1VDFA

Assembly domain of cartilage oligomeric matrix protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
46
structure length
46
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARTILAGE OLIGOMERIC MATRIX PROTEIN
publication title The crystal structure of a five-stranded coiled coil in COMP: a prototype ion channel?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Extracellular matrix protein
total genus 20
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1996-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1vdfA00
1FBMA 3V2PA 3V2NA 3V2RA 1MZ9A 3V2QA 1VDFA 1DEBA
chains in the Genus database with same CATH superfamily
3SWKA 2XU6A 3AE7C 3L72D 2GUSA 1SQVJ 3SFEC 2K9JB 3VMYA 2KIKA 2PFXA 1HH0A 4D6TJ 1SQQE 1H8AA 1NAFA 1SQPK 1Q82Q 5CMZA 1S9KD 5APVA 3SFDC 5B5EE 3G4SP 2G3AA 1YYCA 1L0ND 1R5LA 1SFCC 5CCHA 2YIUC 1L2PA 3TGUG 1JM0A 3CWBG 2Q7CA 3GG2A 5KLIB 4GT1A 2M0BA 1GTWA 2FBWC 1VQLP 3C8VA 2FYUD 2A06E 2P7JA 3H1JJ 4ZKPA 4BRYB 3MTUE 2KS1B 2Q9IA 1L4AA 3TGUJ 3UIAA 4RJTA 3CCJP 3K5BA 4WB4A 3CWBJ 1M8OB 1IC2A 3O6QA 1LTTC 2IBZI 3P7KA 3RL0D 4KJMA 2N1TA 2POHA 1S2EA 1IFJA 1VPCA 2MJZA 3KXDA 3NMDA 1OVVA 2IYOA 3RBZA 1SQQD 3WUUA 1JO5A 1YHQP 1GK4A 2QSIA 4KHXA 1YBKA 1MUUA 3AE5C 1RF1A 1CSBA 3MUDC 2YXRB 3QWOC 3QH9A 4WY4C 3KHUA 1M1JC 3NXSA 1PPJG 3H32A 2ZYDA 2A06D 5H2FH 1OFCX 1SQPE 3C9IA 3R4YA 4TT3H 2E74B 2B9BA 3CCQP 5H2FE 1GD2E 3RK3E 2N9YB 1PV3A 1JCDA 4W7YA 1X8YA 3BRVB 5KAIH 2XNDH 5TJHA 2D2CC 4WY4B 2WWWA 5AW5B 1K73Q 1K8AQ 5L8RJ 1VQOP 3M9BA 1YIJP 2OTJP 3KZIH 1JTHB 3AEEC 1N7SD 5AVZB 5CCGA 4HJGH 1PGPA 3CD6P 2QJPB 2RMZA 1OX3A 2V7QH 1NTMG 1LGHB 2AEMA 4QMAA 3FWLA 4W80A 1CI6B 3OJAB 1SQPD 1S72P 2K88A 4PV1C 1GU5A 2CK3H 1X9VA 1VF5B 3E1RA 3Q5SA 3Q5PA 3RK3D 1S5LX 1N73B 1FZGA 1NTMJ 4LLHA 2WT7A 4N3YB 3GF7A 3MD0A 2ZYGA 3M0DC 3RL0g 1KYOH 4N78E 2OARA 1FZAA 1AA0A 2JKVA 3AE4C 4PV1B 1N2DC 5B66E 2SPZA 3D6ZA 5BVZA 5KLVG 3MIWA 3A2AA 2J59M 1G2CA 3PH0A 2E75C 2VRSA 1KYOI 2E42A 3B5ND 4H0LB 4EYYQ 1EDJA 4I1LA 4IFFA 4Z1MH 5KLVJ 3W67A 2O01N 4IFMA 1L0LK 3WMM0 3CL3D 3HUSC 4L76A 3RK2C 2NPSC 1Q81Q 4NPDA 1OXZA 1RH5B 1BSNA 4N78D 3JC22 3S4RA 2E75B 1KN7A 3II6A 2ZVOB 1QL1A 1AJYA 4JQ0D 1EZVI 5M1BA 2M3BA 3W68A 3L72G 4UB8H 2Y0CA 5KJ7D 4H13C 2HPCA 1RF1C 2KYVA 5AVRB 2H43A 4OGQC 1KILE 1L4AB 1N7SA 2WVRA 2WZ7A 1RY3A 3AECC 1JEKA 3H1IJ 3JCUH 3O6QB 3L72J 2N1TB 1MFZA 4YTPC 2FYUG 1JY3P 2YKPA 1DH3A 3CC4P 1KC8Q 2FXMA 2WPRA 3D6YA 2YKOA 3IFMA 1RF1B 3M06A 4AYCA 4HB1A 4C7NA 2WPSA 1YJNP 4OGQB 2FXOA 1FZCA 4U3FE 3M9QA 2FYUJ 1YJWP 2KXPB 1H89A 1GZLA 1LT9A 1FC2C 3H32B 2E5TA 3NTNA 2E76B 2RH0A 3CCVP 2DW3A 2NRGA 1SQQG 2H8PD 1KILD 1XTGB 1U7MA 1VQ9P 1AQTA 1BDCA 3AE3C 3V2NA 2C0WA 5APQA 3USSA 4H44D 3TSIA 4PD4I 5APUA 1OMIA 4GOEA 1M56D 2WSFH 3CX5H 1IO4A 1J1EB 4I7ZC 1PP9G 5AW2B 3Q1MA 1M57D 1SQQJ 2IBZG 2WSSH 3B5NA 4N6JA 1DEEG 4L73A 2O3JA 3L73E 2A45H 5APXA 3L74E 2FYNB 1PP9J 2WSCH 1LTAC 2WPVB 4U3FD 2IX7C 2IFNA 1J2JB 2W8ZA 4JYBA 1HWTC 3CX5I 1PZQA 2W83C 4PJ0H 2HR3A 3H1HD 1KD1Q 2Q3IA 1PGOA 1JY2N 2B89A 4L75A 2LXCB 4PJ0E 1IFNA 1KTMA 2NZ2A 2HYNA 2ZXEB 3EWKA 3AEFC 1GL2D 1LNQA 2QA4P 1KB9E 5GTIH 2WT7B 3D70A 2XV5A 2AEJA 2QIWA 3TDKA 1CZQA 5DJUB 5KJ7A 5AW9B 1SQBK 2B87A 1FZEA 1SQXK 1K9MQ 1SQPG 1P84H 2IYPA 3L73D 1KZUB 3CXHI 1ZR4A 3CCMP 3BRTB 2L91A 3V4WA 3L74D 4MN4C 1JUNA 4HH2A 3RL0B 5AVXB 3HTKA 4OH8B 2KK7A 1PP9E 4ASVA 2JO1A 4B86A 1SQPJ 1G2CB 2Y0EA 1PGQA 1D7MA 1USDA 3F89A 2IBZE 1H88A 2LXBA 2QVAA 1QL2A 3IF4A 4R4MA 1P84I 3S1KA 4A7PA 1LP1A 4C46A 1NH4A 1W5CE 2G8YA 1KB9D 2P1JA 4XFJA 1JNMA 4IOIH 4IL6X 3VP9A 2M5AA 1OWAA 1GDTA 1URQD 1KMIZ 3GF3A 2LR2A 1HUCA 1KILA 2E74C 1GW3A 3CPWO 1KQFB 3GHGA 2I1JA 3HE4A 2KB7P 3N7NA 2Q5UA 2KSEA 2OYHA 3B4SA 2KI7B 1NJIQ 1PP9D 4W7ZA 2V7QJ 3L4FA 4WWIA 4YPCA 1A02F 2HPCB 1SQXE 1YTZI 3EFGA 2IBZD 3R2PA 1N7SB 1OIPA 2QEXP 1FZCC 2ZJSE 2YO2A 1RF0A 1LT9C 2QJPC 2JWDA 3KYQA 4ASWA 2W27A 4GODA 5CBNA 1VQNP 3IN6A 3V2PA 4EI2A 2KNCA 1SFCD 2H7HA 2QJYB 3L71E 1U7JA 3V6IA 1Q90D 2PGDA 4JF7A 2M8RA 1VF5C 1K05A 5KAIE 1LWUA 2ZT9C 1Q2NA 1FJKA 1N73C 1OW7A 3ITKA 2ZVNB 1FZCB 3Q2YA 1X79B 2PP6A 3G71P 1ZP0C 1NTZK 2WSEH 2P2UA 1LT9B 2ZFCA 3KZIE 3C1LA 2K3RA 3GMAA 2N9BA 3MHVA 2E5YA 2O1KA 1SQXD 1MZ9A 3CI9A 4LGDE 4ZNCA 4IL6H 3N4XA 1H0TA 1HGZA 3IR9A 4XA4A 2ZT9B 2Y9YA 2OYIA 1T2KD 2M3EA 1GMJA 5CJ4A 4UB6H 1IZNB 3L71D 1VQKP 3P32A 4JYCA 1FZBA 3BCCD 3V2QA 4DJGA 1VQPP 2KP8A 3B5NB 5APWA 4JBZA 4H0LC 3SWYA 2JDIH 4UB6E 5AVYB 3G3ZA 3L35A 1JY2O 1UIIA 5DJTB 2QM8A 3LIEA 3H25A 5KJ7C 1KYOE 3IAOA 3HD7D 1G1JA 3O8ZA 2LKMA 3AE1C 4GKGA 3HRNA 1YITP 3B8EB 3P8MC 1TU3F 1URQA 1LT1A 3KPEA 3M91A 1LTSC 1GU4A 3E7KA 4BXLA 1CW5A 2D2CD 4ZMDA 3P8CE 3M9HA 4C7RA 3G9RA 1FJPA 2HODA 1KORA 5CCHC 1XTCC 2H88C 4U3FG 2QJKB 1L0LG 2IZ1A 3SSUA 3PJSK 3CCRP 2FXPA 1QGKB 5C39A 2B87B 1EZVE 1NTKK 3H1HG 2WPQA 3FGAD 1L4AC 1T6AA 2BCCG 3U1AA 3U1CA 1OW6A 4U3FJ 3H1KE 3JSVC 1KYOD 1L0LJ 3HTKB 2N1TC 3VN0A 1N7LA 1IFPA 2FY8A 2PRRA 1ZXGA 4XE5B 4U7JA 1RE4A 1SFCA 3H1HJ 5AVUB 2JJLA 3GHGC 2Q1KA 2BCCJ 5AVWB 2O01H 1LTGC 4DOJA 3P8CD 3L73G 2I8DA 1S5LH 1NO4A 3PRJA 1LP1B 4UB8E 2P10A 3L74G 1EDIA 2M5AB 3ZDMA 1VQMP 2A45G 3AE2C 4GDOA 1JCCA 1S5LE 3I56P 3L75E 2OGUA 4Y28J 2E76C 2YMKA 2IPPA 3AEGC 3T97A 1EZVD 4I2LC 3A0BH 2IZ0A 3L73J 1S4XA 1KILB 3JCUE 5AW6B 4WVZA 3ABVC 3GHGB 3L74J 3HE4B 1YQ3C 1VQ8P 2R3CA 4H44B 2AXCA 5KTBA 2GUVA 1YQ4C 3A0BE 1L0NK 3KQGA 3TNUA 5BU5A 4PD4H 3H1KD 2OYHB 1J1EC 1WRGA 1PFIA 2FFDA 3MUDA 2WSCJ 3PP5A 1FS0E 4DZOA 4PD4E 3AE6C 1NWQA 1KQGB 1L0LE 3D71A 1LWUC 1M1JA 1NTKE 3BASA 2PAJA 5APTA 1ZMEC 3H1HE 3A0HH 2W90A 3AE9C 3RK2D 4EOTA 1GW4A 2NPSD 1M7LA 2FYNC 2BCCE 1JOCA 3SWFA 1FDMA 1QVGO 5AVSB 5CCGC 3EFFK 3HD7A 1PIXA 3A0HE 2FKWB 4I6MC 2GA1A 3L75D 1X0TA 1OZHA 2L5GB 1Q7YQ 2E43A 1RQVA 2KNCB 2R32A 1JY3N 1QVFO 2O1JA 1ZR2A 1IK9A 2C9LY 2RN0A 1JY2P 1LJ2A 3CX5E 1LWUB 3HE5A 3BATA 1BSHA 3A3YB 4H13D 1OW8A 2XKMA 1ZLLA 1EDLA 4OGQD 1J1DC 1NOHA 4PD4D 1L0LD 1FAVA 1FU1A 1NTKD 4L74A 2YMYA 3LW5H 1JB0J 4HYTB 3OAKA 2JP3A 2KOGA 1BGYD 5E79H 3I55P 3NFQA 4R4LA 3CXHH 5AW8B 2BCCD 1KQLA 2W6AA 1KV4A 1UIXA 1H0TB 1ZW0A 3RL0C 3AEAC 1URQC 5E79E 1SLQA 2Y0DA 3WU2H 3Q3DA 3FX0A 1YJ9P 1J1DB 4Y99C 1SQBG 1DX7A 1IFIA 1K04A 3WU2E 3CMEP 1SQXG 5GTIE 3CX5D 1SQVK 3V5BA 1PGJA 3L70G 4LC1A 1MV8A 2K1AA 1P84E 2YXQB 1KQSO 4YXWH 1SQBJ 1URQB 1SQXJ 1LTIC 3U59A 4AQRD 3L71G 5B5EH 1W2BO 3BCCG 3H1JG 1KB9I 4DCKA 1AFOA 5TISH 3E1IA 4Y99B 1SP4A 2HODB 5AW7B 3L70J 3AE8C 1FE6A 1RE4C 1GK6A 3LIDA 5TISE 4RKUJ 3CXHD 1RQUA 3V2RA 3L71J 2BEZF 2WITA 2I1KA 3BCCJ 1X22A 1DEBA 3FWNA 1M1KQ 2HLOA 5CHXA 3HUSA 1N7SC 2NPSA 1BCCE 1DIPA 1BE3G 3CC2P 4IFDK 1RE3A 4JPZB 2KLVA 4EIJA 1P84D 1SFCB 2QJYC 2YIUB 4WBAA 1NYHA 2WSEJ 5AVVB 1BE3J 1SQBE 1SQVE 3RK3C 3VTPC 3F5HA 2R44A 4D6TE 4YXDC 2FFDC 1T2KC 1JMMA 1E79H 1Y47A 3G6EP 3OW2O 3L70E 2KLUA 3FXEA 4GIFA 1NAYA 2OQQA 4CPGA 5AW0B 3L36A 3OA7A 3T97B 1JMBA 1YTZT 2W6JH 2Q3EA 1R5SA 3HD7C 2JR8A 2GM4A 3BCCE 3H1JE 1BCCD 5K5GB 3TYYA 3TNUB 4DT0A 3RK3B 2QE7H 1GL2A 1AQ5A 1VQ5P 5KKZC 2FFDB 4C7NB 1ZRTE 3TGUE 1VQ7P 2QG4A 1A02J 3VMXA 1NTZG 3CWBE 4GOFA 1HF9A 1M1JB 1HBWA 3B5NC 4TLFA 3TK1A 1EZVG 1NGMB 1T8ZA 4KT0J 3I5CA 1FDOA 1SQBD 1Z56A 1SQVD 1VDFA 1JY3O 1WMKA 3CLQA 3FXDA 4HKZH 1MKMA 4D6TD 1BE3E 2E74D 3HD7B 4AUWA 3Q5RA 1M90Q 1NTZJ 3H1KG 3L37A 1W2EA 3L70D 1T3UA 3MZWB 1NTMK 1MFTA 5KKZB 4IL6E 3VP8A 1HJ0A 3PLNA 2D2CB 1HVVA 4WY4D 1LTJA 3TF5A 2J58A 1HTLC 3H1JD 3HE5B 3EQ2A 1BDDA 3H1KJ 2ITAA 1EDKA 2FYZA 2QJKC 1ZRTD 3TGUD 1NU1G 3CWBD 3L75G 1PPJE 1NU1K 1S3JA 2K9JA 5B66H 3VYIA 2P58A 2BASA 4BWNA 2O01J 1YI2P 2YKQA 3VOPA 1BE3D 2QRXA 1VF5D 3VMAA 3V4QA 1NU1J 4NPEA 3L75J 3CC7P 2ZT9D 1AVYA 2C0XA 2OYOA 1NKZB 3PHLA 1KFMA 5GTHH 5KLVK 1EC5A 3WUTA 1NTZE 1ZV8A 1VQ6P 3S9OA 1NTKG 2R5BA 5GTHE 2WMMA 1EQ7A 1BGYG 2J5UA 1DD4A 4BRYA 5AW4B 2KS1A 1FZFA 2HG5D 1HGVA 2W6BA 2KZJA 1Y9BA 4PV1D 2KZIA 3WUVA 1NVOA 3MGNA 1NTKJ 1NTME 1ZN5A 1PPJD 3AEDC 3KDPB 3H1LG 1KILC 1QLED 1BGYJ 2CPSA 3AEBC 1RE3C 4H44C 1AVOA 2IFMA 1DD3A 1IK7A 2OYHC 1PL5A 2MKVA 4H0LD 4OVNF 1SS1A 4NPFX 1G1IA 5APSA 2XZRA 3H1IG 2YO3A 3H1LJ 1EXIA 4K3AA 3BVHA 2H89C 1NTZD 1NU1E 1OVUA 2R5DA 2WSFJ 3CCEP 3HUSB 4OWFA 1IJDB 1QX8A 3RK2B 2NPSB 1FOSF 1ZOYC 5EFWB 2Z5IA 1Q86Q 1RF0C 1AV1A 3GLMA 1L0NG 2QM7A 4O9BA 2E75D 1U57A 3RBXA 5CBOA 5CCHD 5KAFH 3MP7B 5KLVE 3RGUA 1SVFA 1NTMD 2V4HA 2FYUK 2XNXA 4WY4A 1N8RQ 2JEEA 5KAFE 1OVRA 1L0NJ 3LW5J 1GL2C 4H13B 2K37A 5AVQB 1BGYE 1JTHA 3CCUP 1L4AD 2ZXXA 1IFMA 2KUBA 1NKNA 1R8EA 4EDFA 1QEXA 4ZKUA 4RO0A 3VMZA 1NU1D 4M3LA 2BEQD 2R3SA 2WQYC 2UWJE 2N1TD 2Z4EA 3H1LE 2WTYA 1CI6A 5BU8B 1VQ4P 2YNYA 1SQQK 1USEA 2Z5HA 1HJBA 2P67A 2Q6QA 1GL2B 2RKLA 2OYIC 1WT6A 1N73A 2AEFA 3H6PA 1E5WA 3H1IE 5KLVD 1VL2A 1LTJC 1LTBC 1T3JA 2A06G 3L72E 3PTZA 1FDIA 2ZAEB 1RHZB 2E76D 3M0AA 2CPBA 1BCCG 5CJ0A 1S9KE 1NHLA 2B88A 2OTKE 1L0NE 2AXTH 3A5TA 3B71A 5AW3B 3CXHE 1N86A 2OYIB 2FYUE 4I7ZB 3CMAP 1EXJA 5APYA 2Y9ZA 2AXTE 3H1LD 1BCCJ 1FOSE 2K9YA 1KB9H 1LTJB 3CCLP 1S1CX 1SQVG 3A7OA 2ZYAA 3M0DA 4RESB 1FBMA 1IFDA 4D6TG 2A45I 3GW6A 1KFNA 2C9NY 2IDBA 2HFED 2JWAA 2KSJA 2XDJA 5KLIC 5AW1B 5AVTB 2OTLP 3CCSP 4K35A 5CCGD 3H1ID 1Y8AA
chains in the Genus database with same CATH topology
1YTZT 4C7RA 2XU6A 1FJPA 2HODA 3HD7C 1FZCA 2GUSA 5CCHC 2GM4A 3M9QA 3VMYA 1H89A 1GZLA 1HH0A 1LT9A 1XTCC 3H32B 3TYYA 1H8AA 3TNUB 1NAFA 1SQPK 3RK3B 3NTNA 5CMZA 1GL2A 1AQ5A 1S9KD 4C7NB 2FFDB 2H8PD 5APVA 1A02J 3VMXA 1KILD 1XTGB 1NTKK 1YYCA 2WPQA 1SFCC 5CCHA 1L4AC 3V2NA 2C0WA 5APQA 1M1JB 1HBWA 3TSIA 3B5NC 3TK1A 2Q7CA 5APUA 1T8ZA 3U1AA 3I5CA 4GT1A 2WSFH 1Z56A 3U1CA 1GTWA 1VDFA 1JY3O 3CLQA 1IO4A 1J1EB 2P7JA 4ZKPA 5AW2B 3HTKB 2N1TC 3VN0A 1N7LA 3HD7B 4AUWA 3MTUE 4XE5B 2Q9IA 1RE4A 1SFCA 5AVUB 1L4AA 3L37A 2JJLA 1W2EA 3B5NA 3GHGC 4N6JA 3UIAA 5AVWB 1T3UA 4WB4A 2O01H 2A45H 5APXA 1NTMK 1LTGC 1IC2A 3VP8A 4DOJA 1LTTC 3P7KA 3RL0D 3P8CD 2WSCH 1LTAC 2N1TA 2POHA 1HVVA 4WY4D 1LTJA 1NO4A 1IFJA 1VPCA 2IFNA 2IX7C 2MJZA 2J58A 1HTLC 3NMDA 3HE5B 3EQ2A 1J2JB 4JYBA 1HWTC 1JO5A 1GK4A 2A45G 4KHXA 1JCCA 2FYZA 2Q3IA 1JY2N 1MUUA 1RF1A 2IPPA 1CSBA 3T97A 4I2LC 1IFNA 1KILB 5AW6B 4C7NA 1NU1K 4WY4C 2HYNA 2ZXEB 3GHGB 3HE4B 1GL2D 1M1JC 2R3CA 3NXSA 5KTBA 3VYIA 2WT7B 2GUVA 2BASA 3H32A 1L0NK 3KQGA 2XV5A 3TNUA 5BU5A 2OYHB 2YKQA 1CZQA 1J1EC 3VOPA 5KJ7A 1WRGA 1PFIA 2FFDA 5AW9B 3MUDA 3C9IA 1SQBK 3PP5A 3V4QA 1FZEA 4DZOA 1NWQA 1SQXK 1LWUC 1GD2E 2C0XA 1M1JA 1NKZB 1KFMA 5KLVK 3BASA 2PAJA 1JCDA 1KZUB 5APTA 4W7YA 1ZR4A 3BRTB 3V4WA 1X8YA 1ZV8A 3BRVB 3RK2D 4EOTA 1GW4A 2NPSD 2R5BA 1M7LA 1JUNA 4HH2A 1JOCA 3SWFA 1FDMA 3RL0B 5AVXB 3HTKA 5AVSB 5CCGC 1EQ7A 3HD7A 4OH8B 4WY4B 2WWWA 5AW5B 5AW4B 2FKWB 4I6MC 1FZFA 2HG5D 1HGVA 2W6BA 4B86A 1G2CB 3M9BA 1JTHB 2L5GB 1H88A 2E43A 2R32A 1N7SD 1JY3N 5AVZB 2O1JA 3MGNA 1ZR2A 1IK9A 1QL2A 2C9LY 1JY2P 5CCGA 1ZN5A 3KDPB 1KILC 1LWUB 2CPSA 1NH4A 4C46A 3HE5A 3BATA 3A3YB 1LGHB 2P1JA 1JNMA 1RE3C 1ZLLA 2XKMA 3VP9A 2IFMA 4W80A 1CI6B 2OYHC 3OJAB 1OWAA 1J1DC 1NOHA 1GU5A 1GDTA 1URQD 1X9VA 1G1IA 5APSA 2XZRA 1HUCA 1KILA 2YO3A 1GW3A 1FAVA 3RK3D 1FU1A 3GHGA 2I1JA 2YMYA 3LW5H 3HE4A 4HYTB 3BVHA 1N73B 2KB7P 1FZGA 2R5DA 3OAKA 4LLHA 2WT7A 2KOGA 3N7NA 2Q5UA 4N3YB 3NFQA 2OYHA 3HUSB 1IJDB 5AW8B 3RK2B 3MD0A 2NPSB 1KQLA 2W6AA 1FOSF 3M0DC 3RL0C 2Z5IA 1RF0C 1URQC 1SLQA 4W7ZA 2QM7A 3L4FA 4N78E 4O9BA 1A02F 2HPCB 1YTZI 2OARA 3EFGA 1FZAA 1J1DB 3R2PA 4Y99C 5CCHD 1N7SB 1DX7A 1IFIA 1N2DC 1FZCC 1SVFA 2YO2A 5BVZA 1SQVK 1RF0A 2FYUK 3V5BA 1LT9C 2XNXA 4WY4A 3MIWA 2JEEA 3KYQA 3A2AA 2W27A 2J59M 1GL2C 1G2CA 3V2PA 4LC1A 5AVQB 1MV8A 1JTHA 1SFCD 2H7HA 1L4AD 2VRSA 1IFMA 2E42A 3B5ND 1URQB 4JF7A 2M8RA 1NKNA 4I1LA 4IFFA 1LTIC 3U59A 4AQRD 1LWUA 4ZKUA 3VMZA 1FJKA 4M3LA 1AFOA 1N73C 2N1TD 2Z4EA 3E1IA 4IFMA 4Y99B 1SP4A 1L0LK 3WMM0 2HODB 2WTYA 1CI6A 5BU8B 5AW7B 1FZCB 3CL3D 2YNYA 3HUSC 1X79B 1SQQK 3RK2C 1RE4C 1GK6A 2NPSC 2PP6A 1NTZK 2WSEH 2P2UA 1LT9B 2ZFCA 3LIDA 2Z5HA 1HJBA 1OXZA 4N78D 2N9BA 3V2RA 2P67A 2O1KA 1GL2B 2WITA 2I1KA 2OYIC 1WT6A 1N73A 3H6PA 1MZ9A 1E5WA 1DEBA 3II6A 3CI9A 2HLOA 1LTJC 1LTBC 1QL1A 5CHXA 1T3JA 3HUSA 1N7SC 4LGDE 2NPSA 3N4XA 1HGZA 3IR9A 2M3BA 4IFDK 4XA4A 3M0AA 5KJ7D 2CPBA 1RE3A 5CJ0A 2OYIA 1T2KD 2HPCA 2KLVA 1S9KE 1RF1C 5CJ4A 2KYVA 1NHLA 5AVRB 4EIJA 2H43A 3P32A 4JYCA 1SFCB 1FZBA 1L4AB 1N7SA 4WBAA 3V2QA 2KP8A 2WZ7A 3B5NB 1RY3A 5APWA 3SWYA 3A5TA 5AVVB 5AW3B 5AVYB 3G3ZA 3L35A 1N86A 1JY2O 3RK3C 2OYIB 2QM8A 5APYA 3LIEA 5KJ7C 3VTPC 1FOSE 2FFDC 2N1TB 3HD7D 1G1JA 1LTJB 3O8ZA 1T2KC 1MFZA 2LKMA 1JMMA 4GKGA 3HRNA 3A7OA 1JY3P 2YKPA 3B8EB 3M0DA 3P8MC 4RESB 1DH3A 1FBMA 1IFDA 2A45I 1URQA 1KFNA 2C9NY 2FXMA 2HFED 3KPEA 1LTSC 3M91A 1GU4A 4GIFA 2KSJA 2XDJA 2WPRA 5AW1B 2YKOA 3IFMA 5AVTB 5AW0B 1RF1B 3L36A 3M06A 4AYCA 3OA7A 5CCGD 1CW5A 2WPSA 3P8CE 3M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBM A;  3V2P A;  3V2N A;  3V2R A;  1MZ9 A;  3V2Q A;  1VDF A;  1DEB A; 
#chains in the Genus database with same CATH topology
 3SWK A;  2XU6 A;  3AE7 C;  3L72 D;  2GUS A;  1SQV J;  3SFE C;  2K9J B;  3VMY A;  2KIK A;  2PFX A;  1HH0 A;  4D6T J;  1SQQ E;  1H8A A;  1NAF A;  1SQP K;  1Q82 Q;  5CMZ A;  1S9K D;  5APV A;  3SFD C;  5B5E E;  3G4S P;  2G3A A;  1YYC A;  1L0N D;  1R5L A;  1SFC C;  5CCH A;  2YIU C;  1L2P A;  3TGU G;  1JM0 A;  3CWB G;  2Q7C A;  3GG2 A;  5KLI B;  4GT1 A;  2M0B A;  1GTW A;  2FBW C;  1VQL P;  3C8V A;  2FYU D;  2A06 E;  2P7J A;  3H1J J;  4ZKP A;  4BRY B;  3MTU E;  2KS1 B;  2Q9I A;  1L4A A;  3TGU J;  3UIA A;  4RJT A;  3CCJ P;  3K5B A;  4WB4 A;  3CWB J;  1M8O B;  1IC2 A;  3O6Q A;  1LTT C;  2IBZ I;  3P7K A;  3RL0 D;  4KJM A;  2N1T A;  2POH A;  1S2E A;  1IFJ A;  1VPC A;  2MJZ A;  3KXD A;  3NMD A;  1OVV A;  2IYO A;  3RBZ A;  1SQQ D;  3WUU A;  1JO5 A;  1YHQ P;  1GK4 A;  2QSI A;  4KHX A;  1YBK A;  1MUU A;  3AE5 C;  1RF1 A;  1CSB A;  3MUD C;  2YXR B;  3QWO C;  3QH9 A;  4WY4 C;  3KHU A;  1M1J C;  3NXS A;  1PPJ G;  3H32 A;  2ZYD A;  2A06 D;  5H2F H;  1OFC X;  1SQP E;  3C9I A;  3R4Y A;  4TT3 H;  2E74 B;  2B9B A;  3CCQ P;  5H2F E;  1GD2 E;  3RK3 E;  2N9Y B;  1PV3 A;  1JCD A;  4W7Y A;  1X8Y A;  3BRV B;  5KAI H;  2XND H;  5TJH A;  2D2C C;  4WY4 B;  2WWW A;  5AW5 B;  1K73 Q;  1K8A Q;  5L8R J;  1VQO P;  3M9B A;  1YIJ P;  2OTJ P;  3KZI H;  1JTH B;  3AEE C;  1N7S D;  5AVZ B;  5CCG A;  4HJG H;  1PGP A;  3CD6 P;  2QJP B;  2RMZ A;  1OX3 A;  2V7Q H;  1NTM G;  1LGH B;  2AEM A;  4QMA A;  3FWL A;  4W80 A;  1CI6 B;  3OJA B;  1SQP D;  1S72 P;  2K88 A;  4PV1 C;  1GU5 A;  2CK3 H;  1X9V A;  1VF5 B;  3E1R A;  3Q5S A;  3Q5P A;  3RK3 D;  1S5L X;  1N73 B;  1FZG A;  1NTM J;  4LLH A;  2WT7 A;  4N3Y B;  3GF7 A;  3MD0 A;  2ZYG A;  3M0D C;  3RL0 g;  1KYO H;  4N78 E;  2OAR A;  1FZA A;  1AA0 A;  2JKV A;  3AE4 C;  4PV1 B;  1N2D C;  5B66 E;  2SPZ A;  3D6Z A;  5BVZ A;  5KLV G;  3MIW A;  3A2A A;  2J59 M;  1G2C A;  3PH0 A;  2E75 C;  2VRS A;  1KYO I;  2E42 A;  3B5N D;  4H0L B;  4EYY Q;  1EDJ A;  4I1L A;  4IFF A;  4Z1M H;  5KLV J;  3W67 A;  2O01 N;  4IFM A;  1L0L K;  3WMM 0;  3CL3 D;  3HUS C;  4L76 A;  3RK2 C;  2NPS C;  1Q81 Q;  4NPD A;  1OXZ A;  1RH5 B;  1BSN A;  4N78 D;  3JC2 2;  3S4R A;  2E75 B;  1KN7 A;  3II6 A;  2ZVO B;  1QL1 A;  1AJY A;  4JQ0 D;  1EZV I;  5M1B A;  2M3B A;  3W68 A;  3L72 G;  4UB8 H;  2Y0C A;  5KJ7 D;  4H13 C;  2HPC A;  1RF1 C;  2KYV A;  5AVR B;  2H43 A;  4OGQ C;  1KIL E;  1L4A B;  1N7S A;  2WVR A;  2WZ7 A;  1RY3 A;  3AEC C;  1JEK A;  3H1I J;  3JCU H;  3O6Q B;  3L72 J;  2N1T B;  1MFZ A;  4YTP C;  2FYU G;  1JY3 P;  2YKP A;  1DH3 A;  3CC4 P;  1KC8 Q;  2FXM A;  2WPR A;  3D6Y A;  2YKO A;  3IFM A;  1RF1 B;  3M06 A;  4AYC A;  4HB1 A;  4C7N A;  2WPS A;  1YJN P;  4OGQ B;  2FXO A;  1FZC A;  4U3F E;  3M9Q A;  2FYU J;  1YJW P;  2KXP B;  1H89 A;  1GZL A;  1LT9 A;  1FC2 C;  3H32 B;  2E5T A;  3NTN A;  2E76 B;  2RH0 A;  3CCV P;  2DW3 A;  2NRG A;  1SQQ G;  2H8P D;  1KIL D;  1XTG B;  1U7M A;  1VQ9 P;  1AQT A;  1BDC A;  3AE3 C;  3V2N A;  2C0W A;  5APQ A;  3USS A;  4H44 D;  3TSI A;  4PD4 I;  5APU A;  1OMI A;  4GOE A;  1M56 D;  2WSF H;  3CX5 H;  1IO4 A;  1J1E B;  4I7Z C;  1PP9 G;  5AW2 B;  3Q1M A;  1M57 D;  1SQQ J;  2IBZ G;  2WSS H;  3B5N A;  4N6J A;  1DEE G;  4L73 A;  2O3J A;  3L73 E;  2A45 H;  5APX A;  3L74 E;  2FYN B;  1PP9 J;  2WSC H;  1LTA C;  2WPV B;  4U3F D;  2IX7 C;  2IFN A;  1J2J B;  2W8Z A;  4JYB A;  1HWT C;  3CX5 I;  1PZQ A;  2W83 C;  4PJ0 H;  2HR3 A;  3H1H D;  1KD1 Q;  2Q3I A;  1PGO A;  1JY2 N;  2B89 A;  4L75 A;  2LXC B;  4PJ0 E;  1IFN A;  1KTM A;  2NZ2 A;  2HYN A;  2ZXE B;  3EWK A;  3AEF C;  1GL2 D;  1LNQ A;  2QA4 P;  1KB9 E;  5GTI H;  2WT7 B;  3D70 A;  2XV5 A;  2AEJ A;  2QIW A;  3TDK A;  1CZQ A;  5DJU B;  5KJ7 A;  5AW9 B;  1SQB K;  2B87 A;  1FZE A;  1SQX K;  1K9M Q;  1SQP G;  1P84 H;  2IYP A;  3L73 D;  1KZU B;  3CXH I;  1ZR4 A;  3CCM P;  3BRT B;  2L91 A;  3V4W A;  3L74 D;  4MN4 C;  1JUN A;  4HH2 A;  3RL0 B;  5AVX B;  3HTK A;  4OH8 B;  2KK7 A;  1PP9 E;  4ASV A;  2JO1 A;  4B86 A;  1SQP J;  1G2C B;  2Y0E A;  1PGQ A;  1D7M A;  1USD A;  3F89 A;  2IBZ E;  1H88 A;  2LXB A;  2QVA A;  1QL2 A;  3IF4 A;  4R4M A;  1P84 I;  3S1K A;  4A7P A;  1LP1 A;  4C46 A;  1NH4 A;  1W5C E;  2G8Y A;  1KB9 D;  2P1J A;  4XFJ A;  1JNM A;  4IOI H;  4IL6 X;  3VP9 A;  2M5A A;  1OWA A;  1GDT A;  1URQ D;  1KMI Z;  3GF3 A;  2LR2 A;  1HUC A;  1KIL A;  2E74 C;  1GW3 A;  3CPW O;  1KQF B;  3GHG A;  2I1J A;  3HE4 A;  2KB7 P;  3N7N A;  2Q5U A;  2KSE A;  2OYH A;  3B4S A;  2KI7 B;  1NJI Q;  1PP9 D;  4W7Z A;  2V7Q J;  3L4F A;  4WWI A;  4YPC A;  1A02 F;  2HPC B;  1SQX E;  1YTZ I;  3EFG A;  2IBZ D;  3R2P A;  1N7S B;  1OIP A;  2QEX P;  1FZC C;  2ZJS E;  2YO2 A;  1RF0 A;  1LT9 C;  2QJP C;  2JWD A;  3KYQ A;  4ASW A;  2W27 A;  4GOD A;  5CBN A;  1VQN P;  3IN6 A;  3V2P A;  4EI2 A;  2KNC A;  1SFC D;  2H7H A;  2QJY B;  3L71 E;  1U7J A;  3V6I A;  1Q90 D;  2PGD A;  4JF7 A;  2M8R A;  1VF5 C;  1K05 A;  5KAI E;  1LWU A;  2ZT9 C;  1Q2N A;  1FJK A;  1N73 C;  1OW7 A;  3ITK A;  2ZVN B;  1FZC B;  3Q2Y A;  1X79 B;  2PP6 A;  3G71 P;  1ZP0 C;  1NTZ K;  2WSE H;  2P2U A;  1LT9 B;  2ZFC A;  3KZI E;  3C1L A;  2K3R A;  3GMA A;  2N9B A;  3MHV A;  2E5Y A;  2O1K A;  1SQX D;  1MZ9 A;  3CI9 A;  4LGD E;  4ZNC A;  4IL6 H;  3N4X A;  1H0T A;  1HGZ A;  3IR9 A;  4XA4 A;  2ZT9 B;  2Y9Y A;  2OYI A;  1T2K D;  2M3E A;  1GMJ A;  5CJ4 A;  4UB6 H;  1IZN B;  3L71 D;  1VQK P;  3P32 A;  4JYC A;  1FZB A;  3BCC D;  3V2Q A;  4DJG A;  1VQP P;  2KP8 A;  3B5N B;  5APW A;  4JBZ A;  4H0L C;  3SWY A;  2JDI H;  4UB6 E;  5AVY B;  3G3Z A;  3L35 A;  1JY2 O;  1UII A;  5DJT B;  2QM8 A;  3LIE A;  3H25 A;  5KJ7 C;  1KYO E;  3IAO A;  3HD7 D;  1G1J A;  3O8Z A;  2LKM A;  3AE1 C;  4GKG A;  3HRN A;  1YIT P;  3B8E B;  3P8M C;  1TU3 F;  1URQ A;  1LT1 A;  3KPE A;  3M91 A;  1LTS C;  1GU4 A;  3E7K A;  4BXL A;  1CW5 A;  2D2C D;  4ZMD A;  3P8C E;  3M9H A;  4C7R A;  3G9R A;  1FJP A;  2HOD A;  1KOR A;  5CCH C;  1XTC C;  2H88 C;  4U3F G;  2QJK B;  1L0L G;  2IZ1 A;  3SSU A;  3PJS K;  3CCR P;  2FXP A;  1QGK B;  5C39 A;  2B87 B;  1EZV E;  1NTK K;  3H1H G;  2WPQ A;  3FGA D;  1L4A C;  1T6A A;  2BCC G;  3U1A A;  3U1C A;  1OW6 A;  4U3F J;  3H1K E;  3JSV C;  1KYO D;  1L0L J;  3HTK B;  2N1T C;  3VN0 A;  1N7L A;  1IFP A;  2FY8 A;  2PRR A;  1ZXG A;  4XE5 B;  4U7J A;  1RE4 A;  1SFC A;  3H1H J;  5AVU B;  2JJL A;  3GHG C;  2Q1K A;  2BCC J;  5AVW B;  2O01 H;  1LTG C;  4DOJ A;  3P8C D;  3L73 G;  2I8D A;  1S5L H;  1NO4 A;  3PRJ A;  1LP1 B;  4UB8 E;  2P10 A;  3L74 G;  1EDI A;  2M5A B;  3ZDM A;  1VQM P;  2A45 G;  3AE2 C;  4GDO A;  1JCC A;  1S5L E;  3I56 P;  3L75 E;  2OGU A;  4Y28 J;  2E76 C;  2YMK A;  2IPP A;  3AEG C;  3T97 A;  1EZV D;  4I2L C;  3A0B H;  2IZ0 A;  3L73 J;  1S4X A;  1KIL B;  3JCU E;  5AW6 B;  4WVZ A;  3ABV C;  3GHG B;  3L74 J;  3HE4 B;  1YQ3 C;  1VQ8 P;  2R3C A;  4H44 B;  2AXC A;  5KTB A;  2GUV A;  1YQ4 C;  3A0B E;  1L0N K;  3KQG A;  3TNU A;  5BU5 A;  4PD4 H;  3H1K D;  2OYH B;  1J1E C;  1WRG A;  1PFI A;  2FFD A;  3MUD A;  2WSC J;  3PP5 A;  1FS0 E;  4DZO A;  4PD4 E;  3AE6 C;  1NWQ A;  1KQG B;  1L0L E;  3D71 A;  1LWU C;  1M1J A;  1NTK E;  3BAS A;  2PAJ A;  5APT A;  1ZME C;  3H1H E;  3A0H H;  2W90 A;  3AE9 C;  3RK2 D;  4EOT A;  1GW4 A;  2NPS D;  1M7L A;  2FYN C;  2BCC E;  1JOC A;  3SWF A;  1FDM A;  1QVG O;  5AVS B;  5CCG C;  3EFF K;  3HD7 A;  1PIX A;  3A0H E;  2FKW B;  4I6M C;  2GA1 A;  3L75 D;  1X0T A;  1OZH A;  2L5G B;  1Q7Y Q;  2E43 A;  1RQV A;  2KNC B;  2R32 A;  1JY3 N;  1QVF O;  2O1J A;  1ZR2 A;  1IK9 A;  2C9L Y;  2RN0 A;  1JY2 P;  1LJ2 A;  3CX5 E;  1LWU B;  3HE5 A;  3BAT A;  1BSH A;  3A3Y B;  4H13 D;  1OW8 A;  2XKM A;  1ZLL A;  1EDL A;  4OGQ D;  1J1D C;  1NOH A;  4PD4 D;  1L0L D;  1FAV A;  1FU1 A;  1NTK D;  4L74 A;  2YMY A;  3LW5 H;  1JB0 J;  4HYT B;  3OAK A;  2JP3 A;  2KOG A;  1BGY D;  5E79 H;  3I55 P;  3NFQ A;  4R4L A;  3CXH H;  5AW8 B;  2BCC D;  1KQL A;  2W6A A;  1KV4 A;  1UIX A;  1H0T B;  1ZW0 A;  3RL0 C;  3AEA C;  1URQ C;  5E79 E;  1SLQ A;  2Y0D A;  3WU2 H;  3Q3D A;  3FX0 A;  1YJ9 P;  1J1D B;  4Y99 C;  1SQB G;  1DX7 A;  1IFI A;  1K04 A;  3WU2 E;  3CME P;  1SQX G;  5GTI E;  3CX5 D;  1SQV K;  3V5B A;  1PGJ A;  3L70 G;  4LC1 A;  1MV8 A;  2K1A A;  1P84 E;  2YXQ B;  1KQS O;  4YXW H;  1SQB J;  1URQ B;  1SQX J;  1LTI C;  3U59 A;  4AQR D;  3L71 G;  5B5E H;  1W2B O;  3BCC G;  3H1J G;  1KB9 I;  4DCK A;  1AFO A;  5TIS H;  3E1I A;  4Y99 B;  1SP4 A;  2HOD B;  5AW7 B;  3L70 J;  3AE8 C;  1FE6 A;  1RE4 C;  1GK6 A;  3LID A;  5TIS E;  4RKU J;  3CXH D;  1RQU A;  3V2R A;  3L71 J;  2BEZ F;  2WIT A;  2I1K A;  3BCC J;  1X22 A;  1DEB A;  3FWN A;  1M1K Q;  2HLO A;  5CHX A;  3HUS A;  1N7S C;  2NPS A;  1BCC E;  1DIP A;  1BE3 G;  3CC2 P;  4IFD K;  1RE3 A;  4JPZ B;  2KLV A;  4EIJ A;  1P84 D;  1SFC B;  2QJY C;  2YIU B;  4WBA A;  1NYH A;  2WSE J;  5AVV B;  1BE3 J;  1SQB E;  1SQV E;  3RK3 C;  3VTP C;  3F5H A;  2R44 A;  4D6T E;  4YXD C;  2FFD C;  1T2K C;  1JMM A;  1E79 H;  1Y47 A;  3G6E P;  3OW2 O;  3L70 E;  2KLU A;  3FXE A;  4GIF A;  1NAY A;  2OQQ A;  4CPG A;  5AW0 B;  3L36 A;  3OA7 A;  3T97 B;  1JMB A;  1YTZ T;  2W6J H;  2Q3E A;  1R5S A;  3HD7 C;  2JR8 A;  2GM4 A;  3BCC E;  3H1J E;  1BCC D;  5K5G B;  3TYY A;  3TNU B;  4DT0 A;  3RK3 B;  2QE7 H;  1GL2 A;  1AQ5 A;  1VQ5 P;  5KKZ C;  2FFD B;  4C7N B;  1ZRT E;  3TGU E;  1VQ7 P;  2QG4 A;  1A02 J;  3VMX A;  1NTZ G;  3CWB E;  4GOF A;  1HF9 A;  1M1J B;  1HBW A;  3B5N C;  4TLF A;  3TK1 A;  1EZV G;  1NGM B;  1T8Z A;  4KT0 J;  3I5C A;  1FDO A;  1SQB D;  1Z56 A;  1SQV D;  1VDF A;  1JY3 O;  1WMK A;  3CLQ A;  3FXD A;  4HKZ H;  1MKM A;  4D6T D;  1BE3 E;  2E74 D;  3HD7 B;  4AUW A;  3Q5R A;  1M90 Q;  1NTZ J;  3H1K G;  3L37 A;  1W2E A;  3L70 D;  1T3U A;  3MZW B;  1NTM K;  1MFT A;  5KKZ B;  4IL6 E;  3VP8 A;  1HJ0 A;  3PLN A;  2D2C B;  1HVV A;  4WY4 D;  1LTJ A;  3TF5 A;  2J58 A;  1HTL C;  3H1J D;  3HE5 B;  3EQ2 A;  1BDD A;  3H1K J;  2ITA A;  1EDK A;  2FYZ A;  2QJK C;  1ZRT D;  3TGU D;  1NU1 G;  3CWB D;  3L75 G;  1PPJ E;  1NU1 K;  1S3J A;  2K9J A;  5B66 H;  3VYI A;  2P58 A;  2BAS A;  4BWN A;  2O01 J;  1YI2 P;  2YKQ A;  3VOP A;  1BE3 D;  2QRX A;  1VF5 D;  3VMA A;  3V4Q A;  1NU1 J;  4NPE A;  3L75 J;  3CC7 P;  2ZT9 D;  1AVY A;  2C0X A;  2OYO A;  1NKZ B;  3PHL A;  1KFM A;  5GTH H;  5KLV K;  1EC5 A;  3WUT A;  1NTZ E;  1ZV8 A;  1VQ6 P;  3S9O A;  1NTK G;  2R5B A;  5GTH E;  2WMM A;  1EQ7 A;  1BGY G;  2J5U A;  1DD4 A;  4BRY A;  5AW4 B;  2KS1 A;  1FZF A;  2HG5 D;  1HGV A;  2W6B A;  2KZJ A;  1Y9B A;  4PV1 D;  2KZI A;  3WUV A;  1NVO A;  3MGN A;  1NTK J;  1NTM E;  1ZN5 A;  1PPJ D;  3AED C;  3KDP B;  3H1L G;  1KIL C;  1QLE D;  1BGY J;  2CPS A;  3AEB C;  1RE3 C;  4H44 C;  1AVO A;  2IFM A;  1DD3 A;  1IK7 A;  2OYH C;  1PL5 A;  2MKV A;  4H0L D;  4OVN F;  1SS1 A;  4NPF X;  1G1I A;  5APS A;  2XZR A;  3H1I G;  2YO3 A;  3H1L J;  1EXI A;  4K3A A;  3BVH A;  2H89 C;  1NTZ D;  1NU1 E;  1OVU A;  2R5D A;  2WSF J;  3CCE P;  3HUS B;  4OWF A;  1IJD B;  1QX8 A;  3RK2 B;  2NPS B;  1FOS F;  1ZOY C;  5EFW B;  2Z5I A;  1Q86 Q;  1RF0 C;  1AV1 A;  3GLM A;  1L0N G;  2QM7 A;  4O9B A;  2E75 D;  1U57 A;  3RBX A;  5CBO A;  5CCH D;  5KAF H;  3MP7 B;  5KLV E;  3RGU A;  1SVF A;  1NTM D;  2V4H A;  2FYU K;  2XNX A;  4WY4 A;  1N8R Q;  2JEE A;  5KAF E;  1OVR A;  1L0N J;  3LW5 J;  1GL2 C;  4H13 B;  2K37 A;  5AVQ B;  1BGY E;  1JTH A;  3CCU P;  1L4A D;  2ZXX A;  1IFM A;  2KUB A;  1NKN A;  1R8E A;  4EDF A;  1QEX A;  4ZKU A;  4RO0 A;  3VMZ A;  1NU1 D;  4M3L A;  2BEQ D;  2R3S A;  2WQY C;  2UWJ E;  2N1T D;  2Z4E A;  3H1L E;  2WTY A;  1CI6 A;  5BU8 B;  1VQ4 P;  2YNY A;  1SQQ K;  1USE A;  2Z5H A;  1HJB A;  2P67 A;  2Q6Q A;  1GL2 B;  2RKL A;  2OYI C;  1WT6 A;  1N73 A;  2AEF A;  3H6P A;  1E5W A;  3H1I E;  5KLV D;  1VL2 A;  1LTJ C;  1LTB C;  1T3J A;  2A06 G;  3L72 E;  3PTZ A;  1FDI A;  2ZAE B;  1RHZ B;  2E76 D;  3M0A A;  2CPB A;  1BCC G;  5CJ0 A;  1S9K E;  1NHL A;  2B88 A;  2OTK E;  1L0N E;  2AXT H;  3A5T A;  3B71 A;  5AW3 B;  3CXH E;  1N86 A;  2OYI B;  2FYU E;  4I7Z B;  3CMA P;  1EXJ A;  5APY A;  2Y9Z A;  2AXT E;  3H1L D;  1BCC J;  1FOS E;  2K9Y A;  1KB9 H;  1LTJ B;  3CCL P;  1S1C X;  1SQV G;  3A7O A;  2ZYA A;  3M0D A;  4RES B;  1FBM A;  1IFD A;  4D6T G;  2A45 I;  3GW6 A;  1KFN A;  2C9N Y;  2IDB A;  2HFE D;  2JWA A;  2KSJ A;  2XDJ A;  5KLI C;  5AW1 B;  5AVT B;  2OTL P;  3CCS P;  4K35 A;  5CCG D;  3H1I D;  1Y8A A; 
#chains in the Genus database with same CATH homology
 1YTZ T;  4C7R A;  2XU6 A;  1FJP A;  2HOD A;  3HD7 C;  1FZC A;  2GUS A;  5CCH C;  2GM4 A;  3M9Q A;  3VMY A;  1H89 A;  1GZL A;  1HH0 A;  1LT9 A;  1XTC C;  3H32 B;  3TYY A;  1H8A A;  3TNU B;  1NAF A;  1SQP K;  3RK3 B;  3NTN A;  5CMZ A;  1GL2 A;  1AQ5 A;  1S9K D;  4C7N B;  2FFD B;  2H8P D;  5APV A;  1A02 J;  3VMX A;  1KIL D;  1XTG B;  1NTK K;  1YYC A;  2WPQ A;  1SFC C;  5CCH A;  1L4A C;  3V2N A;  2C0W A;  5APQ A;  1M1J B;  1HBW A;  3TSI A;  3B5N C;  3TK1 A;  2Q7C A;  5APU A;  1T8Z A;  3U1A A;  3I5C A;  4GT1 A;  2WSF H;  1Z56 A;  3U1C A;  1GTW A;  1VDF A;  1JY3 O;  3CLQ A;  1IO4 A;  1J1E B;  2P7J A;  4ZKP A;  5AW2 B;  3HTK B;  2N1T C;  3VN0 A;  1N7L A;  3HD7 B;  4AUW A;  3MTU E;  4XE5 B;  2Q9I A;  1RE4 A;  1SFC A;  5AVU B;  1L4A A;  3L37 A;  2JJL A;  1W2E A;  3B5N A;  3GHG C;  4N6J A;  3UIA A;  5AVW B;  1T3U A;  4WB4 A;  2O01 H;  2A45 H;  5APX A;  1NTM K;  1LTG C;  1IC2 A;  3VP8 A;  4DOJ A;  1LTT C;  3P7K A;  3RL0 D;  3P8C D;  2WSC H;  1LTA C;  2N1T A;  2POH A;  1HVV A;  4WY4 D;  1LTJ A;  1NO4 A;  1IFJ A;  1VPC A;  2IFN A;  2IX7 C;  2MJZ A;  2J58 A;  1HTL C;  3NMD A;  3HE5 B;  3EQ2 A;  1J2J B;  4JYB A;  1HWT C;  1JO5 A;  1GK4 A;  2A45 G;  4KHX A;  1JCC A;  2FYZ A;  2Q3I A;  1JY2 N;  1MUU A;  1RF1 A;  2IPP A;  1CSB A;  3T97 A;  4I2L C;  1IFN A;  1KIL B;  5AW6 B;  4C7N A;  1NU1 K;  4WY4 C;  2HYN A;  2ZXE B;  3GHG B;  3HE4 B;  1GL2 D;  1M1J C;  2R3C A;  3NXS A;  5KTB A;  3VYI A;  2WT7 B;  2GUV A;  2BAS A;  3H32 A;  1L0N K;  3KQG A;  2XV5 A;  3TNU A;  5BU5 A;  2OYH B;  2YKQ A;  1CZQ A;  1J1E C;  3VOP A;  5KJ7 A;  1WRG A;  1PFI A;  2FFD A;  5AW9 B;  3MUD A;  3C9I A;  1SQB K;  3PP5 A;  3V4Q A;  1FZE A;  4DZO A;  1NWQ A;  1SQX K;  1LWU C;  1GD2 E;  2C0X A;  1M1J A;  1NKZ B;  1KFM A;  5KLV K;  3BAS A;  2PAJ A;  1JCD A;  1KZU B;  5APT A;  4W7Y A;  1ZR4 A;  3BRT B;  3V4W A;  1X8Y A;  1ZV8 A;  3BRV B;  3RK2 D;  4EOT A;  1GW4 A;  2NPS D;  2R5B A;  1M7L A;  1JUN A;  4HH2 A;  1JOC A;  3SWF A;  1FDM A;  3RL0 B;  5AVX B;  3HTK A;  5AVS B;  5CCG C;  1EQ7 A;  3HD7 A;  4OH8 B;  4WY4 B;  2WWW A;  5AW5 B;  5AW4 B;  2FKW B;  4I6M C;  1FZF A;  2HG5 D;  1HGV A;  2W6B A;  4B86 A;  1G2C B;  3M9B A;  1JTH B;  2L5G B;  1H88 A;  2E43 A;  2R32 A;  1N7S D;  1JY3 N;  5AVZ B;  2O1J A;  3MGN A;  1ZR2 A;  1IK9 A;  1QL2 A;  2C9L Y;  1JY2 P;  5CCG A;  1ZN5 A;  3KDP B;  1KIL C;  1LWU B;  2CPS A;  1NH4 A;  4C46 A;  3HE5 A;  3BAT A;  3A3Y B;  1LGH B;  2P1J A;  1JNM A;  1RE3 C;  1ZLL A;  2XKM A;  3VP9 A;  2IFM A;  4W80 A;  1CI6 B;  2OYH C;  3OJA B;  1OWA A;  1J1D C;  1NOH A;  1GU5 A;  1GDT A;  1URQ D;  1X9V A;  1G1I A;  5APS A;  2XZR A;  1HUC A;  1KIL A;  2YO3 A;  1GW3 A;  1FAV A;  3RK3 D;  1FU1 A;  3GHG A;  2I1J A;  2YMY A;  3LW5 H;  3HE4 A;  4HYT B;  3BVH A;  1N73 B;  2KB7 P;  1FZG A;  2R5D A;  3OAK A;  4LLH A;  2WT7 A;  2KOG A;  3N7N A;  2Q5U A;  4N3Y B;  3NFQ A;  2OYH A;  3HUS B;  1IJD B;  5AW8 B;  3RK2 B;  3MD0 A;  2NPS B;  1KQL A;  2W6A A;  1FOS F;  3M0D C;  3RL0 C;  2Z5I A;  1RF0 C;  1URQ C;  1SLQ A;  4W7Z A;  2QM7 A;  3L4F A;  4N78 E;  4O9B A;  1A02 F;  2HPC B;  1YTZ I;  2OAR A;  3EFG A;  1FZA A;  1J1D B;  3R2P A;  4Y99 C;  5CCH D;  1N7S B;  1DX7 A;  1IFI A;  1N2D C;  1FZC C;  1SVF A;  2YO2 A;  5BVZ A;  1SQV K;  1RF0 A;  2FYU K;  3V5B A;  1LT9 C;  2XNX A;  4WY4 A;  3MIW A;  2JEE A;  3KYQ A;  3A2A A;  2W27 A;  2J59 M;  1GL2 C;  1G2C A;  3V2P A;  4LC1 A;  5AVQ B;  1MV8 A;  1JTH A;  1SFC D;  2H7H A;  1L4A D;  2VRS A;  1IFM A;  2E42 A;  3B5N D;  1URQ B;  4JF7 A;  2M8R A;  1NKN A;  4I1L A;  4IFF A;  1LTI C;  3U59 A;  4AQR D;  1LWU A;  4ZKU A;  3VMZ A;  1FJK A;  4M3L A;  1AFO A;  1N73 C;  2N1T D;  2Z4E A;  3E1I A;  4IFM A;  4Y99 B;  1SP4 A;  1L0L K;  3WMM 0;  2HOD B;  2WTY A;  1CI6 A;  5BU8 B;  5AW7 B;  1FZC B;  3CL3 D;  2YNY A;  3HUS C;  1X79 B;  1SQQ K;  3RK2 C;  1RE4 C;  1GK6 A;  2NPS C;  2PP6 A;  1NTZ K;  2WSE H;  2P2U A;  1LT9 B;  2ZFC A;  3LID A;  2Z5H A;  1HJB A;  1OXZ A;  4N78 D;  2N9B A;  3V2R A;  2P67 A;  2O1K A;  1GL2 B;  2WIT A;  2I1K A;  2OYI C;  1WT6 A;  1N73 A;  3H6P A;  1MZ9 A;  1E5W A;  1DEB A;  3II6 A;  3CI9 A;  2HLO A;  1LTJ C;  1LTB C;  1QL1 A;  5CHX A;  1T3J A;  3HUS A;  1N7S C;  4LGD E;  2NPS A;  3N4X A;  1HGZ A;  3IR9 A;  2M3B A;  4IFD K;  4XA4 A;  3M0A A;  5KJ7 D;  2CPB A;  1RE3 A;  5CJ0 A;  2OYI A;  1T2K D;  2HPC A;  2KLV A;  1S9K E;  1RF1 C;  5CJ4 A;  2KYV A;  1NHL A;  5AVR B;  4EIJ A;  2H43 A;  3P32 A;  4JYC A;  1SFC B;  1FZB A;  1L4A B;  1N7S A;  4WBA A;  3V2Q A;  2KP8 A;  2WZ7 A;  3B5N B;  1RY3 A;  5APW A;  3SWY A;  3A5T A;  5AVV B;  5AW3 B;  5AVY B;  3G3Z A;  3L35 A;  1N86 A;  1JY2 O;  3RK3 C;  2OYI B;  2QM8 A;  5APY A;  3LIE A;  5KJ7 C;  3VTP C;  1FOS E;  2FFD C;  2N1T B;  3HD7 D;  1G1J A;  1LTJ B;  3O8Z A;  1T2K C;  1MFZ A;  2LKM A;  1JMM A;  4GKG A;  3HRN A;  3A7O A;  1JY3 P;  2YKP A;  3B8E B;  3M0D A;  3P8M C;  4RES B;  1DH3 A;  1FBM A;  1IFD A;  2A45 I;  1URQ A;  1KFN A;  2C9N Y;  2FXM A;  2HFE D;  3KPE A;  1LTS C;  3M91 A;  1GU4 A;  4GIF A;  2KSJ A;  2XDJ A;  2WPR A;  5AW1 B;  2YKO A;  3IFM A;  5AVT B;  5AW0 B;  1RF1 B;  3L36 A;  3M06 A;  4AYC A;  3OA7 A;  5CCG D;  1CW5 A;  2WPS A;  3P8C E;  3M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...