1VCSA

Solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
b'GSSGSSGEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle transport through interaction with t-SNAREs homolog
publication title Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 30
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 1vcsA00
3ONLC 2QYWA 1VCSA 3ONJA 2V8SV
chains in the Genus database with same CATH superfamily
2WCAA 2PJQA 3PUVF 2E5LT 3CQCB 5JR9A 3ZT7A 2LM2A 3KV6A 3VR9A 2DWKA 5JDFA 4AQFC 2OV9A 5JDNA 4J2CA 3ZKRA 2VKOA 3GWHA 4O4JE 2DI4A 4I4TE 3KV9A 4H9SE 3RKOA 1UURA 5LGNB 1IJ5A 1NWMX 2KZ7B 4X5TA 5JRCB 1VRBA 2KXPB 1GQEA 2E9XA 2IMLA 3ZC0A 3EVYA 1IBLT 2YOEA 1YXRA 3CKDA 4O2BE 3W15B 2W2UA 4DVDA 3HR0A 3J9X1 3C50A 5KMGP 2VVSA 2WU5A 2XJ7A 3IHRA 2X9HA 1IZNB 2C5JA 5ABGA 2M67A 3ZEFB 3K3NA 4KI0F 3N2OA 4OX9T 2F4VT 1HNWT 1NENA 3V5SA 3N9OA 4PFPA 1IJ6A 1D0YA 4YTPA 3N2GE 3E08A 1W09A 4IDQA 1N32T 4CQIA 3L09A 4MLKA 2N1GA 3SRZA 4LFAT 3AE5A 3VRAA 4ZHQE 4JI8T 5LCYA 5IHYA 4B3TT 5ABFA 2K24A 5JDQA 2XQ9A 3HA4A 3BK9A 2LOPA 3CK6A 4YSXA 2BS4A 4H9OC 3RIUA 1DU2A 2CHNA 2BG9C 2Q9QD 5KDMC 3KBUA 1JNZA 3FHNA 4ZOLE 5L4HA 4HWHA 5F8PA 5CFBA 5HXEA 3AXJA 5FNVE 3RGLA 2LHNA 4AXPA 4I50E 4DV4T 3C51A 3HI2A 3LG7A 1HF8A 3FZFB 2ZM8A 3TLVA 4EYUA 3OTOT 4DR6T 2L3LA 3CVRA 2KNDA 2LE8A 1S35A 4EOZB 4NIQA 4X65T 3I1AA 3FZMB 1HFAA 2XPKA 4GYRA 4HFBA 1W0AA 3HL6A 5LNKA 3E22E 4UVBB 2XAJB 4U31A 4AI6A 2YU2A 4U72A 2SPCA 3KINB 4U74A 4ZZBA 5LJMA 2XQ6A 2XQYA 2YDSA 4L0RA 3QB5K 2LSJA 4HFEA 4NXNT 2ZM2A 1XNRT 1D1BA 3AAIA 2IC9A 4DV1T 4WBNE 4ANJA 2W66A 4H9RC 3ONJA 2CLYC 5L2LA 3ZJ1A 2NWBA 3ZYKA 2XAHB 5AQKB 1E7PA 1VCSA 2BKPA 4JV5T 2V1DB 3UU4A 3AEDA 2MYSA 4U3CA 2ZM0A 4ADZA 2X68A 1KFYA 1I6ZA 3ZMTB 4DMWA 5JR9B 2K9AA 4NUVA 4EAHA 4X66T 2NW9A 3UTKA 4LMLA 3AAEB 3ETVA 4B3MT 4G63A 2UXNB 4JYAT 1SE7A 2MOZA 5HAXA 2WQYA 4I0UA 2NP9A 3AA1B 2BVMA 4YHHT 2YU1A 3NWIA 5AQQB 1YQ3A 4A97A 5J1GA 1J5ET 2V6YB 2E9XB 4TUYE 2JIWA 3R6NA 5C2TA 3ZPOA 1YKEB 2WB5A 1E2AA 5AQVB 3N5LA 2KINB 2H7OA 4CN6A 2UUBT 2AE9A 2JQHA 1U5PA 5LYJE 4DBRA 4V1Av 5JRCA 2BBJA 2DLRA 3SS1A 4QX7B 1OEDC 4N78D 4UV8B 3K8PC 1MIWA 1E1HB 4ILCA 5HEUA 4TWHA 3KVBA 4AKIA 1W0BA 4LMJA 4OK0A 2JPFA 2R6GF 2I59A 3R84B 3AE1A 5BMVE 3UT5E 3IA3A 1IAPA 2LM9A 2XQ3A 5EK2A 3ZT5A 5M4YA 2EHOD 3A7MA 4DR7T 2WSSV 3AVRA 2VKHA 5L3BB 4DV6T 4TWDA 4TN7B 2W62A 4PK5A 4IREA 2V8SV 5BR8T 1G73A 3HKCE 4PK4A 1XNQT 2QGSA 1S94A 4WBOA 1LVKA 2MTQA 4Z91A 3MJXA 4PFOA 4UV9B 4YTMA 1LKXA 3AE4A 4IDOA 5HEOA 1UX5A 2XAFB 2M6BA 4BJNA 1T7SA 1SA0E 2V26A 2Q9QC 3VKHA 2P9BA 3F2EA 1WYBA 3FZKB 4YTNA 4IGUA 4DNDA 2JQQA 4ZZCA 3JCFA 2HH7A 5FVKA 3AE9A 4JLEA 3RC8A 2JQ9A 4EV6A 3Q5DA 2LOSA 1D0XA 5AFUL 3OYXA 5LMUT 2JMHA 1OWAA 2CLYB 1XMOT 4GK0E 2J62A 2Z6EA 1UCUA 4X20E 3RQWA 2X0HA 5HWYA 4QKNA 2QRXA 5LXTE 3A5XA 5DJQC 3ONXA 5FMNA 5ABHA 1VOMA 3RIFA 2FBWA 2X0YA 4AQYT 4JEHB 4TX5A 3EHZA 3T1HT 3AVSA 3Q5WA 5JH7E 3RF1A 2C5KT 4HFVA 4DO0A 2B76A 2XASB 2XQ5A 3JADA 3NKZA 4UXNB 3JAEA 3HKBE 4HE8A 4UVAB 5AQUB 2G0UA 3MA9A 4H63H 3O4XE 1NAFA 2LJLA 4WZXA 4U33A 5J0ZA 3SFDA 4HKAA 5IUXA 2J1DG 2IAKA 5FYMA 3AE6A 4TZ4C 3OKQA 3RPUA 2XAGB 1X9BA 3MKDA 2KWIB 4AKRB 3EDVA 5LGUB 2XQAA 3PUGA 3QNUA 4PW8A 1QSDA 2KLQA 5FXWA 4AQFA 4NUUA 4X1IE 2WS3A 2M6IA 4IE0A 1HX8A 3P4WA 3N2KE 5HXSA 2D0UA 2WZHA 4DR5T 5AQHB 1QUUA 1OEDB 2HN1A 1FMVA 4U2YA 2ODVA 5LP6E 2VKDA 4O4HE 4JI0T 2UXCT 1SUMB 1XZYA 3L39A 4M1PA 2X67A 4OHFA 3RYIE 4YJ2E 1I94T 4KUMB 1IBKT 4Q25A 4CXXA 4QWNB 5L3CB 1KK7A 2HPJA 5KXJA 2LSIA 2V6YA 5LG4A 3RLFF 2CM0A 3P4QA 3EI0A 4EIWA 2CMRA 4QHOA 2UUAT 3D0TA 2BS2A 4KHPT 2V7LA 4LFBT 3B5MA 1FEWA 5LB7B 1WLXA 1ZHCA 2JJ9A 5HEHA 3EABA 1HCIA 3C64A 5FY7A 4GKJT 3KFWX 5F5WA 2E5VA 3N9NA 3ZMSB 2VL0A 1UGOA 3DJBA 1WFDA 3RRWA 2ZMAA 1KF6A 3DP7A 2ZM6T 1MIYA 5JDHA 2WZIA 3UUNA 4ZI3D 2EHOC 2WBLA 4WYVA 2VB6A 4HWDA 4DV5T 4IDNA 4B3RT 1N36T 2XSAA 1US7B 2QVAA 3BQIA 2D5UA 2Y6XA 3LK42 4PK6A 3AA6B 4HTEA 2LRLA 4QH1A 2W63A 2LHRA 1HTJF 3CPZA 5LA6E 1BR2A 3GN5B 3AE3A 5LHGB 2UXDT 4TV9E 2RA1A 1KNZA 2WMOA 3AEBA 4CXYA 4JI7T 4X64T 2A9UA 2KT9A 3MZKB 5CGMA 4H9PC 3GMIA 2YN6A 4XAXB 3VRBA 2ACZA 3BQKA 3UQ7A 2H7VC 3RIUC 4GYSA 3AE2A 3VR8A 2WAUA 3H3MA 2ES0A 2UU9T 3JAFA 1WRDA 1MMGA 4CI2B 4B3ST 4IL4A 5ABEA 1OEDE 2LRKA 1R8IA 3NZPA 1HNXT 2J4GA 4WW0A 3EDUA 2L9QA 3AE8A 5HXRA 4JI4T 3E0ZA 3FBLA 4P09A 4DIDB 2FJAA 2NOXA 2VKJA 4CI3B 4MBQA 1Y64B 4AIUA 3AEGA 3RIAA 2NR4A 4IHJE 4YJ3E 2DL1A 3CX6B 2YK0A 3KDSE 3CQXC 5L3GB 3HKEE 3ZCIA 3TLSA 4U7IA 3ZC1A 2CEAA 1BR1A 2NTXA 4CN1A 3SOLA 2BKOA 2X66A 3ZSSA 3P4SA 3B57A 2UXBT 4AKGA 3T1YT 3QK6A 2JRKA 4QXBB 4QXHB 2IIUA 3P50A 3UUBA 4DV3T 3QB5A 2BBHA 4O4LE 3PUSA 3A8YC 1EZ3A 3MK7C 1V9DA 3TLUA 4LF9T 2LSGA 1LVFA 4CXWA 4YXDA 3UFEA 2C5IT 3NRYA 3U78A 3RC3A 3KV5A 1OEDA 4U2ZA 2XUEA 4DV2T 3IBPA 5C8YE 2W67A 4LF8T 1Z8UA 3PTRB 4F8HA 1IBMT 3AECA 4ZI2C 4EZ4A 2C0SA 3VU7H 2W0GA 5AQOB 4PJLA 3EUHA 3AA0B 5LBMA 2K48A 2VK9A 1G8XA 4A56A 5FY0A 4JI6T 4DMVA 4ISSA 2E9XD 5ADXL 2EHOB 4LF7T 4C91A 3NRXA 3IF8B 2XHEB 2LKGA 2NTYA 3OJAA 1HNZT 2H3RA 4XZCA 4HEAA 4QH5A 2YINA 3WAJA 2CXLA 2JQKA 4ILBA 2BG9B 2IDOB 1T8BA 2HHHT 5EZYE 4LF6T 2V7KA 2LSYA 4X1YE 4PJNA 4OYKA 2WM9A 3UU5A 3Q5EA 2WWUA 4DUZT 3Q2MA 4HN9A 3PUXF 1N33T 3LDQB 1CHUA 3C4ZA 4LF4T 1D1AA 2XM2A 3PURA 1ZV4X 2H88A 5AQRB 4O2AE 3H37A 4DR4T 2X9YA 2Q9QA 1QLBA 4HWCA 4HGAA 3ETUA 3ZYLA 3CMLA 5JDLA 4ZI3C 1NEKA 5FVLA 5LJNA 4EYYR 1BR0A 1MIVA 3RYHE 3ESLA 5L3FB 3I0QA 4G2AA 1FIOA 2X9XA 1HR0T 4JUYA 4UVCB 5FY1A 2CWYA 3GN5A 1MMAA 2A2FX 2WU2A 4UR9A 4ASKA 2CBIA 1JNRA 4BAYB 4GIWA 1UX4A 1MNDA 4E7SA 3N9MA 1M62A 2H89A 4C90A 4FI5A 4I55E 3P4RA 4K0UA 3CIRA 4GK5E 3ZCJA 4EXTA 2WDVA 2W61A 5L3EB 2CXDA 1LRZA 3PJAJ 5FXXA 2L8KA 3ZMVB 3CX7B 3VKGA 3LSVA 4KX6A 5FL1A 1X79A 4H63V 2VQFT 5ETWA 4Z8XA 3S4UA 1O3XA 3AAAB 1T72A 5L47A 4EB6E 2OLTA 2D9DA 4COFA 5HEJA 2N2NA 4A98A 2WP9A 5JQGE 3UU6A 4X62T 3KV4A 5AQLB 2X9WA 1ZP0A 5L3DB 1HG5A 1CUNA 2MAWA 2KSRA 4JI1T 2YKSA 2D2SA 2LLYA 3CQGB 2MBGA 4QH4A 4I43B 2X0LB 2HPLA 3I0OA 3O1HA 3V5UA 5F3JA 4PJJA 3L3PA 2BG9E 2XQ4A 5FXVA 3AEEA 3PDYA 3PUYF 4IIJE 4CN4A 5JDMA 1XDOA 4NPPA 2QYWA 5AQGB 2CE7A 4ZI2D 2PG8A 5HEGA 3OVUA 3UUMA 4DR2T 2E8IA 2K5BB 4MALA 3JC6C 2X51A 2B1EA 3TLTA 4JI2T 3KVAA 3F31A 3C4WA 1H7CA 4ILUA 2DNXA 2BVLA 4HFDA 2WDQA 5JVDE 2I6HA 4JI5T 5JR9C 4UF0B 5HYAA 4TV8E 2XAQB 4WNKA 3P8CD 2IHR1 4YSZA 4P1NA 2QA7A 3PE0A 4ZS3A 3UULA 4A5XA 3Q5XA 4ZI7E 4UELA 2EHOA 1KEYA 1WR0A 3PUZF 3O1JA 3LK2B 2E9XC 3QOFA 3PUQA 5LHIB 2UUCT 2N9DA 4ILAA 3SFEA 5FKYA 4TNWA 4GKKT 2BG9A 3PUAA 2V6XA 3FZLB 1HX1B 3FXDB 2Q9QB 3UU8A 1VCTA 5LMNT 1OXZA 2UXXB 3FB2A 3C98B 3ZMZB 5L4EA 5HXHA 2VWAA 2YDRA 5JDGA 2XM1A 4PJMA 2CPTA 5AQNB 3I9YA 3SWHA 4IE7A 3RI5A 4DV0T 3RHWA 5C3JA 2OA5A 5TAOA 2ODUA 3B13A 3LK3B 3M3ZB 4IE5A 2WMNA 3LJCA 3ZN1B 1SHZC 3ANWB 4HFIA 1HG2A 5CJ5A 5LG3A 4IT4A 4IDZA 2BZBA 3N9LA 5J2TE 4BJMA 5E0OA 3L8RA 2WWVA 2FJBA 3AB3B 4DBQA 4GOUA 3UU3A 1YD8G 4YSYA 2YEVC 1D1CA 3CX8B 3AEFA 1MMNA 5LHHB 5DQVA 2YDQA 1MMDA 4YFSA 2A72A 3K3OA 3ZMUB 2LT3A 3LBXB 5A1LA 4AQGA 3F57A 2IC6A 1KNPA 1HS7A 2XQ7A 4CI1B 5AQPB 4FJOA 2DHRA 2CBJA 3J7Yq 5HCJA 3DTOA 3OPCA 4JI3T 3Q9DA 2LKHA 2Y48B 3NVOA 3RYCE 2V7IA 3C4XA 4EEBA 4P0AA 3CWZB 2VVNA 5JTGA 4QX8B 5IWAT 2CWOA 3TKLB 3NBXX 1L0VA 1T98A 3AA7B 2VL8A 1ZEEA 4BA9A 4EEDA 5LGTB 4JBWF 5CB4E 2BKNA 3HKDE 2W4XA 2MPKA 2CCQA 1B7TA 3H3AA 4OYJA 4O8SA 3MXZA 2KMFA 2FJDA 4P0BA 3JC6D 4L9IA 4ZXLA 2BS3A 2I0MA 5AQJB 3ABVA 4U7YA 4HFHA 1WYCA 4HWIB 2PTFA 3UUXB 4EGWA 3O9XA 2RP4A 3NZQA 3KBTA 5EK4A 3MACA 3ZLIA 2BDEA 2CHOA 4Z90A 4LF5T 4PAGA 4E7ZA 5H6QB 5H6RB 2VASA 4UEMA 4O4IE 5AQMB 4LFCT 1MNEA 4F6RC 4TWFA 2V5CA 3IEEA 2V7JA 5FP3A 4DV7T 4DR3T 2CA5A 5AQSB 4ISTA 4ZS2A 5AQIB 5J2UE 1XMQT 3OYZA 4IE6A 5AQTB 4X1KE 2IUBA 3FBZA 3ZSTA 4UF0A 3UFGA 3AE7A 2W00A 3GA8A 3WI3A 3RX6A 4ERRA 2RPAA 4KP3C 1UK5A 3TLWA 2V5DA 2WDRA 4MFRA 3EAMA 4KHZF 4AKHA 3RH3A 4ZEYA 2E2AA 5AQFB 4YHJA 5JREA 5ABFB 1Y01A 3QC9A 2J47A 1FMWA 4H9QC 3RKGA 2XZEA 3RRCA 2CRBA 5IYZE 1FJGT 5KX5E 3P7IA 4EZHA 3FXEB 4CZZB 1W9RA 4QXCB 3PJAA 3RQUA 4JEUB 1D0ZA 3ZN0B 1WR6A 1J1JA 3UQ4A 3AXJB 2LSKA 2LEHA 4IDPA 2NW7A 5HWXA 4UIGA 2PFVA 2IW5B 3AEAA 3ANWA 4KMCA 2V7MA 5GONE 4L5GA 4OFZA 3O1IA 4AISA 3PV0F 4H9NC 3N9QA 3VHLA 2VURA 3N9PA 1XDPA 2KWHA 3U3IA 4AKLA 4KBMB 1N34T 2CXFA 4IL9A 5FXZA 3LFMA 5HXCA 2XQ8A 2XY8B 4NXMT 2DCFA 1WCRA 1ZKEA 1AJ3A 3ZT6A 2VQET 3RYFE 1Z0PA 2XSBA 5EK3A 3T8OA 2D0TA 3LBXA 3QUJA 3PUWF 3ONLC 4YT0A 1J5WA 3G06A 5DQWA 5LOVE 2FUPA 1XWMA 5DABA 4HWFA 3FZHB 4IE4A 4K0KT 2HN2A 1KNRA 1ZOYA 1U4QA 2WY2A 5CA0E 5FL0A 4LMKA 4HFCA 2Y8DA 2JMKA 3BQLA 4DUYT 1YW0A 3ZYMA 5HCMA 3P4PA 4YY3T 3ZJ2A 1BR4A 4PNIA 2NW8A 1UUSA 2GK9A 2A3DA 4TNVA 2PBIA 1YKHB 2AXDS 2K3WA 3K1SA 2DWGA 3I9WA 3WAKA 4YLHA 3X1DA 4DR1T 2ZLYA 3OBVE 2ACXA 2FJEA 3M65A 3PU3A 4XBFB 3PU8A 5CA1E 3K3QC 2XTLA 1YQ4A 1M7KA 5LBQB 4B6XA 4MHCA
chains in the Genus database with same CATH topology
3ONLC 2QYWA 1VCSA 3ONJA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2QYW A;  1VCS A;  3ONJ A;  2V8S V; 
#chains in the Genus database with same CATH topology
 2WCA A;  2PJQ A;  3PUV F;  2E5L T;  3CQC B;  5JR9 A;  3ZT7 A;  2LM2 A;  3KV6 A;  3VR9 A;  2DWK A;  5JDF A;  4AQF C;  2OV9 A;  5JDN A;  4J2C A;  3ZKR A;  2VKO A;  3GWH A;  4O4J E;  2DI4 A;  4I4T E;  3KV9 A;  4H9S E;  3RKO A;  1UUR A;  5LGN B;  1IJ5 A;  1NWM X;  2KZ7 B;  4X5T A;  5JRC B;  1VRB A;  2KXP B;  1GQE A;  2E9X A;  2IML A;  3ZC0 A;  3EVY A;  1IBL T;  2YOE A;  1YXR A;  3CKD A;  4O2B E;  3W15 B;  2W2U A;  4DVD A;  3HR0 A;  3J9X 1;  3C50 A;  5KMG P;  2VVS A;  2WU5 A;  2XJ7 A;  3IHR A;  2X9H A;  1IZN B;  2C5J A;  5ABG A;  2M67 A;  3ZEF B;  3K3N A;  4KI0 F;  3N2O A;  4OX9 T;  2F4V T;  1HNW T;  1NEN A;  3V5S A;  3N9O A;  4PFP A;  1IJ6 A;  1D0Y A;  4YTP A;  3N2G E;  3E08 A;  1W09 A;  4IDQ A;  1N32 T;  4CQI A;  3L09 A;  4MLK A;  2N1G A;  3SRZ A;  4LFA T;  3AE5 A;  3VRA A;  4ZHQ E;  4JI8 T;  5LCY A;  5IHY A;  4B3T T;  5ABF A;  2K24 A;  5JDQ A;  2XQ9 A;  3HA4 A;  3BK9 A;  2LOP A;  3CK6 A;  4YSX A;  2BS4 A;  4H9O C;  3RIU A;  1DU2 A;  2CHN A;  2BG9 C;  2Q9Q D;  5KDM C;  3KBU A;  1JNZ A;  3FHN A;  4ZOL E;  5L4H A;  4HWH A;  5F8P A;  5CFB A;  5HXE A;  3AXJ A;  5FNV E;  3RGL A;  2LHN A;  4AXP A;  4I50 E;  4DV4 T;  3C51 A;  3HI2 A;  3LG7 A;  1HF8 A;  3FZF B;  2ZM8 A;  3TLV A;  4EYU A;  3OTO T;  4DR6 T;  2L3L A;  3CVR A;  2KND A;  2LE8 A;  1S35 A;  4EOZ B;  4NIQ A;  4X65 T;  3I1A A;  3FZM B;  1HFA A;  2XPK A;  4GYR A;  4HFB A;  1W0A A;  3HL6 A;  5LNK A;  3E22 E;  4UVB B;  2XAJ B;  4U31 A;  4AI6 A;  2YU2 A;  4U72 A;  2SPC A;  3KIN B;  4U74 A;  4ZZB A;  5LJM A;  2XQ6 A;  2XQY A;  2YDS A;  4L0R A;  3QB5 K;  2LSJ A;  4HFE A;  4NXN T;  2ZM2 A;  1XNR T;  1D1B A;  3AAI A;  2IC9 A;  4DV1 T;  4WBN E;  4ANJ A;  2W66 A;  4H9R C;  3ONJ A;  2CLY C;  5L2L A;  3ZJ1 A;  2NWB A;  3ZYK A;  2XAH B;  5AQK B;  1E7P A;  1VCS A;  2BKP A;  4JV5 T;  2V1D B;  3UU4 A;  3AED A;  2MYS A;  4U3C A;  2ZM0 A;  4ADZ A;  2X68 A;  1KFY A;  1I6Z A;  3ZMT B;  4DMW A;  5JR9 B;  2K9A A;  4NUV A;  4EAH A;  4X66 T;  2NW9 A;  3UTK A;  4LML A;  3AAE B;  3ETV A;  4B3M T;  4G63 A;  2UXN B;  4JYA T;  1SE7 A;  2MOZ A;  5HAX A;  2WQY A;  4I0U A;  2NP9 A;  3AA1 B;  2BVM A;  4YHH T;  2YU1 A;  3NWI A;  5AQQ B;  1YQ3 A;  4A97 A;  5J1G A;  1J5E T;  2V6Y B;  2E9X B;  4TUY E;  2JIW A;  3R6N A;  5C2T A;  3ZPO A;  1YKE B;  2WB5 A;  1E2A A;  5AQV B;  3N5L A;  2KIN B;  2H7O A;  4CN6 A;  2UUB T;  2AE9 A;  2JQH A;  1U5P A;  5LYJ E;  4DBR A;  4V1A v;  5JRC A;  2BBJ A;  2DLR A;  3SS1 A;  4QX7 B;  1OED C;  4N78 D;  4UV8 B;  3K8P C;  1MIW A;  1E1H B;  4ILC A;  5HEU A;  4TWH A;  3KVB A;  4AKI A;  1W0B A;  4LMJ A;  4OK0 A;  2JPF A;  2R6G F;  2I59 A;  3R84 B;  3AE1 A;  5BMV E;  3UT5 E;  3IA3 A;  1IAP A;  2LM9 A;  2XQ3 A;  5EK2 A;  3ZT5 A;  5M4Y A;  2EHO D;  3A7M A;  4DR7 T;  2WSS V;  3AVR A;  2VKH A;  5L3B B;  4DV6 T;  4TWD A;  4TN7 B;  2W62 A;  4PK5 A;  4IRE A;  2V8S V;  5BR8 T;  1G73 A;  3HKC E;  4PK4 A;  1XNQ T;  2QGS A;  1S94 A;  4WBO A;  1LVK A;  2MTQ A;  4Z91 A;  3MJX A;  4PFO A;  4UV9 B;  4YTM A;  1LKX A;  3AE4 A;  4IDO A;  5HEO A;  1UX5 A;  2XAF B;  2M6B A;  4BJN A;  1T7S A;  1SA0 E;  2V26 A;  2Q9Q C;  3VKH A;  2P9B A;  3F2E A;  1WYB A;  3FZK B;  4YTN A;  4IGU A;  4DND A;  2JQQ A;  4ZZC A;  3JCF A;  2HH7 A;  5FVK A;  3AE9 A;  4JLE A;  3RC8 A;  2JQ9 A;  4EV6 A;  3Q5D A;  2LOS A;  1D0X A;  5AFU L;  3OYX A;  5LMU T;  2JMH A;  1OWA A;  2CLY B;  1XMO T;  4GK0 E;  2J62 A;  2Z6E A;  1UCU A;  4X20 E;  3RQW A;  2X0H A;  5HWY A;  4QKN A;  2QRX A;  5LXT E;  3A5X A;  5DJQ C;  3ONX A;  5FMN A;  5ABH A;  1VOM A;  3RIF A;  2FBW A;  2X0Y A;  4AQY T;  4JEH B;  4TX5 A;  3EHZ A;  3T1H T;  3AVS A;  3Q5W A;  5JH7 E;  3RF1 A;  2C5K T;  4HFV A;  4DO0 A;  2B76 A;  2XAS B;  2XQ5 A;  3JAD A;  3NKZ A;  4UXN B;  3JAE A;  3HKB E;  4HE8 A;  4UVA B;  5AQU B;  2G0U A;  3MA9 A;  4H63 H;  3O4X E;  1NAF A;  2LJL A;  4WZX A;  4U33 A;  5J0Z A;  3SFD A;  4HKA A;  5IUX A;  2J1D G;  2IAK A;  5FYM A;  3AE6 A;  4TZ4 C;  3OKQ A;  3RPU A;  2XAG B;  1X9B A;  3MKD A;  2KWI B;  4AKR B;  3EDV A;  5LGU B;  2XQA A;  3PUG A;  3QNU A;  4PW8 A;  1QSD A;  2KLQ A;  5FXW A;  4AQF A;  4NUU A;  4X1I E;  2WS3 A;  2M6I A;  4IE0 A;  1HX8 A;  3P4W A;  3N2K E;  5HXS A;  2D0U A;  2WZH A;  4DR5 T;  5AQH B;  1QUU A;  1OED B;  2HN1 A;  1FMV A;  4U2Y A;  2ODV A;  5LP6 E;  2VKD A;  4O4H E;  4JI0 T;  2UXC T;  1SUM B;  1XZY A;  3L39 A;  4M1P A;  2X67 A;  4OHF A;  3RYI E;  4YJ2 E;  1I94 T;  4KUM B;  1IBK T;  4Q25 A;  4CXX A;  4QWN B;  5L3C B;  1KK7 A;  2HPJ A;  5KXJ A;  2LSI A;  2V6Y A;  5LG4 A;  3RLF F;  2CM0 A;  3P4Q A;  3EI0 A;  4EIW A;  2CMR A;  4QHO A;  2UUA T;  3D0T A;  2BS2 A;  4KHP T;  2V7L A;  4LFB T;  3B5M A;  1FEW A;  5LB7 B;  1WLX A;  1ZHC A;  2JJ9 A;  5HEH A;  3EAB A;  1HCI A;  3C64 A;  5FY7 A;  4GKJ T;  3KFW X;  5F5W A;  2E5V A;  3N9N A;  3ZMS B;  2VL0 A;  1UGO A;  3DJB A;  1WFD A;  3RRW A;  2ZMA A;  1KF6 A;  3DP7 A;  2ZM6 T;  1MIY A;  5JDH A;  2WZI A;  3UUN A;  4ZI3 D;  2EHO C;  2WBL A;  4WYV A;  2VB6 A;  4HWD A;  4DV5 T;  4IDN A;  4B3R T;  1N36 T;  2XSA A;  1US7 B;  2QVA A;  3BQI A;  2D5U A;  2Y6X A;  3LK4 2;  4PK6 A;  3AA6 B;  4HTE A;  2LRL A;  4QH1 A;  2W63 A;  2LHR A;  1HTJ F;  3CPZ A;  5LA6 E;  1BR2 A;  3GN5 B;  3AE3 A;  5LHG B;  2UXD T;  4TV9 E;  2RA1 A;  1KNZ A;  2WMO A;  3AEB A;  4CXY A;  4JI7 T;  4X64 T;  2A9U A;  2KT9 A;  3MZK B;  5CGM A;  4H9P C;  3GMI A;  2YN6 A;  4XAX B;  3VRB A;  2ACZ A;  3BQK A;  3UQ7 A;  2H7V C;  3RIU C;  4GYS A;  3AE2 A;  3VR8 A;  2WAU A;  3H3M A;  2ES0 A;  2UU9 T;  3JAF A;  1WRD A;  1MMG A;  4CI2 B;  4B3S T;  4IL4 A;  5ABE A;  1OED E;  2LRK A;  1R8I A;  3NZP A;  1HNX T;  2J4G A;  4WW0 A;  3EDU A;  2L9Q A;  3AE8 A;  5HXR A;  4JI4 T;  3E0Z A;  3FBL A;  4P09 A;  4DID B;  2FJA A;  2NOX A;  2VKJ A;  4CI3 B;  4MBQ A;  1Y64 B;  4AIU A;  3AEG A;  3RIA A;  2NR4 A;  4IHJ E;  4YJ3 E;  2DL1 A;  3CX6 B;  2YK0 A;  3KDS E;  3CQX C;  5L3G B;  3HKE E;  3ZCI A;  3TLS A;  4U7I A;  3ZC1 A;  2CEA A;  1BR1 A;  2NTX A;  4CN1 A;  3SOL A;  2BKO A;  2X66 A;  3ZSS A;  3P4S A;  3B57 A;  2UXB T;  4AKG A;  3T1Y T;  3QK6 A;  2JRK A;  4QXB B;  4QXH B;  2IIU A;  3P50 A;  3UUB A;  4DV3 T;  3QB5 A;  2BBH A;  4O4L E;  3PUS A;  3A8Y C;  1EZ3 A;  3MK7 C;  1V9D A;  3TLU A;  4LF9 T;  2LSG A;  1LVF A;  4CXW A;  4YXD A;  3UFE A;  2C5I T;  3NRY A;  3U78 A;  3RC3 A;  3KV5 A;  1OED A;  4U2Z A;  2XUE A;  4DV2 T;  3IBP A;  5C8Y E;  2W67 A;  4LF8 T;  1Z8U A;  3PTR B;  4F8H A;  1IBM T;  3AEC A;  4ZI2 C;  4EZ4 A;  2C0S A;  3VU7 H;  2W0G A;  5AQO B;  4PJL A;  3EUH A;  3AA0 B;  5LBM A;  2K48 A;  2VK9 A;  1G8X A;  4A56 A;  5FY0 A;  4JI6 T;  4DMV A;  4ISS A;  2E9X D;  5ADX L;  2EHO B;  4LF7 T;  4C91 A;  3NRX A;  3IF8 B;  2XHE B;  2LKG A;  2NTY A;  3OJA A;  1HNZ T;  2H3R A;  4XZC A;  4HEA A;  4QH5 A;  2YIN A;  3WAJ A;  2CXL A;  2JQK A;  4ILB A;  2BG9 B;  2IDO B;  1T8B A;  2HHH T;  5EZY E;  4LF6 T;  2V7K A;  2LSY A;  4X1Y E;  4PJN A;  4OYK A;  2WM9 A;  3UU5 A;  3Q5E A;  2WWU A;  4DUZ T;  3Q2M A;  4HN9 A;  3PUX F;  1N33 T;  3LDQ B;  1CHU A;  3C4Z A;  4LF4 T;  1D1A A;  2XM2 A;  3PUR A;  1ZV4 X;  2H88 A;  5AQR B;  4O2A E;  3H37 A;  4DR4 T;  2X9Y A;  2Q9Q A;  1QLB A;  4HWC A;  4HGA A;  3ETU A;  3ZYL A;  3CML A;  5JDL A;  4ZI3 C;  1NEK A;  5FVL A;  5LJN A;  4EYY R;  1BR0 A;  1MIV A;  3RYH E;  3ESL A;  5L3F B;  3I0Q A;  4G2A A;  1FIO A;  2X9X A;  1HR0 T;  4JUY A;  4UVC B;  5FY1 A;  2CWY A;  3GN5 A;  1MMA A;  2A2F X;  2WU2 A;  4UR9 A;  4ASK A;  2CBI A;  1JNR A;  4BAY B;  4GIW A;  1UX4 A;  1MND A;  4E7S A;  3N9M A;  1M62 A;  2H89 A;  4C90 A;  4FI5 A;  4I55 E;  3P4R A;  4K0U A;  3CIR A;  4GK5 E;  3ZCJ A;  4EXT A;  2WDV A;  2W61 A;  5L3E B;  2CXD A;  1LRZ A;  3PJA J;  5FXX A;  2L8K A;  3ZMV B;  3CX7 B;  3VKG A;  3LSV A;  4KX6 A;  5FL1 A;  1X79 A;  4H63 V;  2VQF T;  5ETW A;  4Z8X A;  3S4U A;  1O3X A;  3AAA B;  1T72 A;  5L47 A;  4EB6 E;  2OLT A;  2D9D A;  4COF A;  5HEJ A;  2N2N A;  4A98 A;  2WP9 A;  5JQG E;  3UU6 A;  4X62 T;  3KV4 A;  5AQL B;  2X9W A;  1ZP0 A;  5L3D B;  1HG5 A;  1CUN A;  2MAW A;  2KSR A;  4JI1 T;  2YKS A;  2D2S A;  2LLY A;  3CQG B;  2MBG A;  4QH4 A;  4I43 B;  2X0L B;  2HPL A;  3I0O A;  3O1H A;  3V5U A;  5F3J A;  4PJJ A;  3L3P A;  2BG9 E;  2XQ4 A;  5FXV A;  3AEE A;  3PDY A;  3PUY F;  4IIJ E;  4CN4 A;  5JDM A;  1XDO A;  4NPP A;  2QYW A;  5AQG B;  2CE7 A;  4ZI2 D;  2PG8 A;  5HEG A;  3OVU A;  3UUM A;  4DR2 T;  2E8I A;  2K5B B;  4MAL A;  3JC6 C;  2X51 A;  2B1E A;  3TLT A;  4JI2 T;  3KVA A;  3F31 A;  3C4W A;  1H7C A;  4ILU A;  2DNX A;  2BVL A;  4HFD A;  2WDQ A;  5JVD E;  2I6H A;  4JI5 T;  5JR9 C;  4UF0 B;  5HYA A;  4TV8 E;  2XAQ B;  4WNK A;  3P8C D;  2IHR 1;  4YSZ A;  4P1N A;  2QA7 A;  3PE0 A;  4ZS3 A;  3UUL A;  4A5X A;  3Q5X A;  4ZI7 E;  4UEL A;  2EHO A;  1KEY A;  1WR0 A;  3PUZ F;  3O1J A;  3LK2 B;  2E9X C;  3QOF A;  3PUQ A;  5LHI B;  2UUC T;  2N9D A;  4ILA A;  3SFE A;  5FKY A;  4TNW A;  4GKK T;  2BG9 A;  3PUA A;  2V6X A;  3FZL B;  1HX1 B;  3FXD B;  2Q9Q B;  3UU8 A;  1VCT A;  5LMN T;  1OXZ A;  2UXX B;  3FB2 A;  3C98 B;  3ZMZ B;  5L4E A;  5HXH A;  2VWA A;  2YDR A;  5JDG A;  2XM1 A;  4PJM A;  2CPT A;  5AQN B;  3I9Y A;  3SWH A;  4IE7 A;  3RI5 A;  4DV0 T;  3RHW A;  5C3J A;  2OA5 A;  5TAO A;  2ODU A;  3B13 A;  3LK3 B;  3M3Z B;  4IE5 A;  2WMN A;  3LJC A;  3ZN1 B;  1SHZ C;  3ANW B;  4HFI A;  1HG2 A;  5CJ5 A;  5LG3 A;  4IT4 A;  4IDZ A;  2BZB A;  3N9L A;  5J2T E;  4BJM A;  5E0O A;  3L8R A;  2WWV A;  2FJB A;  3AB3 B;  4DBQ A;  4GOU A;  3UU3 A;  1YD8 G;  4YSY A;  2YEV C;  1D1C A;  3CX8 B;  3AEF A;  1MMN A;  5LHH B;  5DQV A;  2YDQ A;  1MMD A;  4YFS A;  2A72 A;  3K3O A;  3ZMU B;  2LT3 A;  3LBX B;  5A1L A;  4AQG A;  3F57 A;  2IC6 A;  1KNP A;  1HS7 A;  2XQ7 A;  4CI1 B;  5AQP B;  4FJO A;  2DHR A;  2CBJ A;  3J7Y q;  5HCJ A;  3DTO A;  3OPC A;  4JI3 T;  3Q9D A;  2LKH A;  2Y48 B;  3NVO A;  3RYC E;  2V7I A;  3C4X A;  4EEB A;  4P0A A;  3CWZ B;  2VVN A;  5JTG A;  4QX8 B;  5IWA T;  2CWO A;  3TKL B;  3NBX X;  1L0V A;  1T98 A;  3AA7 B;  2VL8 A;  1ZEE A;  4BA9 A;  4EED A;  5LGT B;  4JBW F;  5CB4 E;  2BKN A;  3HKD E;  2W4X A;  2MPK A;  2CCQ A;  1B7T A;  3H3A A;  4OYJ A;  4O8S A;  3MXZ A;  2KMF A;  2FJD A;  4P0B A;  3JC6 D;  4L9I A;  4ZXL A;  2BS3 A;  2I0M A;  5AQJ B;  3ABV A;  4U7Y A;  4HFH A;  1WYC A;  4HWI B;  2PTF A;  3UUX B;  4EGW A;  3O9X A;  2RP4 A;  3NZQ A;  3KBT A;  5EK4 A;  3MAC A;  3ZLI A;  2BDE A;  2CHO A;  4Z90 A;  4LF5 T;  4PAG A;  4E7Z A;  5H6Q B;  5H6R B;  2VAS A;  4UEM A;  4O4I E;  5AQM B;  4LFC T;  1MNE A;  4F6R C;  4TWF A;  2V5C A;  3IEE A;  2V7J A;  5FP3 A;  4DV7 T;  4DR3 T;  2CA5 A;  5AQS B;  4IST A;  4ZS2 A;  5AQI B;  5J2U E;  1XMQ T;  3OYZ A;  4IE6 A;  5AQT B;  4X1K E;  2IUB A;  3FBZ A;  3ZST A;  4UF0 A;  3UFG A;  3AE7 A;  2W00 A;  3GA8 A;  3WI3 A;  3RX6 A;  4ERR A;  2RPA A;  4KP3 C;  1UK5 A;  3TLW A;  2V5D A;  2WDR A;  4MFR A;  3EAM A;  4KHZ F;  4AKH A;  3RH3 A;  4ZEY A;  2E2A A;  5AQF B;  4YHJ A;  5JRE A;  5ABF B;  1Y01 A;  3QC9 A;  2J47 A;  1FMW A;  4H9Q C;  3RKG A;  2XZE A;  3RRC A;  2CRB A;  5IYZ E;  1FJG T;  5KX5 E;  3P7I A;  4EZH A;  3FXE B;  4CZZ B;  1W9R A;  4QXC B;  3PJA A;  3RQU A;  4JEU B;  1D0Z A;  3ZN0 B;  1WR6 A;  1J1J A;  3UQ4 A;  3AXJ B;  2LSK A;  2LEH A;  4IDP A;  2NW7 A;  5HWX A;  4UIG A;  2PFV A;  2IW5 B;  3AEA A;  3ANW A;  4KMC A;  2V7M A;  5GON E;  4L5G A;  4OFZ A;  3O1I A;  4AIS A;  3PV0 F;  4H9N C;  3N9Q A;  3VHL A;  2VUR A;  3N9P A;  1XDP A;  2KWH A;  3U3I A;  4AKL A;  4KBM B;  1N34 T;  2CXF A;  4IL9 A;  5FXZ A;  3LFM A;  5HXC A;  2XQ8 A;  2XY8 B;  4NXM T;  2DCF A;  1WCR A;  1ZKE A;  1AJ3 A;  3ZT6 A;  2VQE T;  3RYF E;  1Z0P A;  2XSB A;  5EK3 A;  3T8O A;  2D0T A;  3LBX A;  3QUJ A;  3PUW F;  3ONL C;  4YT0 A;  1J5W A;  3G06 A;  5DQW A;  5LOV E;  2FUP A;  1XWM A;  5DAB A;  4HWF A;  3FZH B;  4IE4 A;  4K0K T;  2HN2 A;  1KNR A;  1ZOY A;  1U4Q A;  2WY2 A;  5CA0 E;  5FL0 A;  4LMK A;  4HFC A;  2Y8D A;  2JMK A;  3BQL A;  4DUY T;  1YW0 A;  3ZYM A;  5HCM A;  3P4P A;  4YY3 T;  3ZJ2 A;  1BR4 A;  4PNI A;  2NW8 A;  1UUS A;  2GK9 A;  2A3D A;  4TNV A;  2PBI A;  1YKH B;  2AXD S;  2K3W A;  3K1S A;  2DWG A;  3I9W A;  3WAK A;  4YLH A;  3X1D A;  4DR1 T;  2ZLY A;  3OBV E;  2ACX A;  2FJE A;  3M65 A;  3PU3 A;  4XBF B;  3PU8 A;  5CA1 E;  3K3Q C;  2XTL A;  1YQ4 A;  1M7K A;  5LBQ B;  4B6X A;  4MHC A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2QYW A;  1VCS A;  3ONJ A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...