1VD0A

Capsid stabilizing protein gpd, nmr, 20 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
109
structure length
109
Chain Sequence
b'TSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Head decoration protein
publication title NMR solution structure of the monomeric form of the bacteriophage lambda capsid stabilizing protein gpD.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 7
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02924 HDPD Bacteriophage lambda head decoration protein D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 1vd0A01
1TD3A 1TD4A 3SUCA 3GQKA 1TD0A 1TCZA 3GQHA 1C5EA 1VD0A
chains in the Genus database with same CATH superfamily
1TD3A 1TD4A 3SUCA 3GQKA 1TD0A 1TCZA 3GQHA 1C5EA 1VD0A
chains in the Genus database with same CATH topology
1TD3A 1TD4A 3SUCA 3GQKA 1TD0A 1TCZA 3GQHA 1C5EA 1VD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TD3 A;  1TD4 A;  3SUC A;  3GQK A;  1TD0 A;  1TCZ A;  3GQH A;  1C5E A;  1VD0 A; 
#chains in the Genus database with same CATH topology
 1TD3 A;  1TD4 A;  3SUC A;  3GQK A;  1TD0 A;  1TCZ A;  3GQH A;  1C5E A;  1VD0 A; 
#chains in the Genus database with same CATH homology
 1TD3 A;  1TD4 A;  3SUC A;  3GQK A;  1TD0 A;  1TCZ A;  3GQH A;  1C5E A;  1VD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...