1VDLA

Solution structure of rsgi ruh-013, a uba domain in mouse cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
GSSGSSGMTVEQNVLQQSAAQKHQQTFLNQLREITGINDAQILQQALKDSNGNLELAVAFLTAKNAKTPPQEETSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 25
publication title Solution Structure of RSGI RUH-013, a UBA domain in Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 13
structure length 80
sequence length 80
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vdlA00
2MJ5B 1ZMVA 1IXSA 3GLHE 1VDLA 2O25A 1WGNA 2OOBA 2JUJA 1VEGA 1OAIA 2DAMA 1AIPC 2ZTCA 1Q02A 2B3TA 2KNAA 1SG9A 2JY6B 5DFLA 3MMPA 3GLIE 1DO2A 1HJPA 2JP7A 2DAEA 1P3QQ 1V92A 2DAKA 1G4AE 2DAGA 1TR8A 4GEWA 1GO5A 3K9OA 1TTEA 2JZ0A 2EKFA 2DI0A 4UN2B 2KHHA 2DKLA 1G3IA 3FRIA 3FRHA 2ZTDA 1Y8GA 2JNHA 1C7YA 2BWEA 1WHCA 2L4EA 3E46A 1HQYE 1G41A 2LVNC 1YLAA 2DENA 2JY7A 1ZMUA 2DZLA 2LVOC 1IM2A 1XB2B 3GLFE 1VEKA 2DNAA 2KNVA 1ZV1A 2K9DA 1OQYA 1UFZA 1HT1E 1F4IA 2L4FA 2OO9A 2QSFX 1WR1B 2LVQD 1OKSA 1CUKA 5JI2E 2CP8A 2K0BX 1T6OA 2LVPC 1EFUB 1T43A 2MR9A 2EKKA 3BBZA 1XXHE 1BVSA 1WIVA 2WZJA 1NV9A 1A5TA 1MN3A 2JY8A 2KNZA 4G3OA 1IFYA 2RRUA 2MGWA 1DV0A 3F92A 1WGLA 1R4GA 2QNJA 1KYIA 3LCVB 1WJ7A 3E21A 2DAIA 2H5XA 3GLGE 4F1IA 1QZEA 3FE3A 4R71A 3B89A 2L2DA 3LCUA 1JR3E 2EJSA 2G3QA 1E94E 4HEOA 3H4JA 3IECA 2HAKA 2JZ1A 2LBCA 1ZMWA 3T6PA 4WP2A 4Q7JA 1OTRA 2DHYA 1PGYA 3IHPA 2QHOB 2LVAA 2BWBA 1HT2E 4DBGB 4F2LA 2HWJA 1VEJA 1VG5A 1DO0A 1NV8A 2JY5A 2R0IA 2LTUA 2OOAA 1VQ1A 2MROB 3K9PA 2CWBA
chains in the Genus database with same CATH superfamily
2UUCM 2VF7A 2LHCA 4GITA 4G4NA 4FW9A 2BJVA 2RGOA 3J7AS 4GKKM 4B08A 3I51A 4NXMM 3VLFB 3HJ8A 4QNRA 2VIIA 1YSYA 2KNAA 4G4OA 2JY6B 5DFLA 5EXSA 2Z7JA 1HJPA 3U5ZB 1P3QQ 2FFJA 3FKEA 1JB0F 3KOYE 5FTLA 3NWLA 1IN7A 4HLQA 2HCBA 4NSOB 3SASA 2J7OA 4OX9M 3U6OA 4G6ZA 1GO5A 3Q8XA 1N36M 3HZJA 3A98B 4DV2M 4UN2B 5FTJA 4B7GA 3SAUA 1DGHB 4LF9M 4JN6A 2FH0A 1N32M 4NRWA 1IXRC 5EXXA 5ITTA 2BWEA 1QAOA 4D81A 1K82A 1QAQA 1QDRA 1WHCA 2X8AA 2ZAMA 2QZ4A 3DOAA 3E46A 1YLAA 1LV7A 2I7PA 3VK7A 4LF4M 2K6BA 3K8ZA 3THGA 1EE8A 2LHGA 1SXJD 2P5TA 1R2ZA 2J7NA 3D8LA 1G59A 2O01F 4OU7A 4ANRA 1TH2A 3U6QA 2DZLA 3SAVA 3HHXA 2VF8A 2LWXA 4FWHA 1PJIA 2CUZA 4JV5M 4IBKA 2KNVA 3HY5A 4JI3M 4LZZA 1PJTA 4W5WA 2M60A 2HKJA 1NO1A 3ZCBB 1IN5A 1WR1B 2H1RA 3FYDA 1NJFA 2JXNA 2BNKA 1T6OA 3V76A 1FJGM 2EKKA 4MGZE 2CE7A 1WIVA 4KLNA 3L26A 4BBAA 1NV9A 4OVZB 2ZANA 2DWNA 3VDUA 3KOXE 4DR3M 1SXJB 3U6SA 1RU3A 2Q2EB 2MGWA 1Z5AA 2DWMA 3F92A 3TL4X 2QCUA 1IFYA 1IN6A 3PVSA 5JI3E 1YUBA 4AI6A 4MGIE 1KYIA 3LCVB 3SMSA 2O5RA 1Z59A 2XGNA 3KP0E 4XK8F 4AZFA 4G4QA 3AKZA 1J5EM 2N35A 2F4VM 3M7GA 4R71A 3W0LB 4DR5M 2FE8A 4M9XA 2L7HA 3SYKA 3ZQJA 3LCUA 2EJSA 3KXEC 1G8PA 4JXJA 1H6UA 5IREB 2W82A 3C3DA 4I8OA 4WURA 2JWSA 1XHBA 2D7HA 2LNHC 3HHZA 2JA2A 4M9ZA 3I4VA 2DHYA 1SXJC 3HJQA 4AW4A 4LF8M 3GLIB 4IBGA 1GLNA 1HT2E 3GLHA 1NHGC 2RKOA 1DO0A 1J09A 3SATA 2JY5A 2R0IA 3L2AA 2L7IA 2LTUA 4R7GA 5C1BA 5DYGA 3U6PA 2QBYA 1JQJC 3K9PA 5EP4A 1UM8A 1N34M 4AKIA 1R5LA 2HL7A 2QP9X 2XSZA 1ZMVA 1IXSA 4P17A 1XWIA 1Q3CA 4MGKE 1FNNA 3A46A 1G71A 1VDLA 2O25A 1W5SA 1WGNA 2JUJA 4CJ6A 2KEBA 1VEGA 4PDIA 5KQDA 2UU9M 4B3TM 4L8RC 1OAIA 5FTNA 2ZTCA 1Q02A 4LGYA 3QAUA 2F5PA 1N78A 3J27B 1XXHA 3TWMA 3DA1A 1DO2A 5H37D 1V92A 3GQ3A 1I94M 2DAKA 1G4AE 3IG5A 2KXEA 4B7HA 1PM5A 3K9OA 4Y28F 4QHTA 4BB9A 4FD2A 3U61A 3FUVA 5KO3A 5GKNA 2CV2A 3CF6E 3AL0C 4QOZC 3VKHA 2EKFA 2KA6B 5ITUA 2KHHA 3J2PB 3PNVA 4IJFA 2DKLA 1QDTA 4LZJA 2F5OA 4GHAA 2YFQA 2FS1A 4X65M 5ITRA 1TF0B 4CGYB 2YR0A 3RFWA 3SC3A 4R3DA 3GLGA 3SBJA 4JI1M 4KHPM 1HQYE 1GJSA 2DWLA 2LVNC 2CV0A 2F5QA 2DENA 4JI4M 4M0DA 5FSWA 4DV6M 1NHWC 2EO2A 3L27A 4FCTA 4JYAM 1K3XA 1JR3A 3L29A 3GP1A 5IZ7D 1IM2A 3AFHA 3LW5F 2BJWA 3M0EA 4IBCA 2KZUA 1HNZM 2DNAA 3SFZA 1ZV1A 2R65A 4KO8A 4NSRA 4IBIA 5ITXE 4ZPXA 4JI7M 4MGHA 2L4FA 2OO9A 1KSFX 5FTKA 5JI2E 3UJNA 3GQ4A 1NJGA 2XZUA 3DFZA 3ZC7B 2XFTA 4OW0A 2DXIA 4JI8M 3GPPA 4EIWA 1NNJA 3BBZA 3U6LA 4I4LA 1BVSA 2WZJA 1R6BX 3CTWB 3GPUA 1QYRA 2J5YA 1L1TA 2CRUA 2JY8A 4X64M 3K2LA 1QUTA 1NSFA 4WW0A 3BOSA 5EP1A 4BLCA 2Z4SA 4L16A 4XBOA 5F3WA 1HNXM 3C9PA 4GRIA 3FTDA 4YHHM 2R18A 3J81S 2C9CA 2FOIC 1DGBA 4LRTA 4LFBM 5L8RF 4ITQA 1I4WA 3Q8GA 4LF6M 1T3TA 2QNJA 5A2QS 3I01M 3UK6A 3HX3A 4F1IA 4S12A 3W68A 4RNAA 3R8FA 1XMOM 3B89A 3U5ZA 5IWAM 2DWZB 3KOWE 2GQFA 4D82A 1LTMA 1ORYB 4HEOA 1Z5BA 5EJCA 3OTOM 2OPFA 2HAKA 2D7EA 2KRKA 2LBCA 3T6PA 3SYLA 1W5TA 2Y20A 4PCZA 3SHGB 3L28A 4DUZM 4PT5A 1DGHA 2UXDM 1J7KA 1SXJE 2E5LM 3H4MA 2F5NA 2FNAA 3M6AA 4DBGB 1HR0M 5C18A 4F2LA 1IQPA 2R62A 1DGFA 2XSZD 3ILKA 4YY3M 2NQ8C 4AG5A 4LG2A 1NVMA 2XLJA 2DHRA 1E32A 2R4JA 3HJSA 4LJ6A 2ERCA 4I5SA 1OAOC 1Q39A 2OOAA 3B7NA 5E6JA 2VQEM 5BPVA 1GVNA 1NNUC 4M9SA 2CWBA 1R2YA 1IY0A 3FUXA 4FCVA 3TWKA 2CHVA 3GLHB 3A42A 3BXWA 3FUTA 3GLHE 3QYEA 3T15A 3VK8A 2XZFA 3SAWA 4JI5M 3IG8A 2OOBA 2Y0TA 4A3VB 5BR8M 1IBKM 5ITYA 2R6FA 1XNQM 4LJAA 1OIZA 2DAMA 4FWGA 2EUCA 1Z6TA 1Q3BA 1QAMA 2B3TA 3A45A 4QHSA 4GC5A 2QBYB 4CISA 2XH9A 3GLIE 2JP7A 3K1JA 1NY5A 1IXSB 2G8LA 4PDGA 2EA0A 4XGIA 4X62M 1QVRA 3FD9A 4OVZA 4LFCM 3WHLA 1TTEA 4G4RA 4JI6M 2DI0A 4MGYE 2DZOB 4CHTB 2QPAA 5KPTA 1L2BA 3GRUA 3FRIA 3GLFA 1JR3D 3FRHA 1XXHB 2ZTDA 1Y8GA 2ZBKB 1IBLM 4GKJM 2JNHA 4CIZA 1IBMM 4DV7M 1PJJA 1MJGM 2Z4RA 2L4EA 3I4YA 4NOOB 2I7NA 1G41A 1N77A 1D0MA 1DGGA 2D7GA 4I81A 5EQTA 4DR2M 3AOEA 4Z6YA 3HU3A 7CATA 1XMQM 1TDHA 2JY7A 4PD2A 2YNMD 2MH8A 2ZAOA 4B7FA 3GO8A 1GABA 4B3RM 2LVOC 1D2NA 1MU5A 1N75A 1XB2B 1VEKA 2DVWB 3B74A 4B3MM 3R9XB 2YQZA 1MX0A 2RGHA 2M5ZA 3LVWA 3GLGB 2K9DA 4DR1M 3DZDA 3E9SA 1F4IA 1HT1E 3SARA 3KOZE 1TH4A 2DZNB 2K0BX 3GPYA 3NBIA 2LVPC 1EFUB 1T43A 2MR9A 2G5GX 4IIWA 4JI2M 2F5SA 4IJEA 4DV5M 1PJSA 4HL4A 1A5TA 2KNZA 4MM3B 3RE8A 3KVWA 3MHVC 5EP3A 1DV0A 3KW6A 4KT0F 1GJTA 3U60A 3WHKA 3SHFA 3T38A 5KQ8A 3KS8A 3GRRA 1L8QA 3J7BA 1R4GA 2L6OA 4LCBA 1WJ7A 3AV0A 4Z8XA 1IN4A 3W0FA 2UUBM 2H5XA 4DV3M 3W67A 5KPRA 2UXBM 1L2DA 4K0KM 1QUSA 2X4AA 2AHMA 4NL4H 3SMPA 3NBXX 3PFIA 2L2DA 3HGIA 4LJ5A 4DR4M 4X66M 2G3QA 3PXGA 2OQ4A 1PJQA 2QQ8A 3H4JA 3IECA 2Z3XA 4DV1M 3CF0A 4LY6A 1IXZA 2CHQA 2KDLA 4B3SM 1V34A 1OTRA 3HHYA 1PGYA 4FVMA 1EIJA 2QHOB 3EIEA 3UZUA 2BWBA 5DYIA 3HKPA 3T1YM 4AG6A 3T1HM 4D80A 1N33M 3LVVA 4LGMA 5LMUM 3TQSA 3CGWA 3KS4A 1K3WA 3KSXA 2V6ZM 4IBFA 3VDPA 3JR4A 2C96A 3LMMA 1ZQ9A 2CHGA 2C98A 1VQ1A 3HHWA 4LRSA 1GKIA 2CEAA 2X49A 4LFAM 5DNYA 2ZM6M 3EIHA 1ZAEA 2MJ5B 2KRUA 2L09A 3HWSA 4GH9A 4L15A 3U6EA 1XC8A 4TUWA 2C99A 3J80S 5ITXA 4RF1A 4RKUF 2V1CA 4QOSA 1OFHA 2VDBB 3GQ5A 3B7QA 3K92A 5EXPA 1SG9A 3AOGA 4RF0A 5IT9S 3MMPA 3U6CA 4REZA 2DAEA 4IBBA 2Y21A 3C58A 4FWDA 2DAGA 2UXCM 2CFOA 1TR8A 3KFUG 4GEWA 5KPZA 3U6MA 4JI0M 2WSCF 2JZ0A 3U6DA 1D0LA 4DV0M 4P16A 2Z8YM 1V33A 3B9PA 4LJ7A 3UMMA 3MJ5A 3B7ZA 2V1UA 1G3IA 2R45A 3LQRA 1IY1A 1C7YA 1OIPA 4GMQA 1YE9A 4L4UA 3FTEA 2QENA 1X37A 4LF7M 3FTFA 4L6V6 3TPZA 1VDDA 1IY2A 1GL6A 1ZMUA 3L25A 1PRBA 3GLFB 3GLFE 3AJIB 1QANA 2A5YB 3HU1A 2R46A 3HU2A 1QZMA 4LJ8A 2KW0A 3PNYA 4AKGA 3FTCA 3KDSE 1OQYA 3KSJA 3E4RA 2Y0QA 4GC9A 3UGJA 1UFZA 2C9OA 5EP2A 1XNRM 1SXJA 4GIPA 1D0KA 4DV4M 2QSFX 4NRVA 4AQYM 2LVQD 1OKSA 1CUKA 2CP8A 1GL7A 2CV1A 1WXQA 4DR6M 4IBJA 1XXHE 3MK6A 3C3EA 4DR7M 4IBEA 8CATA 4LJ9A 1L1ZA 2APLA 1MN3A 1E9RA 2WSFF 4G3OA 3U61B 1OJLA 2UUAM 2XF3A 2RRUA 3RGPA 1WGLA 2R4EA 2K47A 4FCWA 1TDZA 3RGSA 2C5RA 2WSEF 1NY6A 1S3SA 5LMNM 1OFIA 4NC6A 3KP1E 4LJ4A 3TE6A 5ITQA 3E21A 2DAIA 3VFDA 3GLGE 2LXEA 2GNOA 3FYCA 3JAMS 1IN8A 3VKGA 1C1KA 3AOEC 1QZEA 3FE3A 3GLIA 1HQCA 4DUYM 4II7A 3U60B 4KODA 1JR3E 2KZSA 2R44A 3CF2A 5FTMA 1E94E 4L78A 5EXTA 3FUUA 2JZ1A 3LQQA 1ZMWA 3GRVA 1TGUA 1AUAA 4WP2A 1L2CA 4Q7JA 4MH0E 3IHPA 2VQFM 2LVAA 3QYBA 4AKHA 4GHLA 3QWLA 2LH0A 4MB7A 2HWJA 1VEJA 1VG5A 3FUWA 4IBDA 4LF5M 1NV8A 1KFVA 1R7RA 4M0WA 3D8BA 5FLXS 1TH3A 2HHHM 4QNMA 3JR5A 4NXNM 2XFSA 3TWLA 2MROB 1Z5CA 2XEPA 1E9SA 3ZH9B 3GRYA 5E26A 1QQWA 3GPXA 1AIPC 1HNWM 3I04M
chains in the Genus database with same CATH topology
2MJ5B 1ZMVA 1IXSA 3GLHE 1VDLA 2O25A 1WGNA 2OOBA 2JUJA 1VEGA 1OAIA 2DAMA 1AIPC 2ZTCA 1Q02A 2B3TA 2KNAA 1SG9A 2JY6B 5DFLA 3MMPA 3GLIE 1DO2A 1HJPA 2JP7A 2DAEA 1P3QQ 1V92A 2DAKA 1G4AE 2DAGA 1TR8A 4GEWA 1GO5A 3K9OA 1TTEA 2JZ0A 2EKFA 2DI0A 4UN2B 2KHHA 2DKLA 1G3IA 3FRIA 3FRHA 2ZTDA 1Y8GA 2JNHA 1C7YA 2BWEA 1WHCA 2L4EA 3E46A 1HQYE 1G41A 2LVNC 1YLAA 2DENA 2JY7A 1ZMUA 2DZLA 2LVOC 1IM2A 1XB2B 3GLFE 1VEKA 2DNAA 2KNVA 1ZV1A 2K9DA 1OQYA 1UFZA 1HT1E 1F4IA 2L4FA 2OO9A 2QSFX 1WR1B 2LVQD 1OKSA 1CUKA 5JI2E 2CP8A 2K0BX 1T6OA 2LVPC 1EFUB 1T43A 2MR9A 2EKKA 3BBZA 1XXHE 1BVSA 1WIVA 2WZJA 1NV9A 1A5TA 1MN3A 2JY8A 2KNZA 4G3OA 1IFYA 2RRUA 2MGWA 1DV0A 3F92A 1WGLA 1R4GA 2QNJA 1KYIA 3LCVB 1WJ7A 3E21A 2DAIA 2H5XA 3GLGE 4F1IA 1QZEA 3FE3A 4R71A 3B89A 2L2DA 3LCUA 1JR3E 2EJSA 2G3QA 1E94E 4HEOA 3H4JA 3IECA 2HAKA 2JZ1A 2LBCA 1ZMWA 3T6PA 4WP2A 4Q7JA 1OTRA 2DHYA 1PGYA 3IHPA 2QHOB 2LVAA 2BWBA 1HT2E 4DBGB 4F2LA 2HWJA 1VEJA 1VG5A 1DO0A 1NV8A 2JY5A 2R0IA 2LTUA 2OOAA 1VQ1A 2MROB 3K9PA 2CWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ5 B;  1ZMV A;  1IXS A;  3GLH E;  1VDL A;  2O25 A;  1WGN A;  2OOB A;  2JUJ A;  1VEG A;  1OAI A;  2DAM A;  1AIP C;  2ZTC A;  1Q02 A;  2B3T A;  2KNA A;  1SG9 A;  2JY6 B;  5DFL A;  3MMP A;  3GLI E;  1DO2 A;  1HJP A;  2JP7 A;  2DAE A;  1P3Q Q;  1V92 A;  2DAK A;  1G4A E;  2DAG A;  1TR8 A;  4GEW A;  1GO5 A;  3K9O A;  1TTE A;  2JZ0 A;  2EKF A;  2DI0 A;  4UN2 B;  2KHH A;  2DKL A;  1G3I A;  3FRI A;  3FRH A;  2ZTD A;  1Y8G A;  2JNH A;  1C7Y A;  2BWE A;  1WHC A;  2L4E A;  3E46 A;  1HQY E;  1G41 A;  2LVN C;  1YLA A;  2DEN A;  2JY7 A;  1ZMU A;  2DZL A;  2LVO C;  1IM2 A;  1XB2 B;  3GLF E;  1VEK A;  2DNA A;  2KNV A;  1ZV1 A;  2K9D A;  1OQY A;  1UFZ A;  1HT1 E;  1F4I A;  2L4F A;  2OO9 A;  2QSF X;  1WR1 B;  2LVQ D;  1OKS A;  1CUK A;  5JI2 E;  2CP8 A;  2K0B X;  1T6O A;  2LVP C;  1EFU B;  1T43 A;  2MR9 A;  2EKK A;  3BBZ A;  1XXH E;  1BVS A;  1WIV A;  2WZJ A;  1NV9 A;  1A5T A;  1MN3 A;  2JY8 A;  2KNZ A;  4G3O A;  1IFY A;  2RRU A;  2MGW A;  1DV0 A;  3F92 A;  1WGL A;  1R4G A;  2QNJ A;  1KYI A;  3LCV B;  1WJ7 A;  3E21 A;  2DAI A;  2H5X A;  3GLG E;  4F1I A;  1QZE A;  3FE3 A;  4R71 A;  3B89 A;  2L2D A;  3LCU A;  1JR3 E;  2EJS A;  2G3Q A;  1E94 E;  4HEO A;  3H4J A;  3IEC A;  2HAK A;  2JZ1 A;  2LBC A;  1ZMW A;  3T6P A;  4WP2 A;  4Q7J A;  1OTR A;  2DHY A;  1PGY A;  3IHP A;  2QHO B;  2LVA A;  2BWB A;  1HT2 E;  4DBG B;  4F2L A;  2HWJ A;  1VEJ A;  1VG5 A;  1DO0 A;  1NV8 A;  2JY5 A;  2R0I A;  2LTU A;  2OOA A;  1VQ1 A;  2MRO B;  3K9P A;  2CWB A; 
#chains in the Genus database with same CATH topology
 2UUC M;  2VF7 A;  2LHC A;  4GIT A;  4G4N A;  4FW9 A;  2BJV A;  2RGO A;  3J7A S;  4GKK M;  4B08 A;  3I51 A;  4NXM M;  3VLF B;  3HJ8 A;  4QNR A;  2VII A;  1YSY A;  2KNA A;  4G4O A;  2JY6 B;  5DFL A;  5EXS A;  2Z7J A;  1HJP A;  3U5Z B;  1P3Q Q;  2FFJ A;  3FKE A;  1JB0 F;  3KOY E;  5FTL A;  3NWL A;  1IN7 A;  4HLQ A;  2HCB A;  4NSO B;  3SAS A;  2J7O A;  4OX9 M;  3U6O A;  4G6Z A;  1GO5 A;  3Q8X A;  1N36 M;  3HZJ A;  3A98 B;  4DV2 M;  4UN2 B;  5FTJ A;  4B7G A;  3SAU A;  1DGH B;  4LF9 M;  4JN6 A;  2FH0 A;  1N32 M;  4NRW A;  1IXR C;  5EXX A;  5ITT A;  2BWE A;  1QAO A;  4D81 A;  1K82 A;  1QAQ A;  1QDR A;  1WHC A;  2X8A A;  2ZAM A;  2QZ4 A;  3DOA A;  3E46 A;  1YLA A;  1LV7 A;  2I7P A;  3VK7 A;  4LF4 M;  2K6B A;  3K8Z A;  3THG A;  1EE8 A;  2LHG A;  1SXJ D;  2P5T A;  1R2Z A;  2J7N A;  3D8L A;  1G59 A;  2O01 F;  4OU7 A;  4ANR A;  1TH2 A;  3U6Q A;  2DZL A;  3SAV A;  3HHX A;  2VF8 A;  2LWX A;  4FWH A;  1PJI A;  2CUZ A;  4JV5 M;  4IBK A;  2KNV A;  3HY5 A;  4JI3 M;  4LZZ A;  1PJT A;  4W5W A;  2M60 A;  2HKJ A;  1NO1 A;  3ZCB B;  1IN5 A;  1WR1 B;  2H1R A;  3FYD A;  1NJF A;  2JXN A;  2BNK A;  1T6O A;  3V76 A;  1FJG M;  2EKK A;  4MGZ E;  2CE7 A;  1WIV A;  4KLN A;  3L26 A;  4BBA A;  1NV9 A;  4OVZ B;  2ZAN A;  2DWN A;  3VDU A;  3KOX E;  4DR3 M;  1SXJ B;  3U6S A;  1RU3 A;  2Q2E B;  2MGW A;  1Z5A A;  2DWM A;  3F92 A;  3TL4 X;  2QCU A;  1IFY A;  1IN6 A;  3PVS A;  5JI3 E;  1YUB A;  4AI6 A;  4MGI E;  1KYI A;  3LCV B;  3SMS A;  2O5R A;  1Z59 A;  2XGN A;  3KP0 E;  4XK8 F;  4AZF A;  4G4Q A;  3AKZ A;  1J5E M;  2N35 A;  2F4V M;  3M7G A;  4R71 A;  3W0L B;  4DR5 M;  2FE8 A;  4M9X A;  2L7H A;  3SYK A;  3ZQJ A;  3LCU A;  2EJS A;  3KXE C;  1G8P A;  4JXJ A;  1H6U A;  5IRE B;  2W82 A;  3C3D A;  4I8O A;  4WUR A;  2JWS A;  1XHB A;  2D7H A;  2LNH C;  3HHZ A;  2JA2 A;  4M9Z A;  3I4V A;  2DHY A;  1SXJ C;  3HJQ A;  4AW4 A;  4LF8 M;  3GLI B;  4IBG A;  1GLN A;  1HT2 E;  3GLH A;  1NHG C;  2RKO A;  1DO0 A;  1J09 A;  3SAT A;  2JY5 A;  2R0I A;  3L2A A;  2L7I A;  2LTU A;  4R7G A;  5C1B A;  5DYG A;  3U6P A;  2QBY A;  1JQJ C;  3K9P A;  5EP4 A;  1UM8 A;  1N34 M;  4AKI A;  1R5L A;  2HL7 A;  2QP9 X;  2XSZ A;  1ZMV A;  1IXS A;  4P17 A;  1XWI A;  1Q3C A;  4MGK E;  1FNN A;  3A46 A;  1G71 A;  1VDL A;  2O25 A;  1W5S A;  1WGN A;  2JUJ A;  4CJ6 A;  2KEB A;  1VEG A;  4PDI A;  5KQD A;  2UU9 M;  4B3T M;  4L8R C;  1OAI A;  5FTN A;  2ZTC A;  1Q02 A;  4LGY A;  3QAU A;  2F5P A;  1N78 A;  3J27 B;  1XXH A;  3TWM A;  3DA1 A;  1DO2 A;  5H37 D;  1V92 A;  3GQ3 A;  1I94 M;  2DAK A;  1G4A E;  3IG5 A;  2KXE A;  4B7H A;  1PM5 A;  3K9O A;  4Y28 F;  4QHT A;  4BB9 A;  4FD2 A;  3U61 A;  3FUV A;  5KO3 A;  5GKN A;  2CV2 A;  3CF6 E;  3AL0 C;  4QOZ C;  3VKH A;  2EKF A;  2KA6 B;  5ITU A;  2KHH A;  3J2P B;  3PNV A;  4IJF A;  2DKL A;  1QDT A;  4LZJ A;  2F5O A;  4GHA A;  2YFQ A;  2FS1 A;  4X65 M;  5ITR A;  1TF0 B;  4CGY B;  2YR0 A;  3RFW A;  3SC3 A;  4R3D A;  3GLG A;  3SBJ A;  4JI1 M;  4KHP M;  1HQY E;  1GJS A;  2DWL A;  2LVN C;  2CV0 A;  2F5Q A;  2DEN A;  4JI4 M;  4M0D A;  5FSW A;  4DV6 M;  1NHW C;  2EO2 A;  3L27 A;  4FCT A;  4JYA M;  1K3X A;  1JR3 A;  3L29 A;  3GP1 A;  5IZ7 D;  1IM2 A;  3AFH A;  3LW5 F;  2BJW A;  3M0E A;  4IBC A;  2KZU A;  1HNZ M;  2DNA A;  3SFZ A;  1ZV1 A;  2R65 A;  4KO8 A;  4NSR A;  4IBI A;  5ITX E;  4ZPX A;  4JI7 M;  4MGH A;  2L4F A;  2OO9 A;  1KSF X;  5FTK A;  5JI2 E;  3UJN A;  3GQ4 A;  1NJG A;  2XZU A;  3DFZ A;  3ZC7 B;  2XFT A;  4OW0 A;  2DXI A;  4JI8 M;  3GPP A;  4EIW A;  1NNJ A;  3BBZ A;  3U6L A;  4I4L A;  1BVS A;  2WZJ A;  1R6B X;  3CTW B;  3GPU A;  1QYR A;  2J5Y A;  1L1T A;  2CRU A;  2JY8 A;  4X64 M;  3K2L A;  1QUT A;  1NSF A;  4WW0 A;  3BOS A;  5EP1 A;  4BLC A;  2Z4S A;  4L16 A;  4XBO A;  5F3W A;  1HNX M;  3C9P A;  4GRI A;  3FTD A;  4YHH M;  2R18 A;  3J81 S;  2C9C A;  2FOI C;  1DGB A;  4LRT A;  4LFB M;  5L8R F;  4ITQ A;  1I4W A;  3Q8G A;  4LF6 M;  1T3T A;  2QNJ A;  5A2Q S;  3I01 M;  3UK6 A;  3HX3 A;  4F1I A;  4S12 A;  3W68 A;  4RNA A;  3R8F A;  1XMO M;  3B89 A;  3U5Z A;  5IWA M;  2DWZ B;  3KOW E;  2GQF A;  4D82 A;  1LTM A;  1ORY B;  4HEO A;  1Z5B A;  5EJC A;  3OTO M;  2OPF A;  2HAK A;  2D7E A;  2KRK A;  2LBC A;  3T6P A;  3SYL A;  1W5T A;  2Y20 A;  4PCZ A;  3SHG B;  3L28 A;  4DUZ M;  4PT5 A;  1DGH A;  2UXD M;  1J7K A;  1SXJ E;  2E5L M;  3H4M A;  2F5N A;  2FNA A;  3M6A A;  4DBG B;  1HR0 M;  5C18 A;  4F2L A;  1IQP A;  2R62 A;  1DGF A;  2XSZ D;  3ILK A;  4YY3 M;  2NQ8 C;  4AG5 A;  4LG2 A;  1NVM A;  2XLJ A;  2DHR A;  1E32 A;  2R4J A;  3HJS A;  4LJ6 A;  2ERC A;  4I5S A;  1OAO C;  1Q39 A;  2OOA A;  3B7N A;  5E6J A;  2VQE M;  5BPV A;  1GVN A;  1NNU C;  4M9S A;  2CWB A;  1R2Y A;  1IY0 A;  3FUX A;  4FCV A;  3TWK A;  2CHV A;  3GLH B;  3A42 A;  3BXW A;  3FUT A;  3GLH E;  3QYE A;  3T15 A;  3VK8 A;  2XZF A;  3SAW A;  4JI5 M;  3IG8 A;  2OOB A;  2Y0T A;  4A3V B;  5BR8 M;  1IBK M;  5ITY A;  2R6F A;  1XNQ M;  4LJA A;  1OIZ A;  2DAM A;  4FWG A;  2EUC A;  1Z6T A;  1Q3B A;  1QAM A;  2B3T A;  3A45 A;  4QHS A;  4GC5 A;  2QBY B;  4CIS A;  2XH9 A;  3GLI E;  2JP7 A;  3K1J A;  1NY5 A;  1IXS B;  2G8L A;  4PDG A;  2EA0 A;  4XGI A;  4X62 M;  1QVR A;  3FD9 A;  4OVZ A;  4LFC M;  3WHL A;  1TTE A;  4G4R A;  4JI6 M;  2DI0 A;  4MGY E;  2DZO B;  4CHT B;  2QPA A;  5KPT A;  1L2B A;  3GRU A;  3FRI A;  3GLF A;  1JR3 D;  3FRH A;  1XXH B;  2ZTD A;  1Y8G A;  2ZBK B;  1IBL M;  4GKJ M;  2JNH A;  4CIZ A;  1IBM M;  4DV7 M;  1PJJ A;  1MJG M;  2Z4R A;  2L4E A;  3I4Y A;  4NOO B;  2I7N A;  1G41 A;  1N77 A;  1D0M A;  1DGG A;  2D7G A;  4I81 A;  5EQT A;  4DR2 M;  3AOE A;  4Z6Y A;  3HU3 A;  7CAT A;  1XMQ M;  1TDH A;  2JY7 A;  4PD2 A;  2YNM D;  2MH8 A;  2ZAO A;  4B7F A;  3GO8 A;  1GAB A;  4B3R M;  2LVO C;  1D2N A;  1MU5 A;  1N75 A;  1XB2 B;  1VEK A;  2DVW B;  3B74 A;  4B3M M;  3R9X B;  2YQZ A;  1MX0 A;  2RGH A;  2M5Z A;  3LVW A;  3GLG B;  2K9D A;  4DR1 M;  3DZD A;  3E9S A;  1F4I A;  1HT1 E;  3SAR A;  3KOZ E;  1TH4 A;  2DZN B;  2K0B X;  3GPY A;  3NBI A;  2LVP C;  1EFU B;  1T43 A;  2MR9 A;  2G5G X;  4IIW A;  4JI2 M;  2F5S A;  4IJE A;  4DV5 M;  1PJS A;  4HL4 A;  1A5T A;  2KNZ A;  4MM3 B;  3RE8 A;  3KVW A;  3MHV C;  5EP3 A;  1DV0 A;  3KW6 A;  4KT0 F;  1GJT A;  3U60 A;  3WHK A;  3SHF A;  3T38 A;  5KQ8 A;  3KS8 A;  3GRR A;  1L8Q A;  3J7B A;  1R4G A;  2L6O A;  4LCB A;  1WJ7 A;  3AV0 A;  4Z8X A;  1IN4 A;  3W0F A;  2UUB M;  2H5X A;  4DV3 M;  3W67 A;  5KPR A;  2UXB M;  1L2D A;  4K0K M;  1QUS A;  2X4A A;  2AHM A;  4NL4 H;  3SMP A;  3NBX X;  3PFI A;  2L2D A;  3HGI A;  4LJ5 A;  4DR4 M;  4X66 M;  2G3Q A;  3PXG A;  2OQ4 A;  1PJQ A;  2QQ8 A;  3H4J A;  3IEC A;  2Z3X A;  4DV1 M;  3CF0 A;  4LY6 A;  1IXZ A;  2CHQ A;  2KDL A;  4B3S M;  1V34 A;  1OTR A;  3HHY A;  1PGY A;  4FVM A;  1EIJ A;  2QHO B;  3EIE A;  3UZU A;  2BWB A;  5DYI A;  3HKP A;  3T1Y M;  4AG6 A;  3T1H M;  4D80 A;  1N33 M;  3LVV A;  4LGM A;  5LMU M;  3TQS A;  3CGW A;  3KS4 A;  1K3W A;  3KSX A;  2V6Z M;  4IBF A;  3VDP A;  3JR4 A;  2C96 A;  3LMM A;  1ZQ9 A;  2CHG A;  2C98 A;  1VQ1 A;  3HHW A;  4LRS A;  1GKI A;  2CEA A;  2X49 A;  4LFA M;  5DNY A;  2ZM6 M;  3EIH A;  1ZAE A;  2MJ5 B;  2KRU A;  2L09 A;  3HWS A;  4GH9 A;  4L15 A;  3U6E A;  1XC8 A;  4TUW A;  2C99 A;  3J80 S;  5ITX A;  4RF1 A;  4RKU F;  2V1C A;  4QOS A;  1OFH A;  2VDB B;  3GQ5 A;  3B7Q A;  3K92 A;  5EXP A;  1SG9 A;  3AOG A;  4RF0 A;  5IT9 S;  3MMP A;  3U6C A;  4REZ A;  2DAE A;  4IBB A;  2Y21 A;  3C58 A;  4FWD A;  2DAG A;  2UXC M;  2CFO A;  1TR8 A;  3KFU G;  4GEW A;  5KPZ A;  3U6M A;  4JI0 M;  2WSC F;  2JZ0 A;  3U6D A;  1D0L A;  4DV0 M;  4P16 A;  2Z8Y M;  1V33 A;  3B9P A;  4LJ7 A;  3UMM A;  3MJ5 A;  3B7Z A;  2V1U A;  1G3I A;  2R45 A;  3LQR A;  1IY1 A;  1C7Y A;  1OIP A;  4GMQ A;  1YE9 A;  4L4U A;  3FTE A;  2QEN A;  1X37 A;  4LF7 M;  3FTF A;  4L6V 6;  3TPZ A;  1VDD A;  1IY2 A;  1GL6 A;  1ZMU A;  3L25 A;  1PRB A;  3GLF B;  3GLF E;  3AJI B;  1QAN A;  2A5Y B;  3HU1 A;  2R46 A;  3HU2 A;  1QZM A;  4LJ8 A;  2KW0 A;  3PNY A;  4AKG A;  3FTC A;  3KDS E;  1OQY A;  3KSJ A;  3E4R A;  2Y0Q A;  4GC9 A;  3UGJ A;  1UFZ A;  2C9O A;  5EP2 A;  1XNR M;  1SXJ A;  4GIP A;  1D0K A;  4DV4 M;  2QSF X;  4NRV A;  4AQY M;  2LVQ D;  1OKS A;  1CUK A;  2CP8 A;  1GL7 A;  2CV1 A;  1WXQ A;  4DR6 M;  4IBJ A;  1XXH E;  3MK6 A;  3C3E A;  4DR7 M;  4IBE A;  8CAT A;  4LJ9 A;  1L1Z A;  2APL A;  1MN3 A;  1E9R A;  2WSF F;  4G3O A;  3U61 B;  1OJL A;  2UUA M;  2XF3 A;  2RRU A;  3RGP A;  1WGL A;  2R4E A;  2K47 A;  4FCW A;  1TDZ A;  3RGS A;  2C5R A;  2WSE F;  1NY6 A;  1S3S A;  5LMN M;  1OFI A;  4NC6 A;  3KP1 E;  4LJ4 A;  3TE6 A;  5ITQ A;  3E21 A;  2DAI A;  3VFD A;  3GLG E;  2LXE A;  2GNO A;  3FYC A;  3JAM S;  1IN8 A;  3VKG A;  1C1K A;  3AOE C;  1QZE A;  3FE3 A;  3GLI A;  1HQC A;  4DUY M;  4II7 A;  3U60 B;  4KOD A;  1JR3 E;  2KZS A;  2R44 A;  3CF2 A;  5FTM A;  1E94 E;  4L78 A;  5EXT A;  3FUU A;  2JZ1 A;  3LQQ A;  1ZMW A;  3GRV A;  1TGU A;  1AUA A;  4WP2 A;  1L2C A;  4Q7J A;  4MH0 E;  3IHP A;  2VQF M;  2LVA A;  3QYB A;  4AKH A;  4GHL A;  3QWL A;  2LH0 A;  4MB7 A;  2HWJ A;  1VEJ A;  1VG5 A;  3FUW A;  4IBD A;  4LF5 M;  1NV8 A;  1KFV A;  1R7R A;  4M0W A;  3D8B A;  5FLX S;  1TH3 A;  2HHH M;  4QNM A;  3JR5 A;  4NXN M;  2XFS A;  3TWL A;  2MRO B;  1Z5C A;  2XEP A;  1E9S A;  3ZH9 B;  3GRY A;  5E26 A;  1QQW A;  3GPX A;  1AIP C;  1HNW M;  3I04 M; 
#chains in the Genus database with same CATH homology
 2MJ5 B;  1ZMV A;  1IXS A;  3GLH E;  1VDL A;  2O25 A;  1WGN A;  2OOB A;  2JUJ A;  1VEG A;  1OAI A;  2DAM A;  1AIP C;  2ZTC A;  1Q02 A;  2B3T A;  2KNA A;  1SG9 A;  2JY6 B;  5DFL A;  3MMP A;  3GLI E;  1DO2 A;  1HJP A;  2JP7 A;  2DAE A;  1P3Q Q;  1V92 A;  2DAK A;  1G4A E;  2DAG A;  1TR8 A;  4GEW A;  1GO5 A;  3K9O A;  1TTE A;  2JZ0 A;  2EKF A;  2DI0 A;  4UN2 B;  2KHH A;  2DKL A;  1G3I A;  3FRI A;  3FRH A;  2ZTD A;  1Y8G A;  2JNH A;  1C7Y A;  2BWE A;  1WHC A;  2L4E A;  3E46 A;  1HQY E;  1G41 A;  2LVN C;  1YLA A;  2DEN A;  2JY7 A;  1ZMU A;  2DZL A;  2LVO C;  1IM2 A;  1XB2 B;  3GLF E;  1VEK A;  2DNA A;  2KNV A;  1ZV1 A;  2K9D A;  1OQY A;  1UFZ A;  1HT1 E;  1F4I A;  2L4F A;  2OO9 A;  2QSF X;  1WR1 B;  2LVQ D;  1OKS A;  1CUK A;  5JI2 E;  2CP8 A;  2K0B X;  1T6O A;  2LVP C;  1EFU B;  1T43 A;  2MR9 A;  2EKK A;  3BBZ A;  1XXH E;  1BVS A;  1WIV A;  2WZJ A;  1NV9 A;  1A5T A;  1MN3 A;  2JY8 A;  2KNZ A;  4G3O A;  1IFY A;  2RRU A;  2MGW A;  1DV0 A;  3F92 A;  1WGL A;  1R4G A;  2QNJ A;  1KYI A;  3LCV B;  1WJ7 A;  3E21 A;  2DAI A;  2H5X A;  3GLG E;  4F1I A;  1QZE A;  3FE3 A;  4R71 A;  3B89 A;  2L2D A;  3LCU A;  1JR3 E;  2EJS A;  2G3Q A;  1E94 E;  4HEO A;  3H4J A;  3IEC A;  2HAK A;  2JZ1 A;  2LBC A;  1ZMW A;  3T6P A;  4WP2 A;  4Q7J A;  1OTR A;  2DHY A;  1PGY A;  3IHP A;  2QHO B;  2LVA A;  2BWB A;  1HT2 E;  4DBG B;  4F2L A;  2HWJ A;  1VEJ A;  1VG5 A;  1DO0 A;  1NV8 A;  2JY5 A;  2R0I A;  2LTU A;  2OOA A;  1VQ1 A;  2MRO B;  3K9P A;  2CWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...