4AKLA 4JI7T 2ZM0A 4ZS2A 2JMKA 4O4JE 4YLHA 2C5JA 3LJCA 2Z6EA 3PUSA 2VVNA 2WZIA 1XMQT 4LFAT 3F57A 2JQKA 2GK9A 4DV4T 2WBLA 2RA1A 3I9WA 3P4SA 2PG8A 3AXJA 2Y6XA 3RI5A 4BAYB 3U3IA 3UT5E 3T8OA 2ZM6T 1LVKA 2LM2A 4IE4A 5HEJA 1HG2A 4P09A 3AE5A 3LK3B 1WCRA 4KMCA 4BJNA 4AKHA 1US7B 3LFMA 3VHLA 3TKLB 1Y64B 1HF8A 1YQ3A 2CWYA 5HXEA 3MK7C 4DV7T 1WR0A 4YTPA 4DR5T 4U7YA 3ZPOA 4J2CA 2N1GA 1E7PA 2RP4A 3IEEA 2W62A 2VQET 2W2UA 4PJNA 2QGSA 3M65A 4I50E 1XZYA 2D9DA 1QUUA 4G63A 5JR9A 3ZJ2A 3PUVF 2BBHA 2BG9B 5CA0E 3LBXA 3PTRB 3R84B 4X20E 2NTXA 3RIAA 3KV5A 2CM0A 5LOVE 4DV5T 4WBOA 4AXPA 2V7KA 3FZMB 1W9RA 5AQHB 1G8XA 4DNDA 3PUAA 5HYAA 3UTKA 2LLYA 2XSAA 2CXFA 2E9XA 3ONLC 4HFDA 3F31A 3AB3B 3AE1A 4IDQA 2XQYA 4H63H 3AXJB 4PK5A 2VQFT 3KVAA 2KSRA 5HEOA 2OA5A 2W00A 2XPKA 1XMOT 5ABGA 3ETUA 2WP9A 2LHRA 3CWZB 1HNXT 4NPPA 2HH7A 4LFCT 2LOSA 3C4WA 2G0UA 4Z91A 3ESLA 4ZI3D 4NXMT 5FXXA 5L4HA 2JRKA 2CHOA 3ZSTA 4DR7T 3LG7A 2YK0A 4HN9A 2YOEA 1M7KA 1HX1B 2H88A 1MMNA 4ILBA
chains in the Genus database with same CATH topology
3ONLC 3ONJA 2QYWA 2V8SV 1VCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  3ONJ A;  2QYW A;  2V8S V;  1VCS A; 
#chains in the Genus database with same CATH topology
 4ZS3 A;  5HCM A;  4U2Y A;  5FL1 A;  2M6B A;  4ZI2 D;  2V7L A;  3GA8 A;  4LF7 T;  1U5P A;  5JR9 B;  3NBX X;  1SUM B;  3AE9 A;  2I6H A;  1MMG A;  5KMG P;  4B3R T;  4JI2 T;  1WYB A;  5JDF A;  3LBX B;  4O2B E;  5DQV A;  1VOM A;  1H7C A;  5ABE A;  4CXY A;  4XBF B;  3BQK A;  1E1H B;  2LOP A;  1WRD A;  3DP7 A;  4X62 T;  1Z8U A;  2V7I A;  1KNZ A;  1HTJ F;  4DV1 T;  3V5U A;  2LSY A;  2DLR A;  5LYJ E;  1QSD A;  3W15 B;  2YEV C;  2E9X B;  3EUH A;  4YY3 T;  3C51 A;  5FYM A;  4WW0 A;  1XWM A;  4N78 D;  2VWA A;  4CQI A;  1MND A;  4C91 A;  4ZXL A;  4IE6 A;  3KV6 A;  1O3X A;  2WZH A;  3I1A A;  1UCU A;  4B3S T;  4U3C A;  2YKS A;  1BR0 A;  2MBG A;  3ZN0 B;  4IL9 A;  4ISS A;  2WAU A;  3L8R A;  4IRE A;  2D0T A;  5LGN B;  2LJL A;  3RC8 A;  2FJD A;  4JBW F;  3OBV E;  4JI0 T;  4H9O C;  4ANJ A;  5LBM A;  2WMN A;  4IDN A;  2KWH A;  2EHO D;  4O4H E;  4EYY R;  1D1B A;  2H7V C;  4HWH A;  5AQQ B;  3Q5X A;  2LE8 A;  2W4X A;  3AEE A;  2V8S V;  5CB4 E;  4UF0 A;  1BR1 A;  2NW9 A;  3ZCI A;  3RYC E;  2LSK A;  2Q9Q D;  4UXN B;  2IDO B;  4YHJ A;  4PW8 A;  5ABF A;  5C2T A;  4HFH A;  5AQR B;  2IC6 A;  5JDQ A;  2UUB T;  3NWI A;  3AEA A;  3ONJ A;  3BQI A;  4YJ3 E;  4LF4 T;  1N34 T;  2IW5 B;  1JNR A;  1N32 T;  2EHO C;  3AE3 A;  3FHN A;  3PUQ A;  4NIQ A;  5J2T E;  4MFR A;  3ZKR A;  3VKG A;  3FZF B;  2F4V T;  1OXZ A;  2XAS B;  4QXB B;  3HKB E;  5LB7 B;  5E0O A;  3PJA J;  4LMJ A;  4M1P A;  2Q9Q C;  1UGO A;  5JRE A;  3N5L A;  4YT0 A;  4P0B A;  2E2A A;  2V6X A;  3SOL A;  4WNK A;  3RRW A;  1LRZ A;  3JAD A;  4CI3 B;  3UFE A;  1I94 T;  4IDO A;  3X1D A;  2K9A A;  1JNZ A;  4WBN E;  5IWA T;  3LSV A;  1SHZ C;  4OYJ A;  3N9M A;  5HEH A;  4X5T A;  4PJM A;  2XM2 A;  4ADZ A;  3ANW A;  3C4Z A;  5L2L A;  3FBL A;  3R6N A;  5JR9 C;  2CA5 A;  3P8C D;  5IUX A;  2NW8 A;  2WDR A;  4UF0 B;  4H63 V;  1MIW A;  5FY1 A;  4AI6 A;  4P1N A;  3IF8 B;  2VAS A;  5AFU L;  4HFV A;  1FMW A;  5ABF B;  4IE7 A;  2BS2 A;  3KVB A;  4BA9 A;  2B76 A;  3CVR A;  2L3L A;  2I59 A;  3CIR A;  5JH7 E;  1NWM X;  5EK2 A;  5IYZ E;  2BKN A;  4DUY T;  3MAC A;  1YW0 A;  3ZT6 A;  4HE8 A;  1J1J A;  5CA1 E;  4JI1 T;  1ZKE A;  1Y01 A;  3KV4 A;  1S94 A;  3AE6 A;  2J4G A;  1IJ5 A;  4I4T E;  3BQL A;  4KI0 F;  3UU8 A;  2W0G A;  3ZT7 A;  3K1S A;  4UEM A;  2LKH A;  1KFY A;  4DBQ A;  3L09 A;  2BS3 A;  2XQ3 A;  2CEA A;  4LF9 T;  2VB6 A;  4DUZ T;  2V6Y A;  4EB6 E;  3VR9 A;  3SFE A;  2Y8D A;  2NW7 A;  2V7M A;  1YD8 G;  5F3J A;  5AQT B;  3UU3 A;  2B1E A;  2IUB A;  1UX5 A;  2X51 A;  3AEG A;  3JAF A;  1CUN A;  2X9H A;  4QWN B;  5C3J A;  2IC9 A;  2W63 A;  1ZOY A;  2H3R A;  4YSX A;  2WDQ A;  3JCF A;  4YSY A;  4DV0 T;  3ANW B;  3H37 A;  5LHI B;  4TNV A;  2R6G F;  2KZ7 B;  4HFB A;  2J62 A;  1VRB A;  4LMK A;  5DJQ C;  3JC6 C;  2X66 A;  2LEH A;  3VKH A;  2EHO A;  2C5I T;  2K5B B;  3RPU A;  3C50 A;  3PJA A;  5LGT B;  2QVA A;  4CXW A;  2KWI B;  4PFO A;  1B7T A;  4DV2 T;  4L9I A;  3AE2 A;  3UUN A;  2Q9Q A;  4PJL A;  2X68 A;  4QX7 B;  5AQN B;  5L3E B;  2NWB A;  5HXH A;  1AJ3 A;  5KX5 E;  1OWA A;  4V1A v;  3QC9 A;  3OPC A;  2X0H A;  2UXX B;  3MZK B;  4AIS A;  5JRC A;  2OLT A;  4AQG A;  3TLV A;  5HAX A;  4EOZ B;  5LMN T;  3AEB A;  1HS7 A;  4DMW A;  3KV9 A;  3AA7 B;  4HEA A;  1KNP A;  5DAB A;  4FI5 A;  2V6Y B;  3RIU C;  2WY2 A;  3CPZ A;  4PNI A;  4LF8 T;  4PFP A;  4MHC A;  3EAB A;  4TNW A;  1HG5 A;  2DHR A;  3NVO A;  2LHN A;  1HCI A;  5FY0 A;  2BKO A;  3K8P C;  5FXW A;  5LP6 E;  4LF6 T;  1R8I A;  2DNX A;  3FB2 A;  4U72 A;  2VKJ A;  5JQG E;  2E5L T;  1ZHC A;  4DID B;  4EAH A;  3PV0 F;  1DU2 A;  2DL1 A;  3GWH A;  4L5G A;  4XAX B;  4QH1 A;  1FMV A;  4O2A E;  3RH3 A;  3N9O A;  5AQU B;  2EHO B;  4HWI B;  4YFS A;  5ABH A;  1J5W A;  5JDG A;  3L39 A;  2IML A;  2KND A;  1HFA A;  3WAJ A;  5JVD E;  2XTL A;  3N2K E;  2ACX A;  2V1D B;  4CI2 B;  2LT3 A;  5GON E;  3PU3 A;  2Q9Q B;  2XZE A;  5LHG B;  3LDQ B;  2LRL A;  3UQ4 A;  3NKZ A;  3T1H T;  1XNR T;  3DTO A;  2DI4 A;  3RLF F;  2WDV A;  4NUU A;  2BVL A;  4B3M T;  3RYH E;  4GIW A;  5JRC B;  2VKD A;  3O9X A;  4DR2 T;  2X9W A;  2MAW A;  4TV9 E;  3CQC B;  3PUY F;  1FIO A;  1W0A A;  1HNW T;  2MPK A;  3CX6 B;  5FXV A;  5LGU B;  4U2Z A;  3ZCJ A;  3SWH A;  1NEK A;  2WQY A;  3M3Z B;  1D1C A;  4F8H A;  3PDY A;  4EED A;  4ZZB A;  3VRA A;  4IT4 A;  2WU5 A;  3TLW A;  2JMH A;  2V5C A;  4ZI3 C;  2ES0 A;  2X67 A;  2H7O A;  1Z0P A;  4OK0 A;  4ZZC A;  1VCS A;  3P4W A;  3A8Y C;  3O4X E;  3QB5 K;  2XQ4 A;  1OED E;  5AQO B;  4NXN T;  4IE0 A;  2YDR A;  4IDZ A;  3CQG B;  3H3A A;  2V7J A;  3FXD B;  5AQG B;  2QA7 A;  1V9D A;  4OYK A;  5JDL A;  4U31 A;  5AQI B;  4ZI2 C;  3RC3 A;  4F6R C;  4TN7 B;  3QB5 A;  3ZSS A;  4YXD A;  4JUY A;  4PK4 A;  2MOZ A;  4OX9 T;  3ABV A;  4U7I A;  2XAF B;  3TLS A;  3ZT5 A;  1XDP A;  5JDN A;  1T7S A;  5ETW A;  1X79 A;  3RF1 A;  3NZP A;  2YN6 A;  5FNV E;  4A56 A;  3ZMT B;  3PE0 A;  3AA1 B;  4LFB T;  1N33 T;  2A9U A;  5AQJ B;  3RIU A;  1OED C;  2X0L B;  2XY8 B;  4YTN A;  5J1G A;  3A5X A;  2KT9 A;  1ZEE A;  2WM9 A;  3ONX A;  4HWC A;  1J5E T;  2MTQ A;  2NOX A;  3E22 E;  3AVR A;  1T72 A;  5CFB A;  1M62 A;  1YQ4 A;  4OHF A;  4HGA A;  4PJJ A;  1SA0 E;  3ZLI A;  3AED A;  2QRX A;  3RQU A;  3UU5 A;  4L0R A;  3UUX B;  3UUB A;  4QX8 B;  2VL8 A;  3P7I A;  5H6R B;  2UXN B;  1IBK T;  3UUL A;  4QH4 A;  1YKH B;  2CLY B;  2XM1 A;  4X1I E;  2CHN A;  4EIW A;  1MIY A;  2YDS A;  3P4P A;  4G2A A;  3RX6 A;  3EDV A;  3B5M A;  3ZJ1 A;  4UV9 B;  3PUR A;  4PK6 A;  4E7Z A;  3AAE B;  2YDQ A;  4GYS A;  3EDU A;  1NEN A;  3PUX F;  1YXR A;  3DJB A;  5DQW A;  5FXZ A;  2VUR A;  2A2F X;  1XNQ T;  5BMV E;  4LML A;  5AQS B;  3QOF A;  2MYS A;  4AQF C;  1WFD A;  3ZC1 A;  5CJ5 A;  3ZC0 A;  3UU4 A;  2FUP A;  3RKG A;  4TWH A;  4TX5 A;  2DWG A;  5KDM C;  5HXC A;  2CXL A;  3RKO A;  3AAI A;  2NP9 A;  4JV5 T;  3HI2 A;  2E9X D;  3J7Y q;  4UVC B;  3ZYK A;  3Q9D A;  4DR3 T;  2UXD T;  2CRB A;  3ZMV B;  3RHW A;  3FZL B;  4DV3 T;  4UEL A;  4JYA T;  4DO0 A;  1UX4 A;  2WB5 A;  2W61 A;  3AA0 B;  2WSS V;  4CXX A;  1IBL T;  2C5K T;  5AQK B;  4JI6 T;  2CCQ A;  2DCF A;  1IAP A;  3CX8 B;  5FP3 A;  1HR0 T;  5J0Z A;  1IJ6 A;  5F8P A;  1GQE A;  2K48 A;  3FXE B;  2M67 A;  2XAJ B;  2BS4 A;  2DWK A;  4COF A;  3CK6 A;  2SPC A;  3OVU A;  2P9B A;  3GMI A;  4DV6 T;  4QXH B;  3QK6 A;  4ILA A;  2X0Y A;  2NTY A;  3MJX A;  1N36 T;  2XQ7 A;  3JAE A;  1LVF A;  4HTE A;  2VVS A;  2KIN B;  5LMU T;  4IIJ E;  4WZX A;  1BR2 A;  4IE5 A;  1OED A;  4ZOL E;  5FVK A;  2E8I A;  2JQQ A;  3IHR A;  3AEF A;  3ZYL A;  2IHR 1;  5JDH A;  4A98 A;  5HWX A;  3HKC E;  3RYF E;  3K3Q C;  4K0U A;  4JI5 T;  2FJA A;  2L9Q A;  3L3P A;  2LKG A;  2FJB A;  3O1H A;  4MLK A;  2X9X A;  1IZN B;  3J9X 1;  1IBM T;  3AA6 B;  5FY7 A;  3K3N A;  2UXB T;  5LG3 A;  2QYW A;  3TLT A;  2N2N A;  2WMO A;  3F2E A;  4YHH T;  2CLY C;  4O8S A;  3HR0 A;  4ZEY A;  3NRX A;  3GN5 A;  5L3G B;  4U33 A;  2J47 A;  5LCY A;  4TWD A;  2N9D A;  1WLX A;  4DR1 T;  3EI0 A;  2K24 A;  4HFI A;  3UU6 A;  4DVD A;  1E2A A;  3B57 A;  4U74 A;  4UVB B;  2CWO A;  5LJM A;  2IAK A;  2L8K A;  5AQF B;  5AQP B;  2X9Y A;  3HL6 A;  4H9P C;  3PUW F;  4LF5 T;  2XHE B;  3ZMU B;  3PUG A;  3OTO T;  2AE9 A;  1L0V A;  4YTM A;  4E7S A;  3QUJ A;  4QH5 A;  2XJ7 A;  3KFW X;  4UVA B;  3KBT A;  2ZM2 A;  1OED B;  4AQF A;  3AE7 A;  2XQ8 A;  2UUA T;  2LSG A;  4NUV A;  3RGL A;  2XAQ B;  5M4Y A;  4MBQ A;  1KF6 A;  3Q5D A;  5A1L A;  3Q2M A;  1LKX A;  3ZEF B;  5FL0 A;  4JI4 T;  3HA4 A;  2JIW A;  3SS1 A;  2PJQ A;  3RQW A;  2I0M A;  3NZQ A;  4O4L E;  3I9Y A;  4EZH A;  1XDO A;  3C64 A;  1WYC A;  3FZK B;  3Q5W A;  3ZN1 B;  3O1I A;  2C0S A;  4AIU A;  1U4Q A;  1UUR A;  3N2O A;  4DBR A;  1MMD A;  3UFG A;  3WI3 A;  5H6Q B;  3HKD E;  2NR4 A;  2BVM A;  3MA9 A;  3N9L A;  4GK0 E;  5HWY A;  5LHH B;  3GN5 B;  2CBI A;  3AVS A;  2HN1 A;  2ODU A;  4JI8 T;  2E5V A;  2BBJ A;  3D0T A;  3N2G E;  3LK2 B;  3V5S A;  2HPL A;  5AQM B;  3A7M A;  4X65 T;  2J1D G;  3P4R A;  4H9N C;  3RIF A;  3K3O A;  4DMV A;  2ZLY A;  4EYU A;  4BJM A;  3AE8 A;  3OYX A;  4CN6 A;  4EZ4 A;  3EVY A;  1KEY A;  4WYV A;  4KX6 A;  1MIV A;  4Z8X A;  4ERR A;  3VR8 A;  2CMR A;  2CBJ A;  4HWF A;  4ZI7 E;  3Q5E A;  3N9P A;  3RYI E;  3ZMS B;  4H9R C;  4KHZ F;  3BK9 A;  1UUS A;  2KMF A;  1W09 A;  2KLQ A;  1EZ3 A;  2W67 A;  3MKD A;  1SE7 A;  3O1J A;  3CX7 B;  3WAK A;  3N9N A;  2PFV A;  4EEB A;  4P0A A;  1UK5 A;  4AKG A;  4HFC A;  4KHP T;  4OFZ A;  4UR9 A;  3MXZ A;  1BR4 A;  3C98 B;  1NAF A;  3RRC A;  5IHY A;  4GKJ T;  2YU1 A;  2XQ9 A;  5TAO A;  2YIN A;  2BG9 E;  2UU9 T;  4YJ2 E;  4CN1 A;  4JI3 T;  5LXT E;  4I0U A;  3AEC A;  2JQ9 A;  4IST A;  3I0O A;  2CE7 A;  4IHJ E;  1D0X A;  2ODV A;  2V26 A;  3FBZ A;  5L47 A;  4IGU A;  4MAL A;  4EXT A;  4Z90 A;  4KP3 C;  1I6Z A;  4UIG A;  3SFD A;  3G06 A;  3KIN B;  4H9Q C;  3UUM A;  1MMA A;  2VKO A;  3E08 A;  5HEG A;  1MNE A;  3HKE E;  4HKA A;  3IA3 A;  3B13 A;  4AKI A;  5L3F B;  3ZMZ B;  3UQ7 A;  1T8B A;  5LNK A;  2W66 A;  3ETV A;  1T98 A;  5CGM A;  4AQY T;  5J2U E;  3U78 A;  3EHZ A;  2PTF A;  4A5X A;  2BG9 C;  3KDS E;  5AQV B;  3PU8 A;  2PBI A;  3P4Q A;  4H9S E;  2ACZ A;  4X66 T;  4QXC B;  4EGW A;  2D5U A;  4DR4 T;  4GK5 E;  4I43 B;  2VL0 A;  2H89 A;  4K0K T;  5FVL A;  3SRZ A;  3N9Q A;  2JJ9 A;  2D2S A;  4JEU B;  1CHU A;  5FKY A;  2A72 A;  4X1Y E;  4TZ4 C;  3ZYM A;  1KK7 A;  2ZM8 A;  5C8Y E;  1KNR A;  4Q25 A;  2VKH A;  5JTG A;  3E0Z A;  3OKQ A;  5HEU A;  2CXD A;  1QLB A;  5LA6 E;  2BDE A;  2LSJ A;  2XQ6 A;  3S4U A;  4QHO A;  4O4I E;  2Y48 B;  4QKN A;  2LSI A;  1D0Z A;  3AE4 A;  4IL4 A;  2KXP B;  5EK3 A;  1ZV4 X;  4ASK A;  3CQX C;  4GYR A;  1FJG T;  2JPF A;  2FBW A;  2LRK A;  4JLE A;  4PAG A;  3T1Y T;  3CML A;  2WS3 A;  5ADX L;  4HFE A;  1G73 A;  3AAA B;  4CN4 A;  4CZZ B;  4XZC A;  5KXJ A;  5F5W A;  5L3B B;  3EAM A;  1YKE B;  1S35 A;  2BZB A;  2A3D A;  5HCJ A;  5L4E A;  4GKK T;  5LBQ B;  2WWV A;  2XQ5 A;  4TV8 E;  4X64 T;  1VCT A;  2AXD S;  1ZP0 A;  2CPT A;  2FJE A;  5L3D B;  2VK9 A;  2UXC T;  2D0U A;  4AKR B;  4ILC A;  2RPA A;  2OV9 A;  3LK4 2;  3OYZ A;  2V5D A;  5EZY E;  3VU7 H;  3VRB A;  4YSZ A;  3PUZ F;  2YU2 A;  1WR6 A;  2XUE A;  3TLU A;  4B6X A;  2JQH A;  3CKD A;  2E9X C;  1W0B A;  2HN2 A;  3KBU A;  3H3M A;  2XSB A;  5JDM A;  4C90 A;  2K3W A;  3FZH B;  1D1A A;  1FEW A;  1X9B A;  4ILU A;  4KBM B;  2WCA A;  5EK4 A;  4A97 A;  3QNU A;  5FMN A;  4DR6 T;  4FJO A;  3NRY A;  5L3C B;  4B3T T;  5HXS A;  5BR8 T;  2LM9 A;  2WWU A;  2UUC T;  2BKP A;  2XAG B;  4IDP A;  2XQA A;  4KUM B;  4I55 E;  4X1K E;  1D0Y A;  4JEH B;  4TWF A;  1HNZ T;  2IIU A;  1HX8 A;  3IBP A;  2WU2 A;  4HWD A;  2HPJ A;  4UV8 B;  3JC6 D;  2XAH B;  3OJA A;  2M6I A;  5LJN A;  3C4X A;  2BG9 A;  5AQL B;  5LG4 A;  2ZMA A;  5HXR A;  4CI1 B;  3P50 A;  3I0Q A;  4ZHQ E;  4EV6 A;  4TUY E;  4GOU A;  2HHH T;  4AKL A;  4JI7 T;  2ZM0 A;  4ZS2 A;  2JMK A;  4O4J E;  4YLH A;  2C5J A;  3LJC A;  2Z6E A;  3PUS A;  2VVN A;  2WZI A;  1XMQ T;  4LFA T;  3F57 A;  2JQK A;  2GK9 A;  4DV4 T;  2WBL A;  2RA1 A;  3I9W A;  3P4S A;  2PG8 A;  3AXJ A;  2Y6X A;  3RI5 A;  4BAY B;  3U3I A;  3UT5 E;  3T8O A;  2ZM6 T;  1LVK A;  2LM2 A;  4IE4 A;  5HEJ A;  1HG2 A;  4P09 A;  3AE5 A;  3LK3 B;  1WCR A;  4KMC A;  4BJN A;  4AKH A;  1US7 B;  3LFM A;  3VHL A;  3TKL B;  1Y64 B;  1HF8 A;  1YQ3 A;  2CWY A;  5HXE A;  3MK7 C;  4DV7 T;  1WR0 A;  4YTP A;  4DR5 T;  4U7Y A;  3ZPO A;  4J2C A;  2N1G A;  1E7P A;  2RP4 A;  3IEE A;  2W62 A;  2VQE T;  2W2U A;  4PJN A;  2QGS A;  3M65 A;  4I50 E;  1XZY A;  2D9D A;  1QUU A;  4G63 A;  5JR9 A;  3ZJ2 A;  3PUV F;  2BBH A;  2BG9 B;  5CA0 E;  3LBX A;  3PTR B;  3R84 B;  4X20 E;  2NTX A;  3RIA A;  3KV5 A;  2CM0 A;  5LOV E;  4DV5 T;  4WBO A;  4AXP A;  2V7K A;  3FZM B;  1W9R A;  5AQH B;  1G8X A;  4DND A;  3PUA A;  5HYA A;  3UTK A;  2LLY A;  2XSA A;  2CXF A;  2E9X A;  3ONL C;  4HFD A;  3F31 A;  3AB3 B;  3AE1 A;  4IDQ A;  2XQY A;  4H63 H;  3AXJ B;  4PK5 A;  2VQF T;  3KVA A;  2KSR A;  5HEO A;  2OA5 A;  2W00 A;  2XPK A;  1XMO T;  5ABG A;  3ETU A;  2WP9 A;  2LHR A;  3CWZ B;  1HNX T;  4NPP A;  2HH7 A;  4LFC T;  2LOS A;  3C4W A;  2G0U A;  4Z91 A;  3ESL A;  4ZI3 D;  4NXM T;  5FXX A;  5L4H A;  2JRK A;  2CHO A;  3ZST A;  4DR7 T;  3LG7 A;  2YK0 A;  4HN9 A;  2YOE A;  1M7K A;  1HX1 B;  2H88 A;  1MMN A;  4ILB A; 
#chains in the Genus database with same CATH homology
 3ONL C;  3ONJ A;  2QYW A;  2V8S V;  1VCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...