1VDFA

Assembly domain of cartilage oligomeric matrix protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
46
structure length
46
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDACG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a five-stranded coiled coil in COMP: a prototype ion channel?
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Extracellular matrix protein
molecule keywords CARTILAGE OLIGOMERIC MATRIX PROTEIN
total genus 20
structure length 46
sequence length 46
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1996-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11598 COMP Cartilage oligomeric matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1vdfA00
1VDFA 3V2RA 1MZ9A 3V2NA 1FBMA 3V2PA 3V2QA 1DEBA
chains in the Genus database with same CATH superfamily
4UB8H 3F5HA 3V4WA 1AVYA 3WMM0 2YKPA 1GW3A 2AXTE 2KUBA 2HPCB 1SQPE 3M9QA 2CPSA 2OTKE 1Q82Q 3CCEP 3TGUJ 1Q81Q 3M0DA 2JJLA 3M0AA 4JYCA 3M06A 3U1CA 1P84I 1LTAC 4L75A 4UB6E 3SSUA 2E42A 1KB9E 3B5NB 1S3JA 2FXPA 3L35A 1N8RQ 1M57D 3M9BA 3T97A 4H13D 1NTKG 1RE4C 5AW8B 3CXHE 4YXDC 2A45I 1OZHA 2AEMA 2W83C 1JY3O 3H32A 2HYNA 2RKLA 2FYUE 5EFWB 2ZT9D 1HJ0A 1HH0A 3KXDA 1CI6B 1NVOA 3NMDA 4PV1C 3SFEC 1IFDA 1KILB 2PFXA 2WSSH 3L4FA 2XKMA 2KI7B 4WY4C 1N7LA 2QM7A 2WSCH 1SQPJ 1NJIQ 1YHQP 3TGUG 1QGKB 3PLNA 4CPGA 1LT9A 4WWIA 1M7LA 1XTGB 1JY2N 1CI6A 3KZIE 4H0LD 5DJUB 1YJNP 1M90Q 2KSJA 2GM4A 1QL2A 2WT7B 1NAYA 2RMZA 1JO5A 4EOTA 1BCCE 3R2PA 4XE5B 1OMIA 2IZ0A 5KLVD 1MUUA 1P84H 1RY3A 3KYQA 3GF7A 1E79H 4W7ZA 4ZNCA 2OYIA 4IFDK 2R32A 2QJYC 1OW7A 2IBZE 2QJKB 2R3CA 1QL1A 5M1BA 3QH9A 3W68A 3L70G 5AVWB 1L0LD 1LP1B 3KPEA 3L75D 1P84D 1PGOA 2WWWA 3AE1C 3H1LD 5K5GB 2YO3A 3RK2C 1GL2A 1SQVE 1M1JB 2QJPB 1FZGA 1EDJA 3B5NC 1L0LJ 1OVUA 1SS1A 1NYHA 5GTHE 1PV3A 1A02J 2OYHA 1GD2E 1T3JA 3H1IE 3A0BH 1ZLLA 3L73G 3L74J 5APQA 3B8EB 1FOSE 4D6TD 1Q7YQ 2JWDA 3HUSA 1N2DC 3AEAC 3R4YA 3HE4A 1JEKA 3CCRP 1DD3A 3CX5H 1H0TB 1FC2C 3EFFK 1SQQD 2FYUK 3HD7C 4ASWA 1OVVA 1J1DB 1N86A 2ZT9B 1G2CB 3FGAD 2JKVA 1IK9A 2K37A 3E1RA 1SQPK 1GZLA 3RL0B 4WY4B 4D6TJ 1FJPA 1CSBA 1GMJA 2BEZF 1HBWA 2XNXA 1SQBE 1SQQJ 1AFOA 3L73D 3P8CE 4TT3H 4U7JA 3VYIA 1BSNA 2C9NY 2UWJE 2P67A 5C39A 1K73Q 1N7SA 1UIXA 2OTJP 1PP9G 1NTZE 2W27A 1USDA 1JB0J 2O3JA 3G3ZA 1S4XA 2B89A 2ZJSE 2O01J 3IN6A 1LTIC 3L71E 4U3FD 2O1JA 1K04A 1L0ND 1IZNB 3O6QA 5AW4B 4Z1MH 2YKQA 2CPBA 1JNMA 5KAFE 3M9HA 1MFTA 3AE4C 3O8ZA 4B86A 5AW3B 3RL0D 1NWQA 1U57A 4H44D 3BASA 4R4MA 2Q7CA 2A45H 4KT0J 2NRGA 2W90A 1GW4A 1AQ5A 5CCHC 1E5WA 3HUSB 2JO1A 1IFNA 1VL2A 2I1JA 1URQD 2NZ2A 4H44B 5TJHA 1YYCA 1NTKD 2GUSA 5KJ7A 1IK7A 3BATA 2K3RA 5AVRB 2Q9IA 2E75D 1LTJA 1JY2P 1Q86Q 1IFIA 2QIWA 1BCCG 2ZVOB 1ZRTD 2FKWB 4XA4A 1Y8AA 2KS1B 2WPQA 2Y9YA 4OVNF 3PTZA 3CCSP 2FYUJ 1EQ7A 3GF3A 4IL6E 2XDJA 1HTLC 1S2EA 1SQBG 4W7YA 1LNQA 2KZIA 4PD4D 3H1KJ 2WVRA 3BCCD 4WVZA 1NU1G 3W67A 2YO2A 5GTIH 3S4RA 2JP3A 1MKMA 1VQMP 1YJWP 4N3YB 1JMMA 2P58A 2H89C 2FYUD 2MKVA 5CBOA 1IFJA 2KS1A 1HVVA 2WSFJ 5APUA 4WY4D 1Y47A 3BCCJ 2J58A 4JQ0D 2A06D 1K05A 5AW5B 1HWTC 2M5AB 3TF5A 4PV1D 5AVZB 3P32A 3WUTA 3ZDMA 3H1IG 5KAFH 4LGDE 3VMAA 1L2PA 1GU5A 2LXBA 2ZAEB 3HRNA 3AE6C 4JF7A 1KILE 3U59A 1JY3N 1PGJA 1RF1C 1VQ8P 4OWFA 1EDIA 3L37A 3M0DC 3T97B 1U7MA 2P7JA 4BRYA 1KB9I 2BCCD 1GK6A 3MP7B 3G71P 2Q5UA 1DX7A 1SQXJ 2K9JA 1W2EA 1OW8A 4QMAA 5CCHA 3CWBJ 3Q1MA 3A0BE 1M56D 1SQBJ 4AQRD 1YIJP 2HODB 2KIKA 2A45G 3H1HG 3L36A 1TU3F 1L0LK 2HFED 1NOHA 5BU8B 5TISH 1RF1B 2KNCA 3MUDA 2H7HA 5CJ4A 2E74D 1NTZG 3VMYA 4N78E 2E75C 1FZEA 4AUWA 1L0NK 1KYOI 2N9BA 1KFNA 2FFDC 4I6MC 2YMKA 4DCKA 1VQNP 2XU6A 1S5LE 3CPWO 2ITAA 2OARA 2WPSA 3VP9A 2IBZG 1M1JC 2QJPC 1N7SB 5E79E 5KLIC 4ZKPA 1CW5A 3KDPB 1YJ9P 1SQQE 3ITKA 2PAJA 1NAFA 3H1HD 1FDMA 1SQVJ 3NFQA 3V2RA 2KLVA 1KB9H 3BRTB 5APVA 3S1KA 1SQPD 2QEXP 1L4AB 2N1TD 4BRYB 3H1HJ 2HR3A 1NU1D 3RK3B 1BGYG 1X0TA 3CWBG 3L74E 3H6PA 1ZR2A 2N9YB 1MV8A 3BRVB 1PPJG 4H13B 1LJ2A 1T6AA 3VP8A 1BDCA 1SQBK 1IJDB 1Q90D 2R44A 3RBZA 3TNUB 1L0LE 2FBWC 2WSCJ 2KOGA 2WZ7A 4M3LA 2OYHB 1GL2C 1AQTA 1L4AC 5AW7B 5L8RJ 1S9KE 4GDOA 4KJMA 1VQ7P 3HD7D 3HE4B 3JC22 1DIPA 1ZV8A 3L75J 2E5TA 4PD4I 3RK3C 2L91A 4XFJA 1NGMB 2QVAA 1JTHB 1FZBA 3TNUA 1D7MA 2P1JA 5AW9B 4IOIH 2Y0EA 3H32B 4OH8B 3CMAP 2PGDA 5BU5A 3RK3D 1ZXGA 1EXIA 2KNCB 3D70A 2OYOA 3HTKA 2KK7A 3A0HH 3TDKA 2G3AA 3Q5SA 4DJGA 3H1JD 3V6IA 2H88C 2IFNA 3RK2D 1GL2D 1IC2A 3H1KE 4R4LA 1PP9D 1SQVG 5APSA 1GDTA 3G6EP 3Q2YA 1K8AQ 5AW0B 3BCCE 5H2FE 3GHGB 4I1LA 1OIPA 2ZVNB 4GOFA 1LT9B 3D6YA 3JSVC 4BXLA 1JY2O 1RF0A 3AEEC 3H1JE 2FXOA 4EDFA 1JM0A 1OXZA 3TGUE 4RJTA 2LXCB 2O01N 4DZOA 3L75E 1KB9D 1L0LG 2N1TC 5AVTB 4GOEA 3SFDC 1X8YA 3RK3E 1EC5A 1RE3A 2RN0A 1L4AA 1XTCC 3GHGA 4WBAA 1SFCC 4ZMDA 3OA7A 5BVZA 5KAIH 2WT7A 1ZW0A 2R5BA 3HD7A 1L0NG 4JBZA 2IDBA 4Y99B 1YTZT 1JTHA 1H89A 1PL5A 2QRXA 5DJTB 3WU2E 1GU4A 4GKGA 1FZCB 4YPCA 1J2JB 4JPZB 4W80A 3WUVA 2D2CB 2WPRA 3V2QA 3EQ2A 1N7SD 1SQPG 2Y9ZA 2XV5A 3AE7C 2JR8A 3M91A 2D2CD 1ZN5A 2Z5IA 1FOSF 2O01H 3OAKA 3NXSA 2QSIA 1Q2NA 1HGZA 2WSEJ 3A0HE 1AV1A 5KLIB 4RKUJ 1G2CA 1LWUA 3AE3C 3GMAA 2QJYB 4NPEA 3VTPC 3MIWA 1FZCC 2QJKC 3JCUE 1BE3G 1RE4A 3TSIA 2JDIH 1RHZB 1NTMJ 1SLQA 2Z5HA 2NPSA 3L73E 1SQBD 3Q3DA 1J1EC 1NKNA 1N73A 3CX5I 3P8CD 1JOCA 2M0BA 1HUCA 3L72E 3P8MC 2NPSB 1N73B 4OGQD 1G1JA 1ZP0C 1EDLA 2YNYA 2KSEA 3H1HE 1NTMD 2FXMA 2J5UA 2M3BA 3HE5B 4GODA 2HPCA 1YTZI 1R8EA 1SQXK 1X9VA 3LIDA 1A02F 1IFPA 2POHA 2AEJA 4D6TE 3N4XA 3D6ZA 5KAIE 1RQVA 3IF4A 1WMKA 1EXJA 1URQB 5APWA 1BE3D 5KKZC 3CCVP 1OX3A 3F89A 2LKMA 3AE2C 1N7SC 2K9YA 1PP9E 4GIFA 4PJ0H 4BWNA 5B5EH 1ZR4A 4PD4H 5AVUB 4RO0A 4A7PA 3CC2P 3AEFC 1RF0C 5CJ0A 5GTIE 3OJAB 1LWUB 2BEQD 3PH0A 3SWKA 5KLVG 4C7NA 1NU1K 3AEDC 3MD0A 1NO4A 2KLUA 4JYBA 1SQVK 4ZKUA 1MFZA 2XZRA 3FXDA 1GTWA 1NKZB 1RE3C 4GT1A 2B88A 1H8AA 1T3UA 2E5YA 5KKZB 3Q5RA 2E76C 1SQXD 3SWYA 1H0TA 1KYOE 5CCGC 3CWBE 3L74G 3U1AA 1YITP 2Z4EA 1VQ9P 3L75G 2BASA 2R3SA 2I1KA 1VF5B 2QE7H 3HTKB 3SWFA 3HE5A 1S9KD 5KJ7D 5B66E 1H88A 2B87B 1VF5D 1LTJC 1EZVD 1G1IA 1PZQA 2PRRA 2K1AA 3V2NA 2OYHC 1VQPP 3EWKA 1JUNA 1T8ZA 2V7QJ 5CCHD 1KZUB 1KTMA 2N1TB 1LTGC 1S1CX 2A06E 2IX7C 2M5AA 1SQXG 2E76B 1M8OB 4H44C 3RL0C 1LTTC 3RL0g 1NU1E 3N7NA 4I2LC 2CK3H 1QLED 4TLFA 1FS0E 4C46A 4EIJA 2IPPA 2JWAA 3CC7P 2E74B 1FJKA 3E7KA 3H1JJ 3O6QB 4IL6X 1ZOYC 3MHVA 4WY4A 3RBXA 1QX8A 4PJ0E 1NHLA 3V5BA 3S9OA 5B5EE 4PD4E 2WSEH 4NPFX 3I55P 1BGYD 1EZVG 2FFDA 5CMZA 1ZRTE 4AYCA 4EYYQ 3CCJP 1L4AD 1Z56A 3AE8C 3KZIH 3EFGA 3L71G 4L73A 5CBNA 3CCMP 1S72P 1LT1A 1NU1J 1SVFA 1ZMEC 1YI2P 1BGYJ 1LGHB 2MJZA 2YIUB 4U3FJ 2GA1A 2G8YA 2H8PD 4N78D 2WITA 3B4SA 1EDKA 4KHXA 4EI2A 3VMXA 3L70J 3ABVC 5B66H 4UB8E 3CCQP 1J1DC 3JCUH 2AXTH 3H25A 4I7ZC 1QVGO 1FDIA 3MUDC 1KMIZ 2B87A 3H1LE 5APTA 3L72G 3V2PA 2HLOA 3P7KA 3L70D 1JCCA 2BCCE 2FYZA 1VQ5P 1NTKK 1KQFB 1KILD 4PV1B 1KILA 4D6TG 1S5LX 4L76A 3L71J 3LW5H 1RH5B 3OW2O 2H43A 1QVFO 1URQA 2ZXXA 2WSFH 4O9BA 4YXWH 4K3AA 2QM8A 1NTMG 1PP9J 3CX5E 3GG2A 3AEBC 1YQ4C 2E74C 1LWUC 3TGUD 3AEGC 2E75B 2K88A 3Q5PA 2AXCA 1NTKJ 3FX0A 1FZCA 2LR2A 2FFDB 4ASVA 1FZFA 1KV4A 5TISE 1SFCA 2IYOA 3TYYA 2Q3IA 2KP8A 1AVOA 2J59M 2C9LY 1SFCB 1FZAA 1R5SA 1JMBA 2JEEA 3QWOC 4IFMA 2QA4P 2ZYDA 5CHXA 1KQSO 1S5LH 3H1KD 1WRGA 2KZJA 1OWAA 2IFMA 1RF1A 3L72J 1LTJB 1UIIA 1P84E 1KYOH 1FDOA 3A3YB 5KTBA 1GK4A 1FE6A 1HF9A 5H2FH 5CCGA 1VQKP 3FWNA 2K9JB 2IBZD 4NPDA 2Y0CA 3MGNA 4LLHA 3CCLP 1QEXA 4H13C 1SQXE 3CWBD 3IR9A 3RGUA 2HODA 1KYOD 1BCCD 1KQGB 3C8VA 3L70E 4OGQC 5KLVE 2OGUA 3CXHI 2YXRB 2W6JH 2WPVB 1RQUA 3I5CA 4MN4C 4LC1A 1VDFA 3WU2H 2B9BA 2VRSA 1BCCJ 1LTSC 3H1KG 1WT6A 2BCCJ 4N6JA 3GW6A 1X22A 4IL6H 1HJBA 2W6BA 4Y99C 2FYUG 3CD6P 2KYVA 1VQLP 1JY3P 2FYNC 3H1LJ 1BE3E 2NPSD 2OYIC 2M3EA 2ZFCA 3VN0A 2D2CC 3H1JG 2ZYGA 1OFCX 3PJSK 3TK1A 2C0WA 1U7JA 4C7NB 1URQC 1KN7A 4U3FG 3I56P 1YBKA 1VQ6P 1KILC 3CXHD 4I7ZB 2V7QH 1W2BO 1BE3J 2I8DA 1BGYE 2DW3A 3CX5D 3FWLA 3GHGC 3PP5A 4HJGH 1T2KD 1DH3A 1LT9C 1SP4A 2A06G 3B5NA 2FYNB 5AW6B 1SFCD 3AECC 3CCUP 4HH2A 2WTYA 3VOPA 2IBZI 1J1EB 1VQOP 2ZXEB 2WQYC 1M1JA 3HUSC 2BCCG 1BSHA 1NTMK 1SQVD 3CXHH 2E43A 2Y0DA 2ZYAA 3AE9C 1R5LA 3G4SP 1SQQG 1PGQA 2YKOA 3B71A 3LW5J 1PPJD 3GLMA 3PRJA 5KLVJ 4L74A 3A5TA 2C0XA 1EZVE 1VPCA 3V4QA 1M1KQ 3NTNA 4DT0A 1NTZD 4OGQB 1USEA 1BDDA 3UIAA 2RH0A 4HYTB 1EZVI 3MZWB 2P2UA 1L0NJ 3IAOA 1OW6A 5AVQB 1NTZJ 3AE5C 3D71A 2O1KA 5KLVK 3KHUA 1FU1A 2YXQB 1FAVA 1KQLA 3C9IA 1VQ4P 1PIXA 4HKZH 1DD4A 5AVYB 1LTBC 2OYIB 1GL2B 1KORA 2M8RA 2R5DA 3B5ND 1JCDA 4YTPC 3CL3D 3L74D 4DOJA 5E79H 3FXEA 2KXPB 4HB1A 4Y28J 1HGVA 1KC8Q 1LP1A 3H1ID 2OTLP 1NH4A 3LIEA 2KB7P 4H0LB 2Q6QA 1DEBA 4IFFA 3MTUE 1VF5C 2FY8A 3CLQA 5KJ7C 3KQGA 2WMMA 1Y9BA 2YIUC 4WB4A 1AA0A 1K9MQ 1X79B 3A2AA 4UB6H 3H1IJ 1FBMA 2AEFA 5CCGD 1NTME 3L73J 4RESB 5GTHH 1PFIA 2Q1KA 2E76D 2QG4A 2IYPA 3RK2B 3E1IA 2L5GB 1NTKE 4C7RA 3BCCG 1OVRA 3CC4P 3K5BA 3BVHA 4H0LC 2W8ZA 1KFMA 3L72D 3USSA 1T2KC 2OQQA 3CI9A 5APYA 5AW2B 3II6A 1PGPA 2IZ1A 1SQQK 2PP6A 1IO4A 3IFMA 1MZ9A 3G9RA 2N1TA 2P10A 2HG5D 5AVSB 3WUUA 1YQ3C 1NTZK 2V4HA 5APXA 5AW1B 3VMZA 3CMEP 2Q3EA 3HD7B 1AJYA 2NPSC 1KD1Q 2ZT9C 1N73C 2XNDH 1L0NE 4K35A 1DEEG 1IFMA 1PPJE 2GUVA 3C1LA 3PHLA 2W6AA 3H1LG 1CZQA 3L71D 3A7OA 4U3FE 5AVXB 5AVVB 2SPZA 1W5CE 2YMYA
chains in the Genus database with same CATH topology
3V4WA 3WMM0 2HPCB 2YKPA 1GW3A 3M9QA 2CPSA 3M0DA 2JJLA 3M0AA 4JYCA 3M06A 3U1CA 1LTAC 2E42A 3B5NB 3L35A 3M9BA 3T97A 1RE4C 5AW8B 2A45I 1JY3O 3H32A 2HYNA 1HH0A 3NMDA 1CI6B 1IFDA 1KILB 3L4FA 2XKMA 4WY4C 1N7LA 2QM7A 2WSCH 1LT9A 1M7LA 1XTGB 1JY2N 1CI6A 2GM4A 2KSJA 1QL2A 2WT7B 1JO5A 4EOTA 3R2PA 4XE5B 1MUUA 1RY3A 3KYQA 4W7ZA 2OYIA 4IFDK 2R32A 2R3CA 1QL1A 5AVWB 3KPEA 2WWWA 2YO3A 3RK2C 1GL2A 1M1JB 1FZGA 3B5NC 1A02J 2OYHA 1GD2E 1T3JA 1ZLLA 5APQA 3B8EB 1FOSE 3HUSA 1N2DC 3HE4A 2FYUK 3HD7C 1J1DB 1N86A 1G2CB 3RL0B 1FJPA 1IK9A 1SQPK 1GZLA 4WY4B 1CSBA 1HBWA 2XNXA 1AFOA 3P8CE 3VYIA 2C9NY 2P67A 1N7SA 2W27A 3G3ZA 5CCHA 2WT7A 1LTIC 2O1JA 5AW4B 1JNMA 2YKQA 2CPBA 3M9HA 3O8ZA 4B86A 1NWQA 5AW3B 3RL0D 3BASA 2Q7CA 2A45H 1GW4A 1AQ5A 5CCHC 1E5WA 3HUSB 1IFNA 2I1JA 1URQD 1YYCA 2GUSA 5KJ7A 3BATA 5AVRB 2Q9IA 1LTJA 1JY2P 1IFIA 4XA4A 2FKWB 2WPQA 1EQ7A 4W7YA 2XDJA 1HTLC 1ZR4A 2YO2A 4N3YB 1JMMA 1IFJA 1HVVA 5APUA 4WY4D 2J58A 5AW5B 1HWTC 5AVZB 3P32A 4LGDE 1GU5A 1RF1C 3HRNA 4JF7A 3U59A 1JY3N 3L37A 3M0DC 2P7JA 1DX7A 1GK6A 2Q5UA 1W2EA 4AQRD 2HODB 2A45G 3L36A 1L0LK 2HFED 1NOHA 5BU8B 1RF1B 3MUDA 2H7HA 5CJ4A 3VMYA 4N78E 1FZEA 4AUWA 1L0NK 2N9BA 2FFDC 1KFNA 4I6MC 2XU6A 2OARA 2WPSA 3VP9A 1M1JC 1N7SB 4ZKPA 1CW5A 3KDPB 2PAJA 1NAFA 1FDMA 3NFQA 3V2RA 2KLVA 3BRTB 5APVA 1L4AB 2N1TD 3RK3B 3H6PA 1ZR2A 3BRVB 1MV8A 3VP8A 1SQBK 1IJDB 3TNUB 2KOGA 2WZ7A 4M3LA 2OYHB 1GL2C 1L4AC 5AW7B 1S9KE 3HD7D 3HE4B 1ZV8A 3RK3C 1JTHB 1FZBA 3TNUA 2P1JA 5AW9B 3H32B 4OH8B 5BU5A 3RK3D 3HTKA 2IFNA 3RK2D 1GL2D 1IC2A 5APSA 1GDTA 5AW0B 3GHGB 4I1LA 1LT9B 1JY2O 1RF0A 1OXZA 4DZOA 2N1TC 5AVTB 1X8YA 1RE3A 1L4AA 1XTCC 3GHGA 4WBAA 1SFCC 5BVZA 3OA7A 2R5BA 3HD7A 4Y99B 1YTZT 1JTHA 1H89A 1FZCB 1GU4A 4GKGA 1J2JB 4W80A 2WPRA 3V2QA 3EQ2A 1N7SD 2XV5A 3M91A 1ZN5A 2Z5IA 2O01H 3OAKA 3NXSA 1HGZA 1G2CA 1LWUA 3VTPC 3MIWA 1FZCC 1RE4A 3TSIA 2Z5HA 1SLQA 2NPSA 1N73A 1J1EC 1NKNA 3P8CD 1JOCA 1HUCA 3P8MC 2NPSB 1N73B 1G1JA 2YNYA 3HE5B 2FXMA 2M3BA 2HPCA 1YTZI 1SQXK 1X9VA 3LIDA 1A02F 2POHA 3N4XA 1URQB 5APWA 2LKMA 1N7SC 4GIFA 5AVUB 1RF0C 5CJ0A 3OJAB 1LWUB 4C7NA 1NU1K 3MD0A 4JYBA 1NO4A 4ZKUA 1SQVK 1MFZA 2XZRA 1GTWA 1NKZB 1RE3C 4GT1A 1H8AA 1T3UA 3SWYA 5CCGC 3U1AA 2Z4EA 2BASA 3SWFA 2I1KA 3HTKB 1S9KD 3HE5A 5KJ7D 1H88A 1LTJC 1G1IA 2OYHC 3V2NA 1JUNA 1T8ZA 5CCHD 1KZUB 2N1TB 1LTGC 2IX7C 3RL0C 1LTTC 3N7NA 4I2LC 4C46A 4EIJA 2IPPA 1FJKA 4WY4A 3V5BA 1NHLA 2WSEH 2FFDA 5CMZA 4AYCA 1L4AD 1Z56A 1FOSF 3EFGA 1SVFA 1LGHB 2MJZA 2H8PD 4N78D 2WITA 4KHXA 3VMXA 1J1DC 3V2PA 5APTA 2HLOA 3P7KA 1JCCA 2FYZA 1NTKK 1KILD 1KILA 3LW5H 2H43A 1URQA 2WSFH 4O9BA 2QM8A 1LWUC 2FFDB 1FZCA 1FZFA 1SFCA 3TYYA 2Q3IA 2KP8A 2J59M 2C9LY 1SFCB 1FZAA 2JEEA 4IFMA 5CHXA 1WRGA 1OWAA 2IFMA 1RF1A 1LTJB 3A3YB 5KTBA 1GK4A 5CCGA 3MGNA 4LLHA 3IR9A 2HODA 3I5CA 4LC1A 1VDFA 2VRSA 4N6JA 1LTSC 1WT6A 1HJBA 2W6BA 4Y99C 2KYVA 1JY3P 2NPSD 2OYIC 2ZFCA 3VN0A 4C7NB 3TK1A 2C0WA 1URQC 1KILC 3PP5A 1DH3A 3GHGC 1T2KD 1LT9C 1SP4A 3B5NA 5AW6B 1SFCD 4HH2A 2WTYA 3VOPA 1J1EB 2ZXEB 1M1JA 3HUSC 1NTMK 2E43A 2YKOA 3A5TA 2C0XA 1VPCA 3V4QA 3NTNA 3UIAA 4HYTB 2P2UA 5AVQB 2O1KA 5KLVK 1FU1A 1FAVA 1KQLA 3C9IA 2OYIB 5AVYB 1LTBC 1GL2B 2M8RA 2R5DA 3B5ND 4DOJA 1JCDA 3CL3D 1HGVA 1NH4A 3LIEA 2KB7P 1DEBA 4IFFA 3MTUE 3CLQA 5KJ7C 3KQGA 4WB4A 1X79B 3A2AA 1FBMA 5CCGD 1PFIA 3RK2B 3E1IA 2L5GB 4C7RA 3BVHA 1KFMA 1T2KC 3CI9A 5APYA 5AW2B 3II6A 2PP6A 1SQQK 1IO4A 3IFMA 1MZ9A 2N1TA 2HG5D 5AVSB 5APXA 1NTZK 3VMZA 5AW1B 3HD7B 2NPSC 1N73C 4RESB 1IFMA 2GUVA 2W6AA 1CZQA 3A7OA 5AVXB 5AVVB 2YMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDF A;  3V2R A;  1MZ9 A;  3V2N A;  1FBM A;  3V2P A;  3V2Q A;  1DEB A; 
#chains in the Genus database with same CATH topology
 4UB8 H;  3F5H A;  3V4W A;  1AVY A;  3WMM 0;  2YKP A;  1GW3 A;  2AXT E;  2KUB A;  2HPC B;  1SQP E;  3M9Q A;  2CPS A;  2OTK E;  1Q82 Q;  3CCE P;  3TGU J;  1Q81 Q;  3M0D A;  2JJL A;  3M0A A;  4JYC A;  3M06 A;  3U1C A;  1P84 I;  1LTA C;  4L75 A;  4UB6 E;  3SSU A;  2E42 A;  1KB9 E;  3B5N B;  1S3J A;  2FXP A;  3L35 A;  1N8R Q;  1M57 D;  3M9B A;  3T97 A;  4H13 D;  1NTK G;  1RE4 C;  5AW8 B;  3CXH E;  4YXD C;  2A45 I;  1OZH A;  2AEM A;  2W83 C;  1JY3 O;  3H32 A;  2HYN A;  2RKL A;  2FYU E;  5EFW B;  2ZT9 D;  1HJ0 A;  1HH0 A;  3KXD A;  1CI6 B;  1NVO A;  3NMD A;  4PV1 C;  3SFE C;  1IFD A;  1KIL B;  2PFX A;  2WSS H;  3L4F A;  2XKM A;  2KI7 B;  4WY4 C;  1N7L A;  2QM7 A;  2WSC H;  1SQP J;  1NJI Q;  1YHQ P;  3TGU G;  1QGK B;  3PLN A;  4CPG A;  1LT9 A;  4WWI A;  1M7L A;  1XTG B;  1JY2 N;  1CI6 A;  3KZI E;  4H0L D;  5DJU B;  1YJN P;  1M90 Q;  2KSJ A;  2GM4 A;  1QL2 A;  2WT7 B;  1NAY A;  2RMZ A;  1JO5 A;  4EOT A;  1BCC E;  3R2P A;  4XE5 B;  1OMI A;  2IZ0 A;  5KLV D;  1MUU A;  1P84 H;  1RY3 A;  3KYQ A;  3GF7 A;  1E79 H;  4W7Z A;  4ZNC A;  2OYI A;  4IFD K;  2R32 A;  2QJY C;  1OW7 A;  2IBZ E;  2QJK B;  2R3C A;  1QL1 A;  5M1B A;  3QH9 A;  3W68 A;  3L70 G;  5AVW B;  1L0L D;  1LP1 B;  3KPE A;  3L75 D;  1P84 D;  1PGO A;  2WWW A;  3AE1 C;  3H1L D;  5K5G B;  2YO3 A;  3RK2 C;  1GL2 A;  1SQV E;  1M1J B;  2QJP B;  1FZG A;  1EDJ A;  3B5N C;  1L0L J;  1OVU A;  1SS1 A;  1NYH A;  5GTH E;  1PV3 A;  1A02 J;  2OYH A;  1GD2 E;  1T3J A;  3H1I E;  3A0B H;  1ZLL A;  3L73 G;  3L74 J;  5APQ A;  3B8E B;  1FOS E;  4D6T D;  1Q7Y Q;  2JWD A;  3HUS A;  1N2D C;  3AEA C;  3R4Y A;  3HE4 A;  1JEK A;  3CCR P;  1DD3 A;  3CX5 H;  1H0T B;  1FC2 C;  3EFF K;  1SQQ D;  2FYU K;  3HD7 C;  4ASW A;  1OVV A;  1J1D B;  1N86 A;  2ZT9 B;  1G2C B;  3FGA D;  2JKV A;  1IK9 A;  2K37 A;  3E1R A;  1SQP K;  1GZL A;  3RL0 B;  4WY4 B;  4D6T J;  1FJP A;  1CSB A;  1GMJ A;  2BEZ F;  1HBW A;  2XNX A;  1SQB E;  1SQQ J;  1AFO A;  3L73 D;  3P8C E;  4TT3 H;  4U7J A;  3VYI A;  1BSN A;  2C9N Y;  2UWJ E;  2P67 A;  5C39 A;  1K73 Q;  1N7S A;  1UIX A;  2OTJ P;  1PP9 G;  1NTZ E;  2W27 A;  1USD A;  1JB0 J;  2O3J A;  3G3Z A;  1S4X A;  2B89 A;  2ZJS E;  2O01 J;  3IN6 A;  1LTI C;  3L71 E;  4U3F D;  2O1J A;  1K04 A;  1L0N D;  1IZN B;  3O6Q A;  5AW4 B;  4Z1M H;  2YKQ A;  2CPB A;  1JNM A;  5KAF E;  3M9H A;  1MFT A;  3AE4 C;  3O8Z A;  4B86 A;  5AW3 B;  3RL0 D;  1NWQ A;  1U57 A;  4H44 D;  3BAS A;  4R4M A;  2Q7C A;  2A45 H;  4KT0 J;  2NRG A;  2W90 A;  1GW4 A;  1AQ5 A;  5CCH C;  1E5W A;  3HUS B;  2JO1 A;  1IFN A;  1VL2 A;  2I1J A;  1URQ D;  2NZ2 A;  4H44 B;  5TJH A;  1YYC A;  1NTK D;  2GUS A;  5KJ7 A;  1IK7 A;  3BAT A;  2K3R A;  5AVR B;  2Q9I A;  2E75 D;  1LTJ A;  1JY2 P;  1Q86 Q;  1IFI A;  2QIW A;  1BCC G;  2ZVO B;  1ZRT D;  2FKW B;  4XA4 A;  1Y8A A;  2KS1 B;  2WPQ A;  2Y9Y A;  4OVN F;  3PTZ A;  3CCS P;  2FYU J;  1EQ7 A;  3GF3 A;  4IL6 E;  2XDJ A;  1HTL C;  1S2E A;  1SQB G;  4W7Y A;  1LNQ A;  2KZI A;  4PD4 D;  3H1K J;  2WVR A;  3BCC D;  4WVZ A;  1NU1 G;  3W67 A;  2YO2 A;  5GTI H;  3S4R A;  2JP3 A;  1MKM A;  1VQM P;  1YJW P;  4N3Y B;  1JMM A;  2P58 A;  2H89 C;  2FYU D;  2MKV A;  5CBO A;  1IFJ A;  2KS1 A;  1HVV A;  2WSF J;  5APU A;  4WY4 D;  1Y47 A;  3BCC J;  2J58 A;  4JQ0 D;  2A06 D;  1K05 A;  5AW5 B;  1HWT C;  2M5A B;  3TF5 A;  4PV1 D;  5AVZ B;  3P32 A;  3WUT A;  3ZDM A;  3H1I G;  5KAF H;  4LGD E;  3VMA A;  1L2P A;  1GU5 A;  2LXB A;  2ZAE B;  3HRN A;  3AE6 C;  4JF7 A;  1KIL E;  3U59 A;  1JY3 N;  1PGJ A;  1RF1 C;  1VQ8 P;  4OWF A;  1EDI A;  3L37 A;  3M0D C;  3T97 B;  1U7M A;  2P7J A;  4BRY A;  1KB9 I;  2BCC D;  1GK6 A;  3MP7 B;  3G71 P;  2Q5U A;  1DX7 A;  1SQX J;  2K9J A;  1W2E A;  1OW8 A;  4QMA A;  5CCH A;  3CWB J;  3Q1M A;  3A0B E;  1M56 D;  1SQB J;  4AQR D;  1YIJ P;  2HOD B;  2KIK A;  2A45 G;  3H1H G;  3L36 A;  1TU3 F;  1L0L K;  2HFE D;  1NOH A;  5BU8 B;  5TIS H;  1RF1 B;  2KNC A;  3MUD A;  2H7H A;  5CJ4 A;  2E74 D;  1NTZ G;  3VMY A;  4N78 E;  2E75 C;  1FZE A;  4AUW A;  1L0N K;  1KYO I;  2N9B A;  1KFN A;  2FFD C;  4I6M C;  2YMK A;  4DCK A;  1VQN P;  2XU6 A;  1S5L E;  3CPW O;  2ITA A;  2OAR A;  2WPS A;  3VP9 A;  2IBZ G;  1M1J C;  2QJP C;  1N7S B;  5E79 E;  5KLI C;  4ZKP A;  1CW5 A;  3KDP B;  1YJ9 P;  1SQQ E;  3ITK A;  2PAJ A;  1NAF A;  3H1H D;  1FDM A;  1SQV J;  3NFQ A;  3V2R A;  2KLV A;  1KB9 H;  3BRT B;  5APV A;  3S1K A;  1SQP D;  2QEX P;  1L4A B;  2N1T D;  4BRY B;  3H1H J;  2HR3 A;  1NU1 D;  3RK3 B;  1BGY G;  1X0T A;  3CWB G;  3L74 E;  3H6P A;  1ZR2 A;  2N9Y B;  1MV8 A;  3BRV B;  1PPJ G;  4H13 B;  1LJ2 A;  1T6A A;  3VP8 A;  1BDC A;  1SQB K;  1IJD B;  1Q90 D;  2R44 A;  3RBZ A;  3TNU B;  1L0L E;  2FBW C;  2WSC J;  2KOG A;  2WZ7 A;  4M3L A;  2OYH B;  1GL2 C;  1AQT A;  1L4A C;  5AW7 B;  5L8R J;  1S9K E;  4GDO A;  4KJM A;  1VQ7 P;  3HD7 D;  3HE4 B;  3JC2 2;  1DIP A;  1ZV8 A;  3L75 J;  2E5T A;  4PD4 I;  3RK3 C;  2L91 A;  4XFJ A;  1NGM B;  2QVA A;  1JTH B;  1FZB A;  3TNU A;  1D7M A;  2P1J A;  5AW9 B;  4IOI H;  2Y0E A;  3H32 B;  4OH8 B;  3CMA P;  2PGD A;  5BU5 A;  3RK3 D;  1ZXG A;  1EXI A;  2KNC B;  3D70 A;  2OYO A;  3HTK A;  2KK7 A;  3A0H H;  3TDK A;  2G3A A;  3Q5S A;  4DJG A;  3H1J D;  3V6I A;  2H88 C;  2IFN A;  3RK2 D;  1GL2 D;  1IC2 A;  3H1K E;  4R4L A;  1PP9 D;  1SQV G;  5APS A;  1GDT A;  3G6E P;  3Q2Y A;  1K8A Q;  5AW0 B;  3BCC E;  5H2F E;  3GHG B;  4I1L A;  1OIP A;  2ZVN B;  4GOF A;  1LT9 B;  3D6Y A;  3JSV C;  4BXL A;  1JY2 O;  1RF0 A;  3AEE C;  3H1J E;  2FXO A;  4EDF A;  1JM0 A;  1OXZ A;  3TGU E;  4RJT A;  2LXC B;  2O01 N;  4DZO A;  3L75 E;  1KB9 D;  1L0L G;  2N1T C;  5AVT B;  4GOE A;  3SFD C;  1X8Y A;  3RK3 E;  1EC5 A;  1RE3 A;  2RN0 A;  1L4A A;  1XTC C;  3GHG A;  4WBA A;  1SFC C;  4ZMD A;  3OA7 A;  5BVZ A;  5KAI H;  2WT7 A;  1ZW0 A;  2R5B A;  3HD7 A;  1L0N G;  4JBZ A;  2IDB A;  4Y99 B;  1YTZ T;  1JTH A;  1H89 A;  1PL5 A;  2QRX A;  5DJT B;  3WU2 E;  1GU4 A;  4GKG A;  1FZC B;  4YPC A;  1J2J B;  4JPZ B;  4W80 A;  3WUV A;  2D2C B;  2WPR A;  3V2Q A;  3EQ2 A;  1N7S D;  1SQP G;  2Y9Z A;  2XV5 A;  3AE7 C;  2JR8 A;  3M91 A;  2D2C D;  1ZN5 A;  2Z5I A;  1FOS F;  2O01 H;  3OAK A;  3NXS A;  2QSI A;  1Q2N A;  1HGZ A;  2WSE J;  3A0H E;  1AV1 A;  5KLI B;  4RKU J;  1G2C A;  1LWU A;  3AE3 C;  3GMA A;  2QJY B;  4NPE A;  3VTP C;  3MIW A;  1FZC C;  2QJK C;  3JCU E;  1BE3 G;  1RE4 A;  3TSI A;  2JDI H;  1RHZ B;  1NTM J;  1SLQ A;  2Z5H A;  2NPS A;  3L73 E;  1SQB D;  3Q3D A;  1J1E C;  1NKN A;  1N73 A;  3CX5 I;  3P8C D;  1JOC A;  2M0B A;  1HUC A;  3L72 E;  3P8M C;  2NPS B;  1N73 B;  4OGQ D;  1G1J A;  1ZP0 C;  1EDL A;  2YNY A;  2KSE A;  3H1H E;  1NTM D;  2FXM A;  2J5U A;  2M3B A;  3HE5 B;  4GOD A;  2HPC A;  1YTZ I;  1R8E A;  1SQX K;  1X9V A;  3LID A;  1A02 F;  1IFP A;  2POH A;  2AEJ A;  4D6T E;  3N4X A;  3D6Z A;  5KAI E;  1RQV A;  3IF4 A;  1WMK A;  1EXJ A;  1URQ B;  5APW A;  1BE3 D;  5KKZ C;  3CCV P;  1OX3 A;  3F89 A;  2LKM A;  3AE2 C;  1N7S C;  2K9Y A;  1PP9 E;  4GIF A;  4PJ0 H;  4BWN A;  5B5E H;  1ZR4 A;  4PD4 H;  5AVU B;  4RO0 A;  4A7P A;  3CC2 P;  3AEF C;  1RF0 C;  5CJ0 A;  5GTI E;  3OJA B;  1LWU B;  2BEQ D;  3PH0 A;  3SWK A;  5KLV G;  4C7N A;  1NU1 K;  3AED C;  3MD0 A;  1NO4 A;  2KLU A;  4JYB A;  1SQV K;  4ZKU A;  1MFZ A;  2XZR A;  3FXD A;  1GTW A;  1NKZ B;  1RE3 C;  4GT1 A;  2B88 A;  1H8A A;  1T3U A;  2E5Y A;  5KKZ B;  3Q5R A;  2E76 C;  1SQX D;  3SWY A;  1H0T A;  1KYO E;  5CCG C;  3CWB E;  3L74 G;  3U1A A;  1YIT P;  2Z4E A;  1VQ9 P;  3L75 G;  2BAS A;  2R3S A;  2I1K A;  1VF5 B;  2QE7 H;  3HTK B;  3SWF A;  3HE5 A;  1S9K D;  5KJ7 D;  5B66 E;  1H88 A;  2B87 B;  1VF5 D;  1LTJ C;  1EZV D;  1G1I A;  1PZQ A;  2PRR A;  2K1A A;  3V2N A;  2OYH C;  1VQP P;  3EWK A;  1JUN A;  1T8Z A;  2V7Q J;  5CCH D;  1KZU B;  1KTM A;  2N1T B;  1LTG C;  1S1C X;  2A06 E;  2IX7 C;  2M5A A;  1SQX G;  2E76 B;  1M8O B;  4H44 C;  3RL0 C;  1LTT C;  3RL0 g;  1NU1 E;  3N7N A;  4I2L C;  2CK3 H;  1QLE D;  4TLF A;  1FS0 E;  4C46 A;  4EIJ A;  2IPP A;  2JWA A;  3CC7 P;  2E74 B;  1FJK A;  3E7K A;  3H1J J;  3O6Q B;  4IL6 X;  1ZOY C;  3MHV A;  4WY4 A;  3RBX A;  1QX8 A;  4PJ0 E;  1NHL A;  3V5B A;  3S9O A;  5B5E E;  4PD4 E;  2WSE H;  4NPF X;  3I55 P;  1BGY D;  1EZV G;  2FFD A;  5CMZ A;  1ZRT E;  4AYC A;  4EYY Q;  3CCJ P;  1L4A D;  1Z56 A;  3AE8 C;  3KZI H;  3EFG A;  3L71 G;  4L73 A;  5CBN A;  3CCM P;  1S72 P;  1LT1 A;  1NU1 J;  1SVF A;  1ZME C;  1YI2 P;  1BGY J;  1LGH B;  2MJZ A;  2YIU B;  4U3F J;  2GA1 A;  2G8Y A;  2H8P D;  4N78 D;  2WIT A;  3B4S A;  1EDK A;  4KHX A;  4EI2 A;  3VMX A;  3L70 J;  3ABV C;  5B66 H;  4UB8 E;  3CCQ P;  1J1D C;  3JCU H;  2AXT H;  3H25 A;  4I7Z C;  1QVG O;  1FDI A;  3MUD C;  1KMI Z;  2B87 A;  3H1L E;  5APT A;  3L72 G;  3V2P A;  2HLO A;  3P7K A;  3L70 D;  1JCC A;  2BCC E;  2FYZ A;  1VQ5 P;  1NTK K;  1KQF B;  1KIL D;  4PV1 B;  1KIL A;  4D6T G;  1S5L X;  4L76 A;  3L71 J;  3LW5 H;  1RH5 B;  3OW2 O;  2H43 A;  1QVF O;  1URQ A;  2ZXX A;  2WSF H;  4O9B A;  4YXW H;  4K3A A;  2QM8 A;  1NTM G;  1PP9 J;  3CX5 E;  3GG2 A;  3AEB C;  1YQ4 C;  2E74 C;  1LWU C;  3TGU D;  3AEG C;  2E75 B;  2K88 A;  3Q5P A;  2AXC A;  1NTK J;  3FX0 A;  1FZC A;  2LR2 A;  2FFD B;  4ASV A;  1FZF A;  1KV4 A;  5TIS E;  1SFC A;  2IYO A;  3TYY A;  2Q3I A;  2KP8 A;  1AVO A;  2J59 M;  2C9L Y;  1SFC B;  1FZA A;  1R5S A;  1JMB A;  2JEE A;  3QWO C;  4IFM A;  2QA4 P;  2ZYD A;  5CHX A;  1KQS O;  1S5L H;  3H1K D;  1WRG A;  2KZJ A;  1OWA A;  2IFM A;  1RF1 A;  3L72 J;  1LTJ B;  1UII A;  1P84 E;  1KYO H;  1FDO A;  3A3Y B;  5KTB A;  1GK4 A;  1FE6 A;  1HF9 A;  5H2F H;  5CCG A;  1VQK P;  3FWN A;  2K9J B;  2IBZ D;  4NPD A;  2Y0C A;  3MGN A;  4LLH A;  3CCL P;  1QEX A;  4H13 C;  1SQX E;  3CWB D;  3IR9 A;  3RGU A;  2HOD A;  1KYO D;  1BCC D;  1KQG B;  3C8V A;  3L70 E;  4OGQ C;  5KLV E;  2OGU A;  3CXH I;  2YXR B;  2W6J H;  2WPV B;  1RQU A;  3I5C A;  4MN4 C;  4LC1 A;  1VDF A;  3WU2 H;  2B9B A;  2VRS A;  1BCC J;  1LTS C;  3H1K G;  1WT6 A;  2BCC J;  4N6J A;  3GW6 A;  1X22 A;  4IL6 H;  1HJB A;  2W6B A;  4Y99 C;  2FYU G;  3CD6 P;  2KYV A;  1VQL P;  1JY3 P;  2FYN C;  3H1L J;  1BE3 E;  2NPS D;  2OYI C;  2M3E A;  2ZFC A;  3VN0 A;  2D2C C;  3H1J G;  2ZYG A;  1OFC X;  3PJS K;  3TK1 A;  2C0W A;  1U7J A;  4C7N B;  1URQ C;  1KN7 A;  4U3F G;  3I56 P;  1YBK A;  1VQ6 P;  1KIL C;  3CXH D;  4I7Z B;  2V7Q H;  1W2B O;  1BE3 J;  2I8D A;  1BGY E;  2DW3 A;  3CX5 D;  3FWL A;  3GHG C;  3PP5 A;  4HJG H;  1T2K D;  1DH3 A;  1LT9 C;  1SP4 A;  2A06 G;  3B5N A;  2FYN B;  5AW6 B;  1SFC D;  3AEC C;  3CCU P;  4HH2 A;  2WTY A;  3VOP A;  2IBZ I;  1J1E B;  1VQO P;  2ZXE B;  2WQY C;  1M1J A;  3HUS C;  2BCC G;  1BSH A;  1NTM K;  1SQV D;  3CXH H;  2E43 A;  2Y0D A;  2ZYA A;  3AE9 C;  1R5L A;  3G4S P;  1SQQ G;  1PGQ A;  2YKO A;  3B71 A;  3LW5 J;  1PPJ D;  3GLM A;  3PRJ A;  5KLV J;  4L74 A;  3A5T A;  2C0X A;  1EZV E;  1VPC A;  3V4Q A;  1M1K Q;  3NTN A;  4DT0 A;  1NTZ D;  4OGQ B;  1USE A;  1BDD A;  3UIA A;  2RH0 A;  4HYT B;  1EZV I;  3MZW B;  2P2U A;  1L0N J;  3IAO A;  1OW6 A;  5AVQ B;  1NTZ J;  3AE5 C;  3D71 A;  2O1K A;  5KLV K;  3KHU A;  1FU1 A;  2YXQ B;  1FAV A;  1KQL A;  3C9I A;  1VQ4 P;  1PIX A;  4HKZ H;  1DD4 A;  5AVY B;  1LTB C;  2OYI B;  1GL2 B;  1KOR A;  2M8R A;  2R5D A;  3B5N D;  1JCD A;  4YTP C;  3CL3 D;  3L74 D;  4DOJ A;  5E79 H;  3FXE A;  2KXP B;  4HB1 A;  4Y28 J;  1HGV A;  1KC8 Q;  1LP1 A;  3H1I D;  2OTL P;  1NH4 A;  3LIE A;  2KB7 P;  4H0L B;  2Q6Q A;  1DEB A;  4IFF A;  3MTU E;  1VF5 C;  2FY8 A;  3CLQ A;  5KJ7 C;  3KQG A;  2WMM A;  1Y9B A;  2YIU C;  4WB4 A;  1AA0 A;  1K9M Q;  1X79 B;  3A2A A;  4UB6 H;  3H1I J;  1FBM A;  2AEF A;  5CCG D;  1NTM E;  3L73 J;  4RES B;  5GTH H;  1PFI A;  2Q1K A;  2E76 D;  2QG4 A;  2IYP A;  3RK2 B;  3E1I A;  2L5G B;  1NTK E;  4C7R A;  3BCC G;  1OVR A;  3CC4 P;  3K5B A;  3BVH A;  4H0L C;  2W8Z A;  1KFM A;  3L72 D;  3USS A;  1T2K C;  2OQQ A;  3CI9 A;  5APY A;  5AW2 B;  3II6 A;  1PGP A;  2IZ1 A;  1SQQ K;  2PP6 A;  1IO4 A;  3IFM A;  1MZ9 A;  3G9R A;  2N1T A;  2P10 A;  2HG5 D;  5AVS B;  3WUU A;  1YQ3 C;  1NTZ K;  2V4H A;  5APX A;  5AW1 B;  3VMZ A;  3CME P;  2Q3E A;  3HD7 B;  1AJY A;  2NPS C;  1KD1 Q;  2ZT9 C;  1N73 C;  2XND H;  1L0N E;  4K35 A;  1DEE G;  1IFM A;  1PPJ E;  2GUV A;  3C1L A;  3PHL A;  2W6A A;  3H1L G;  1CZQ A;  3L71 D;  3A7O A;  4U3F E;  5AVX B;  5AVV B;  2SPZ A;  1W5C E;  2YMY A; 
#chains in the Genus database with same CATH homology
 3V4W A;  3WMM 0;  2HPC B;  2YKP A;  1GW3 A;  3M9Q A;  2CPS A;  3M0D A;  2JJL A;  3M0A A;  4JYC A;  3M06 A;  3U1C A;  1LTA C;  2E42 A;  3B5N B;  3L35 A;  3M9B A;  3T97 A;  1RE4 C;  5AW8 B;  2A45 I;  1JY3 O;  3H32 A;  2HYN A;  1HH0 A;  3NMD A;  1CI6 B;  1IFD A;  1KIL B;  3L4F A;  2XKM A;  4WY4 C;  1N7L A;  2QM7 A;  2WSC H;  1LT9 A;  1M7L A;  1XTG B;  1JY2 N;  1CI6 A;  2GM4 A;  2KSJ A;  1QL2 A;  2WT7 B;  1JO5 A;  4EOT A;  3R2P A;  4XE5 B;  1MUU A;  1RY3 A;  3KYQ A;  4W7Z A;  2OYI A;  4IFD K;  2R32 A;  2R3C A;  1QL1 A;  5AVW B;  3KPE A;  2WWW A;  2YO3 A;  3RK2 C;  1GL2 A;  1M1J B;  1FZG A;  3B5N C;  1A02 J;  2OYH A;  1GD2 E;  1T3J A;  1ZLL A;  5APQ A;  3B8E B;  1FOS E;  3HUS A;  1N2D C;  3HE4 A;  2FYU K;  3HD7 C;  1J1D B;  1N86 A;  1G2C B;  3RL0 B;  1FJP A;  1IK9 A;  1SQP K;  1GZL A;  4WY4 B;  1CSB A;  1HBW A;  2XNX A;  1AFO A;  3P8C E;  3VYI A;  2C9N Y;  2P67 A;  1N7S A;  2W27 A;  3G3Z A;  5CCH A;  2WT7 A;  1LTI C;  2O1J A;  5AW4 B;  1JNM A;  2YKQ A;  2CPB A;  3M9H A;  3O8Z A;  4B86 A;  1NWQ A;  5AW3 B;  3RL0 D;  3BAS A;  2Q7C A;  2A45 H;  1GW4 A;  1AQ5 A;  5CCH C;  1E5W A;  3HUS B;  1IFN A;  2I1J A;  1URQ D;  1YYC A;  2GUS A;  5KJ7 A;  3BAT A;  5AVR B;  2Q9I A;  1LTJ A;  1JY2 P;  1IFI A;  4XA4 A;  2FKW B;  2WPQ A;  1EQ7 A;  4W7Y A;  2XDJ A;  1HTL C;  1ZR4 A;  2YO2 A;  4N3Y B;  1JMM A;  1IFJ A;  1HVV A;  5APU A;  4WY4 D;  2J58 A;  5AW5 B;  1HWT C;  5AVZ B;  3P32 A;  4LGD E;  1GU5 A;  1RF1 C;  3HRN A;  4JF7 A;  3U59 A;  1JY3 N;  3L37 A;  3M0D C;  2P7J A;  1DX7 A;  1GK6 A;  2Q5U A;  1W2E A;  4AQR D;  2HOD B;  2A45 G;  3L36 A;  1L0L K;  2HFE D;  1NOH A;  5BU8 B;  1RF1 B;  3MUD A;  2H7H A;  5CJ4 A;  3VMY A;  4N78 E;  1FZE A;  4AUW A;  1L0N K;  2N9B A;  2FFD C;  1KFN A;  4I6M C;  2XU6 A;  2OAR A;  2WPS A;  3VP9 A;  1M1J C;  1N7S B;  4ZKP A;  1CW5 A;  3KDP B;  2PAJ A;  1NAF A;  1FDM A;  3NFQ A;  3V2R A;  2KLV A;  3BRT B;  5APV A;  1L4A B;  2N1T D;  3RK3 B;  3H6P A;  1ZR2 A;  3BRV B;  1MV8 A;  3VP8 A;  1SQB K;  1IJD B;  3TNU B;  2KOG A;  2WZ7 A;  4M3L A;  2OYH B;  1GL2 C;  1L4A C;  5AW7 B;  1S9K E;  3HD7 D;  3HE4 B;  1ZV8 A;  3RK3 C;  1JTH B;  1FZB A;  3TNU A;  2P1J A;  5AW9 B;  3H32 B;  4OH8 B;  5BU5 A;  3RK3 D;  3HTK A;  2IFN A;  3RK2 D;  1GL2 D;  1IC2 A;  5APS A;  1GDT A;  5AW0 B;  3GHG B;  4I1L A;  1LT9 B;  1JY2 O;  1RF0 A;  1OXZ A;  4DZO A;  2N1T C;  5AVT B;  1X8Y A;  1RE3 A;  1L4A A;  1XTC C;  3GHG A;  4WBA A;  1SFC C;  5BVZ A;  3OA7 A;  2R5B A;  3HD7 A;  4Y99 B;  1YTZ T;  1JTH A;  1H89 A;  1FZC B;  1GU4 A;  4GKG A;  1J2J B;  4W80 A;  2WPR A;  3V2Q A;  3EQ2 A;  1N7S D;  2XV5 A;  3M91 A;  1ZN5 A;  2Z5I A;  2O01 H;  3OAK A;  3NXS A;  1HGZ A;  1G2C A;  1LWU A;  3VTP C;  3MIW A;  1FZC C;  1RE4 A;  3TSI A;  2Z5H A;  1SLQ A;  2NPS A;  1N73 A;  1J1E C;  1NKN A;  3P8C D;  1JOC A;  1HUC A;  3P8M C;  2NPS B;  1N73 B;  1G1J A;  2YNY A;  3HE5 B;  2FXM A;  2M3B A;  2HPC A;  1YTZ I;  1SQX K;  1X9V A;  3LID A;  1A02 F;  2POH A;  3N4X A;  1URQ B;  5APW A;  2LKM A;  1N7S C;  4GIF A;  5AVU B;  1RF0 C;  5CJ0 A;  3OJA B;  1LWU B;  4C7N A;  1NU1 K;  3MD0 A;  4JYB A;  1NO4 A;  4ZKU A;  1SQV K;  1MFZ A;  2XZR A;  1GTW A;  1NKZ B;  1RE3 C;  4GT1 A;  1H8A A;  1T3U A;  3SWY A;  5CCG C;  3U1A A;  2Z4E A;  2BAS A;  3SWF A;  2I1K A;  3HTK B;  1S9K D;  3HE5 A;  5KJ7 D;  1H88 A;  1LTJ C;  1G1I A;  2OYH C;  3V2N A;  1JUN A;  1T8Z A;  5CCH D;  1KZU B;  2N1T B;  1LTG C;  2IX7 C;  3RL0 C;  1LTT C;  3N7N A;  4I2L C;  4C46 A;  4EIJ A;  2IPP A;  1FJK A;  4WY4 A;  3V5B A;  1NHL A;  2WSE H;  2FFD A;  5CMZ A;  4AYC A;  1L4A D;  1Z56 A;  1FOS F;  3EFG A;  1SVF A;  1LGH B;  2MJZ A;  2H8P D;  4N78 D;  2WIT A;  4KHX A;  3VMX A;  1J1D C;  3V2P A;  5APT A;  2HLO A;  3P7K A;  1JCC A;  2FYZ A;  1NTK K;  1KIL D;  1KIL A;  3LW5 H;  2H43 A;  1URQ A;  2WSF H;  4O9B A;  2QM8 A;  1LWU C;  2FFD B;  1FZC A;  1FZF A;  1SFC A;  3TYY A;  2Q3I A;  2KP8 A;  2J59 M;  2C9L Y;  1SFC B;  1FZA A;  2JEE A;  4IFM A;  5CHX A;  1WRG A;  1OWA A;  2IFM A;  1RF1 A;  1LTJ B;  3A3Y B;  5KTB A;  1GK4 A;  5CCG A;  3MGN A;  4LLH A;  3IR9 A;  2HOD A;  3I5C A;  4LC1 A;  1VDF A;  2VRS A;  4N6J A;  1LTS C;  1WT6 A;  1HJB A;  2W6B A;  4Y99 C;  2KYV A;  1JY3 P;  2NPS D;  2OYI C;  2ZFC A;  3VN0 A;  4C7N B;  3TK1 A;  2C0W A;  1URQ C;  1KIL C;  3PP5 A;  1DH3 A;  3GHG C;  1T2K D;  1LT9 C;  1SP4 A;  3B5N A;  5AW6 B;  1SFC D;  4HH2 A;  2WTY A;  3VOP A;  1J1E B;  2ZXE B;  1M1J A;  3HUS C;  1NTM K;  2E43 A;  2YKO A;  3A5T A;  2C0X A;  1VPC A;  3V4Q A;  3NTN A;  3UIA A;  4HYT B;  2P2U A;  5AVQ B;  2O1K A;  5KLV K;  1FU1 A;  1FAV A;  1KQL A;  3C9I A;  2OYI B;  5AVY B;  1LTB C;  1GL2 B;  2M8R A;  2R5D A;  3B5N D;  4DOJ A;  1JCD A;  3CL3 D;  1HGV A;  1NH4 A;  3LIE A;  2KB7 P;  1DEB A;  4IFF A;  3MTU E;  3CLQ A;  5KJ7 C;  3KQG A;  4WB4 A;  1X79 B;  3A2A A;  1FBM A;  5CCG D;  1PFI A;  3RK2 B;  3E1I A;  2L5G B;  4C7R A;  3BVH A;  1KFM A;  1T2K C;  3CI9 A;  5APY A;  5AW2 B;  3II6 A;  2PP6 A;  1SQQ K;  1IO4 A;  3IFM A;  1MZ9 A;  2N1T A;  2HG5 D;  5AVS B;  5APX A;  1NTZ K;  3VMZ A;  5AW1 B;  3HD7 B;  2NPS C;  1N73 C;  4RES B;  1IFM A;  2GUV A;  2W6A A;  1CZQ A;  3A7O A;  5AVX B;  5AVV B;  2YMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...