1VDMA

Crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
153
structure length
151
Chain Sequence
MDKVYLTWWQVDRAIFALAEKLREYKPDVIIGVARGGLIPAVRLSHILGDIPLKVIDVKFYKGERGEKPVITIPIHGDLKDKRVVIVDDVSDTGKTLEVVIEEVKKLGAKEIKIACLAMKPWTSVVPDYYVFRTEKWIVFPWEEFPVIEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of purine phosphoribosyltransferase from Pyrococcus horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords purine phosphoribosyltransferase
total genus 40
structure length 151
sequence length 153
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.4.2.-:
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vdmA00
1I13A 1UPFA 3MJDA 5IPFA 1VCHA 3OZFA 4RADA 3NAGA 3OZGA 4OHCA 1LH0A 2EHJA 2H07A 1ECBA 4PFQA 5BSKA 2XBUA 4RAQA 1OROA 1Z7GA 2P1ZA 4RACA 4RANA 2YZKA 4P81A 1O57A 3MBIA 4JITA 4M0KA 4RHYA 1R3UA 1FSGA 3DMPA 1A97A 4Z1OA 1OPRA 1ECFA 1P19A 5BQOA 1VDMA 1XZNA 1P18A 1L1RA 3O7MA 1ZN7A 4TWBA 1G9TA 2FXVA 3EFHA 1YFZA 3GEPA 5JV5A 1IBSA 3DAHA 4PAWA 1XTVA 1AO0A 1DKUA 1QK4A 3ACCA 5ESXA 1QCCA 4P86A 4RHXA 2DY0A 4LZNA 5KAPA 1QK5A 5KAMA 1QK3A 5EUCA 1W30A 1BZYA 1G2PA 3HVUA 4M0PA 4QYIB 3M3HA 4RHUA 4P84A 1OREA 1ZN9A 3LRTA 1QCDA 4LZOA 1P17A 4LYGA 2HCRA 5BQPA 4S2UA 4RHTA 1I0LA 1GPH1 4P82A 1STOA 3DEZA 4QRIA 1L1QA 4IJQA 1DQPA 2H08A 2IGBA 1HGXA 1A4XA 5JSQA 1QB7A 3KB8A 1DBRA 1A3CA 4LYYA 4P3KA 1DKRA 1TC2A 4X45A 5IAOA 1BD4A 5ESWA 1I14A 1D6NA 1PZMA 4P80A 1A96A 1I5EA 1JLRA 3GGJA 1NULA 4RAOA 1QB8A 5E38A 4WMLA 5K51A 1XZ8A 3H83A 1U9YA 4LZAA 4FYMA 2H06A 3QW4B 1TC1A 1V9SA 3LPNA 1ECJA 2PRZA 1Y0BA 2VFAA 1J7JA 1XTTA 1UFRA 2E55A 3ACDA 5HIAA 1A98A 1CJBA 2JBHA 2PS1A 4X44A 4RV4A 3GGCA 2GEBA 2PRYA 1GRVA 1DQNA 3G6WA 2AEEA 4JLSA 4RQAA 1P4AA 2JKYA 4RABA 2WNSA 3ACBA 4M0UA 4QYIA 4RQBA 5BRNA 3S5JA 2JKZA 4KN6A 2JI4A 1G9SA 5HKLA 1XTUA 1G2QA 1BD3A 1WD5A 3N2LA 4P83A 1U9ZA 1A95A 1ECGA 1I0IA 3OHPA 4WN3A 4F8EA 4ZFNA 1HMPA 1NONA 1MZVA 1UPUA 4MB6A 1JLSA 1ZN8A 1ECCA 1O5OA 1VSTA 2C4KA
chains in the Genus database with same CATH superfamily
2XUHA 2J9ZB 1UPFA 1GU0A 2XAAA 3ZWQA 1UM9A 4M0FA 1W9HA 3OA0A 3L1VA 5IARA 7MHTA 3MLEA 5U4XA 1OFIA 4H7FA 1TKCA 4RKFA 1KZ4A 5FFMA 3GLFB 1JQJC 5AM4A 3AZQA 4R2IA 5L45A 2YASA 3W1EA 1QRAA 4HAYA 3HCDA 4CF3A 1NRIA 3HVKA 1RADA 1H6DA 5K3EA 1XQ6A 2NUTB 3G59A 2G9VA 5LMCA 2XDQA 2DQSA 2DLNA 4YRMA 4MWBA 3VVCA 4HFJA 2Z6VA 2PZJA 1EFHA 1T6ZA 4ZAYA 5JDCC 3HADA 1NAHA 4P35A 1Y9AA 2Z43A 1F8UA 2OCKA 3JQ6A 2OT3B 1CZLA 3KZXA 3Q3JB 2FUCA 4BZPA 4ZYUA 4QTZA 1QYWA 3PD1A 4C0WA 1EUCB 4IH4A 1ZR4A 5B1SA 1E2QA 5FWXB 1TLFA 3WBJA 2Q5FA 2PJDA 3KKZA 1M75A 2B9EA 5JUWA 4RGVA 1O97D 2RHTA 4O2BA 2JLVA 1L5VA 5JAMA 3T5DA 5ALJA 3OWXA 5LMNB 3U0BA 5K0ZA 1Q0UA 1M76A 1YS1X 1WPGA 3ZIAA 6CHYA 1G19A 4MLCA 5AW6A 1KH1A 1UOQA 3C97A 9GPBA 5K3OA 3RUHA 4AX8A 4Q16A 5JPIA 4GDFA 2C8LA 5JRJA 1Z5OA 4DV0B 3TLXA 3MJTA 1W5FA 3M9XA 2UUAB 3RF6A 2GILA 2MYTA 1RBZA 2B5WA 3ADPA 3LT2A 1OT3A 3OECA 3PXDA 2QAJA 4YGXB 4GSYA 5TLSA 1T29A 1UDAA 2NSDA 2PU5A 3PQ6A 1Y6GA 2GJKA 5A6SA 1QRSA 1SMKA 4LWPA 5KDLA 1QU2A 1UP7A 2XRFA 2AF4C 5EJ4A 6ADHA 2H5EA 4KJXA 3HJBA 3A06A 1R16A 4D45A 1QO9A 4TWIA 2MTBA 1JIQA 4IP0A 5CEJA 2XMSA 4GKBA 3SJCA 3RU2A 4R2LA 3BMNA 4L3WA 4CXMA 2JLUA 1A96A 1R5NA 1Y3AA 1I5EA 2H1IA 3AEQB 4OA8A 1XMIA 3PCTA 4D3SA 4ZHSA 1QZXA 2IQ5A 2DPHA 2OLJA 1IJKA 3O31A 5AVKA 1DUIA 3LYHA 1ECJA 1ZVJA 4DCGA 1OMOA 4X1IB 2CBZA 3KVNA 4PVCA 4G26A 4QTTB 5SYNA 2QORA 1DKOA 1Y1SA 4TMFA 2CHQA 1W52X 2QLTA 1HQDA 2QMYA 4JL6A 1DXQA 2GCOA 1KRXA 4RS4A 2PZAA 5DHUA 3F73A 1UT6A 1A5SB 4X9XA 4BKOA 5HW0A 1D2NA 2OG2A 2ODQA 5ARCA 1K7CA 4FS8A 4DDMA 3UXMA 5C5DA 1ZL2A 2FKNA 5GZ1A 4GPBA 4CM6A 4LF5B 3DE3X 2C4MA 1NXSA 2NZVG 1NN1A 3A25A 4UHJA 3CCCA 4KFSA 4GGOA 5JHHB 1I4OA 4NBWA 5JSZB 4XQ0A 1SWVA 1G21A 4PGMA 2A9VA 3GD7A 1PHRA 3BMNB 5LWHA 4YT4A 5FAKA 2VYQA 4BNIA 2NVBA 1OHHD 1TNDA 4W1SA 1J24A 2LR0A 2IRWA 2P9QA 5CLQA 1E4OA 1TT5A 5B36A 1B73A 1OXXK 4E5DA 5P8WA 4ND5A 4E21A 4FR2A 4EJ0A 2HJRA 4EHLA 1PJLA 2WJ6A 3DVAB 3GJ3A 4KV7A 1NATA 1ZUD1 1RBQA 2FAXA 1D6MA 1IMOA 1X1DA 2PVCA 2QRKA 3QELB 3BHMA 4AWAA 4Y6OA 1W47A 4OQNA 4DR4B 1XQXA 5CA1F 1QX4A 1EWQA 1T2UA 5DIZA 2R2AA 3F5SA 2XCSB 1KJWA 1DMRA 1S1MA 1WDWB 1WW3A 1OC4A 1O95D 3AWDA 2QS9A 4D9JA 1VPVA 2EGGA 1TQHA 1YTLA 2G63A 3O82A 3OP4A 4PU0A 3W5BA 2PAFA 5ARBA 2KI5A 4F0JA 3CLSC 2AQ8A 4MS1A 3A0RB 4TV9F 2RE8A 1B23P 1XZNA 3FSJX 4DRYA 3FTDA 1N2HA 4H15A 3P9QA 3ZZTA 1XNRB 1QE3A 1N4AA 4FJ0A 1NSYA 3PRKE 2POCA 4KLAA 1PWEA 4PIVA 4OA5A 1SCUB 4PLTA 1R2QA 1AXGA 1L4MA 1OLSB 4F21A 4YQYA 5TV2A 1FNBA 4M46A 2G0NA 4QDZA 4S12A 1Y1QA 1T13A 4RPKA 3GT0A 2ERYA 3HP4A 3COPA 3QXSA 5AIAA 5DYWA 2R6DA 4AICA 4B75A 4DDWA 4ZIRA 2VUHB 5AUOB 2PX3A 5KKNB 4LQCA 2PO7A 2QW1A 2PLRA 2WU4A 3G9UA 4PX5A 3V4SA 1DB3A 3T61A 3SJ7A 1V95A 4J0HA 1YE5A 3BULA 3EHEA 3UICA 2EX1A 1CW2B 3SQNA 5A4IS 3A3KA 3BWDD 3WGQA 3FHTA 2AX4A 5IANA 1CRLA 1O1YA 1OSNA 4OHRA 4CI9A 2GPNA 2NQ2C 1DQPA 2AYZA 2ETVA 3O2JA 1B7GO 1SULA 1OQAA 4G25A 2IF2A 3AVQA 4OFZA 3DZHA 4IGKA 5JSKA 1NVGA 4C3UA 3EXHA 1JEYB 2R96A 1EX7A 2CMHA 1IHOA 3TRIA 1LRKA 2BOVA 3D6NB 1GPNA 3LDGA 4IHJB 3E0XA 2HHHB 1CY6A 1SC6A 2I7CA 3HUFA 4JP2A 4MYTA 1KEUA 2W4MA 5BWOA 4L9RA 2IX3A 4LJ4A 5IX8A 2H9IA 4QUIA 4CKBB 3AEYA 1KHTA 2W6QA 4K9NA 1TAHA 2DRIA 2PQMA 1F2TB 3KEQA 4X1KA 3ZK7A 2G9RA 3WLNA 1FFXA 3L0CA 4LZWA 4A6DA 5FPPA 5JMOA 2SKDA 2ZBUA 1IY9A 4V3CA 1BXGB 1ZDMA 1JG4A 1DWOA 3T0GA 2QYOA 1USIA 3G6WA 3NJ8A 1E6KA 1WLSA 2A1UB 3BRSA 5AI9A 4UTNA 3RFTA 3T3DA 2WF9A 3K5PA 1UK8A 3K9FC 5CLJA 3NIGB 2A7XA 5ALLA 2WTBA 1KYWA 1Z38A 4OTZA 3ETEA 2AK2A 4P7BA 3WYBA 3X1DA 1G0OA 1WDLA 4LSGA 1EM8A 3C4JA 2HSWA 2V74B 3K4QA 1L5LA 4YV2A 3TNDA 3NEYA 1IBLB 1HKUA 5KTSA 2OORA 1WMBA 1FMFA 1KAOA 3EJWA 4GYYA 4KO4S 4YRBA 1KO5A 1RI2A 5JXGA 1AUVA 5ALQA 4AMZA 3IAAA 1WMEA 4WPGA 2QN6A 1Y7PA 3AEKA 1XFAA 2XF2A 3JPYA 1XJ0A 1QJ4A 3I34X 4JIGA 3CRQA 1W35A 4NULA 3SC2B 5E95A 2PD4A 2H2HA 1ARZA 5IS2A 4P5PA 4TTTS 1VSTA 1IEVA 3HRIA 4YP7A 1E6LA 3CF4A 5IPFA 2OO3A 2ZWVA 4IDQA 1NJ2A 2QNBA 2C57A 4GPAA 2RGGA 4ZD6A 3KKQA 5F2OA 3FDJA 3SFVA 1SG6A 5NULA 4OH1A 5BWCA 4DUGA 3E5HA 3I12A 4XXHA 3GEEA 5SY6A 4QFCA 4U2FA 1CY0A 1G3QA 2F62A 2OZLA 2QRQA 1AZTA 1N2ZA 1YJ5A 3CZ5A 1K5DA 3BG5A 3Q88A 4UD6A 1V48A 2OOSA 1OLOA 1Z34A 2BMVA 1FMTA 4O6VA 2IEDA 4CEJA 2IYRA 5JQWA 5A03A 1UJ4A 1T43A 2QD5A 3IBFA 3U26A 4A27A 2C94A 3K0SA 3UG7A 2KBFA 1KE1A 1AA9A 4ZJUA 2XCUA 3L40A 1UDBA 2YWBA 3PEUA 5B6IA 1VLLA 3KTAB 3OQBA 5EAIA 4DUYB 1ZMXA 1MIHA 3OKPA 5CTJA 2JFQA 4DLSA 5KNDA 3VDQA 1XN4A 3R0IA 2YV5A 4ARVA 2C95A 3B3GA 2M1ZA 5F33A 4KUGA 1N3BA 4KR2A 1V43A 2Y67A 1EAMA 5JFGA 3WIEA 1L5GB 2C2HA 8OHMA 1KYQA 2PZKA 1RDFA 4FLEA 4JUAA 5CW1A 4FR5A 4KQEA 4OFBA 2VJAA 3KR1A 5G0VA 1N34B 1P17A 3B1WA 1IXRC 3HR7A 4EOGA 1LU9A 3NBKA 3VZPA 4X1YA 5L7WA 4MR7B 3ZLVA 1XQYA 3AIIA 5BNZA 2H52A 2WD8A 3L8MA 4FJ1A 5EE3A 1K7XB 1X80A 4ENTA 1PS0A 4F5ZA 2HF9A 2C58A 2HJ9A 2I3ZA 1DT3A 3GJTA 3PFIA 3WHKA 3CF2A 4BP1A 1IAQA 5SYAA 4QXRA 3DNPA 1KVUA 2EJVA 2O7RA 4MWTA 1G5IA 2N1MA 2QX9A 1L5SA 1T0BA 1XNGA 3R3UA 4B4KA 2HREA 2KSQA 4K2HA 1OI7A 3G2IA 5BV2P 3CT4A 3TX2A 5SV2A 5KWIA 2FZVA 1O87A 3LCVB 1DELA 4TWZA 1TVKA 3WS7A 3K0KA 4EF6A 3BRWA 3AVTA 3NTXA 1U3FA 4YJFB 3L04A 3SSMA 1U2TA 4Z54A 2QBYB 1X13A 3RGGA 3DONA 3FFWA 2R9VA 1D3AA 3IXMA 4OI4A 4NMMA 2XB9A 4RFLA 1S3SA 2CVFA 1E32A 1VIYA 3GJ8A 3WGOA 4MQBA 3O8RA 1YCGA 2HC9A 3MWDB 1IJEA 2PMEA 4QOIA 4CUKA 2VNAA 3OIVA 4FT4A 1XTPA 3RJ5A 3HDJA 1PT7A 3ENQA 4HN2A 5I8ZA 2HJHA 1FMLA 3I23A 2UV8A 4C08A 4FYJA 2D1FA 3F1LA 4OMDA 1YKGA 5FTMA 3TUJC 2V9ZA 1Z0DA 4FFNA 4M21A 3QU5A 3BTOA 4GBGA 1ONBA 3D7RA 1IRXA 4JJIA 2IBMA 1SU6A 1I7DA 4CQMB 4WN3A 1S9HA 4QU8A 5A5GA 5KZMB 4LOLA 1ZGGA 1XNJA 2IWRA 2XUJA 1PLLA 4FZJA 3ZE0B 2XWBF 3O1LA 3QXCA 5AI4A 3O8NA 3OIYA 3GPDG 1DG1G 4G5XA 3SJAA 4Y6GB 5IF9A 2PMWB 1AKYA 4DUGD 4WKBA 4EKIA 4EYQA 3SWWA 1OW3B 1RQ7A 1UDWA 2CNBA 1CUBA 2F3PA 2ZYVX 4RCYA 4Y2HA 4DXAA 2IZ0A 3NDPA 5LA6F 2C92A 4R2XA 1DV2A 1CUFA 4TXLA 2HADA 1PR2A 3C6MA 2D1SA 1RTTA 1DQZA 1MV5A 2OP0A 1O89A 1R66A 2QF7A 3ANMA 4IHJF 3IVCA 4L8VA 4QATA 3S1LA 3EVBA 3LBFA 4YUXA 2ZOSA 1ZU5A 5B6PA 2X8JA 1XA0A 3D2BA 3F7NA 3BMXA 4O4LB 2VJCA 1FQKA 3EQ2A 4ND4A 3RARA 1XTIA 3ZXUB 5JJBA 3JYHA 1P77A 2GYWA 4XQGA 2VR1A 1J0XO 2GN4A 4D0SA 1GZUA 2JJ1D 2P0AA 3VC2A 1DKUA 1C3OA 3U2QA 1WM1A 3VR5H 3FFBA 3K0FB 2VS1A 3WMGA 4QUGA 2AFVA 2VHZA 2WF8A 3N7TA 1GL6A 4PZUA 3VR2A 4DV1B 2J9RA 5K0TA 4KWCA 3HO8A 3FF4A 1E89A 4GF5A 4QEKA 2SBTA 3DBLB 4QJIA 3RCBA 4MQMA 4FB5A 3IT0A 1BEZA 1WG8A 4B3DA 1QGAA 2X0JA 3UBMA 4WNCA 1WZ2A 2BONA 3RSZA 3MTQA 1C0KA 1RWOA 4BVGA 4JEMA 3VHXA 2A1UA 2PSDA 2UZ3A 4BV8A 3V2HA 2QIPA 2VK1A 2DFLA 3GA5A 3MB5A 3EXIB 3DEZA 1XEXA 1KK3A 3OICA 3PDIA 4KQIA 5AI6A 3T38A 3ZWBA 5PGMA 4GMFA 4QARA 3GRAA 1LJLA 3BWXA 3H13A 3A6HA 2RGUA 3P9XA 2RGRA 3VOBA 1P2SA 3BF7A 2YYZA 3ITEA 5BSWA 1CS4C 1VMAA 3B9PA 3AEQA 1QHHA 1JA0A 3DQZA 4KDCA 4NS1A 5J63A 4D9GA 2OMEA 2VYND 3NBUA 2WJIA 3RABA 4FW8A 1U98A 3ESRA 1RLJA 3HJAA 1QNFA 4OUKX 1CVIA 2D1YA 4J1NA 4JBIA 4XGRA 5DO9A 3WRWA 5AW7A 2XCTB 2CV2A 4H1VA 5EUMA 2C4TA 3DZDA 3EPKA 1DEKA 1PP4A 1ESMA 1CS0B 1KAHA 2WDZA 3KUDA 4WZ6A 1VXRA 2C78A 3C45A 5AKYA 2YRXA 5E6RA 4RTNA 4BYGA 1B0ZA 2DSTA 4UCQA 1DDOA 1TIPA 4MH0R 4QUEA 1UPBA 5IM4A 3R8FA 4RJLA 1XKQA 2JAQA 3NHLA 1D9XA 3H0CA 5BSUA 2IH4A 2ZSKA 2WU3A 1GSOA 2IYSA 3HBFA 4FKZA 1H1LA 2Y27A 4Y9DA 1CHDA 2LIPA 4C22A 5BRJA 4DDKA 3CQ9A 3WKCA 4OGLA 4HLUC 4B3HA 1VPEA 1Q7TA 2P4SA 1DHTA 1H93A 4QU5A 1NVTA 1XCPA 4L4SA 2AR0A 1ZICA 1ITZA 2RH5A 3DZ8A 3L1HA 3S3TA 5IJ0B 3HJFA 2N3ZA 4MDFA 5AKZA 1ETHA 2Q4EA 3HY4A 4FT2A 4HYTA 5E6SB 1JHAA 1SUDA 4U1RA 4HN4B 3UOWA 5ALKA 5TE9A 4LC1A 1ZH4A 5HA5A 3VDMA 2UZ4A 1NM5C 4ARCA 1Z4MA 4YTEA 5FPHA 2XMQA 2LVBA 3PK0A 4YMIA 1HMPA 3ZV3A 5HIMA 1KZ9A 3ZUGA 2AOVA 3L7OA 2XCLA 2GBGA 1JH8A 3T7TA 5ELXA 1GAQA 1PJBA 4JI0B 3JXEA 2I1VB 2O20A 2D00A 1LPPA 3I9MA 4RY2A 4WIAA 2AMYA 4HH4A 4PYNA 1DQSA 1UQRA 2OXCA 4QULA 4YC7A 4PAOA 2E49A 4GGPA 1LK7A 1CUGA 1SXHA 2WU1A 3PKJA 2V6FA 4KTTE 1UC4B 4KXLA 1I33A 1FRNA 1NSFA 1Z2NX 2J3MA 4CKXA 1ECLA 3UMMA 3I37X 1B8OA 4XVRA 3JSAA 4FGJA 3CW9A 4MCIA 5M3BA 4LRTB 3GVHA 2AVNA 3I92A 1GL9B 2QRVB 2D7CA 3AV3A 3EISA 3LPMA 3P45A 4JSYA 4E6EA 6GPBA 3RVPA 3C98A 4BB0A 1YAJA 1RAEA 2XQJA 1P9RA 1SOWA 2NVUB 3OCXA 1USKA 2AXEA 4ER5A 3T9AA 2FMHA 1Q77A 3SIRA 2WJYA 3QKWA 2VZ0A 1ZN7A 3EASA 5BR7A 2P75A 3QVGA 4GVLA 1M72A 4NRDA 1NDUA 2G40A 1L5ZA 3P2IA 1VC2A 1N2SA 1UMBB 3AR6A 4IEIA 2QSUA 5JPDA 1Z5NA 3ABZA 1RE0A 3P9SA 4RDIA 3PFNA 1H8HA 3HGTA 3FVRA 4U4AA 1QZ3A 3TBKA 2VNHA 3ZIAD 4YJFA 1C4OA 3RFUA 2ZRKA 1MEEA 3NHRA 2FY8A 4HQ0A 3ESBA 3RFVA 2A3NA 1URPA 3BEDA 1D1TA 3PT5A 4WADA 3VYUB 3HJCA 4MVJF 4QGHA 4AF8A 2A5JA 3LRTA 2Q4BA 3HXLA 4PLHA 5IH7A 4X62B 5ABPA 2IU6A 2J45A 3DD1A 1GKIA 5DBFA 5BMVB 5AKJA 1JI3A 4RGQA 4YUVA 3RS5A 3VDRA 4TZ0A 2Z3VA 3DV0B 1R15A 1CF9A 4TL8A 4GM0A 3AJAA 1A69A 3L7LA 2BMAA 3FGPA 4EBBA 4IJQA 4YUZA 1N3LA 2H29A 1QPZA 1H9AA 4YXFA 1JIKA 3NWBA 1S8OA 3IESA 2K5UA 4BLRA 1F2VA 1P31A 1ZK4A 2OC9A 4N01A 4K0RA 5KTMA 1BH6A 1HDRA 5KBYA 5LP6A 4Z99A 3WNZA 1KI2A 3GA0A 4WNYA 4K6CA 5KQPA 1BVRA 2DKNA 2LRHA 5A71A 5K05A 3ENKA 1GYPA 1T1GA 4KXXA 1EH5A 3A1VA 4AO7A 1E6UA 5DNEA 2VWHA 1V25A 1YS7A 3ZXSA 1LZKA 1FUUA 3ZI7A 2ZJ8A 3HO1A 3I64A 3KQLA 1K89A 2R85A 3I09A 4FGSA 4LOAA 4PHFA 5T5QA 1QYXA 1WP4A 1NJ1A 1T0IA 3ESZA 2A57A 2J3EA 1P61B 3UJ3X 3A36A 1Z47A 3DVQX 3SYKA 5AW5A 1VB3A 5IZCA 5ED4A 1Z16A 1J5PA 2Q9BA 3SX4A 5A9SA 4A2CA 3OQVA 1Y42X 4N49A 2PBRA 3UGJA 2AYXA 3C1AA 2H7CA 2P5UA 3BK1A 2I2WA 1PZGA 3UMFA 4QHYA 2PTGA 4F2PA 5CURA 4UXIA 2FZ4A 5A6SB 1ZONA 2XNHA 5CXUA 3ICEA 1MLDA 1W2GA 5EP4A 1HLPA 2AFIE 3ZZUA 4AZ0B 1V5FA 1NF3A 3K2BA 1O0CA 4MUBA 4DQKA 3PNLA 2UVPA 3LWDA 2ZEJA 2MWMA 1XE3A 3VVLA 3QMPA 4JBGA 4CCYA 1JFSA 2VN8A 5C0OE 3W9YA 2VT3A 2FXIA 3VU9B 2BDUA 4RETA 2I66A 1W5AA 1H4QA 1ZCFA 2HMTA 4DMKA 2HH9A 2I7TA 3Q10A 2REXB 3O8LA 4MYUA 1NSTA 3QFFA 4MI1A 4NLLA 4POAA 4WN9B 3RO7A 3S7ZA 5ADVA 3LBIA 1XN1A 1UJBA 2NYUA 3R5HA 1XLVA 4XR9A 4C89A 2CVHA 4FFDA 4QQFA 1NNI1 2VTKA 4QIHA 5GV7A 4EEZA 4B48A 2JVKA 3DBLA 2V4ZA 2NNLD 3MN1A 1EP3B 3B7GA 3LO5A 5LQNA 2B4RO 2JAWA 2Q3DA 3K15A 3OEEA 2R1TA 4DSZA 5L7TA 2G82A 3JARB 4CVNA 2O3UA 3P52A 2J08A 4ONEA 4QOSA 3BB4A 2VP6A 4WEOA 5D7BA 3AHEA 5EIBC 4R0VA 1H2RS 4NJMA 1CJTC 1K4YA 3RUAA 4B7XA 3GPIA 1UZLA 3OZDA 4TS9A 5TS2A 3DMTA 3PR2B 2PX8A 3BT7A 2F7SA 3E9EA 1U6KA 1DAPA 3H1PA 3OEHA 4M54A 4Y1GA 1CYEA 1UXHA 4F7WA 3IP8A 4M88A 3EIHA 3C7KA 2FG7C 1XZKA 2A0UA 2HL6A 1YSCA 4ENQA 5TARA 5ESXA 1ID8A 3PFKA 4HH3C 3DTVB 4L51A 1MB9A 2WWHA 4TVBA 5BSFA 4M0EA 5E7QA 5LD2C 2AWOA 4D8YA 3F96A 4J4TA 4GHWA 3ZYZA 5KINB 4DR2B 4F4UA 2ZU6A 2ZB2A 3VJRA 4IV0A 1HT2E 4FFOA 3LXXA 4JCOA 4J4HA 5E0OA 1ISPA 2WM8A 4FK8A 3GFFA 4I4TB 4TOIA 1NVAA 4MMXB 3H4VA 1BQ3A 3FJ1A 4YMGA 5I7AA 5CLLA 4WI1A 3F6RA 3SHVA 5SY4A 5HUJA 1JZQA 3HWX1 1UZAA 4MP8A 4UW9A 3VVBA 3QMVA 1CG6A 1F7UA 2WZDA 1TYEB 2VAWA 3LT4A 3U49A 3EFOA 3TOZA 2ON6A 1I9GA 3ELBA 3GHYA 2BH2A 4UAJA 3A31A 3AHGA 3L0IB 3TNFA 3M5DA 4Z7OB 3HYNA 3DTVA 1V1MB 5E0KB 1JJVA 4M37A 4TLAA 4YMTA 1HBJA 3EVDA 4ID3A 3LUJA 5LJIA 3QMMA 1N92A 4MV3A 4I6GA 2E6UX 3IL2A 1GFIA 4ZIRB 1GG2A 4TKVB 4L4UA 4P31A 2E55A 4YRCA 3T5AA 1FDRA 1IZYA 3NNDA 5JAQA 4B2IA 2VJNA 1JVBA 1FMCA 2BFEA 3F9CA 2X9NA 4QVKA 4H6XA 5TGDA 3HA3A 2QPLA 4YR9A 2XEDA 2CNLA 1RC8A 2Z6QA 1EQUA 4WFKA 4ETIA 4DG8A 2XE7A 1PKEA 1TYAE 2B21A 3IQHX 2VNJA 2CV1A 1T36A 4HN9A 4N5LA 1ZCZA 3L0DA 1P1JA 4MV9A 1ZAYA 2SCUA 5BWMA 1SCAA 1N9KA 1QDUA 2BC9A 1HDZA 3G5AA 2A94A 4HNTA 3MJHA 1YQTA 1SBTA 4GO1A 1VE9A 1R8SA 1OIWA 3FHLA 3CKMA 5FBZA 2VJLA 1CKEA 3NNNA 6ABPA 3HMQA 2XVMA 1FDOA 1U0HC 1EM6A 2FEWB 2W58A 1VL5A 1IFXA 2PDAA 2BEWA 4O3MA 2W6OA 3A1DA 4TMXA 1I2BA 1ODLA 1UT5A 3BK7A 4E09A 2NTJA 5BVGA 4MB6A 3IOYA 3M6VA 4TYYA 3SZMA 4HQLA 2LKDA 3ZLJA 2CWDA 2RAVA 1JLKA 3C4VA 4UDXX 2C2KA 1BOFA 1VZ3A 5BSEA 4MR8A 2HIAA 4NBSA 3QF4B 1OU0A 2PQ2A 3LG2A 4Q4AA 2IDJA 1TU4A 2YFYA 5AUPB 2C1XA 3N39C 1EI9A 1Q2UA 3MT7A 4I7EA 5DWDA 2LXNA 3TKAA 2V6IA 4HVLA 4P93A 4O4LA 1UBOS 3IFSA 3OQHA 4G0XA 1EM8B 4ZAFA 3M6FA 5F52A 1JSZA 2YJ4A 2VK2A 2R47A 4DGSA 3CW8X 4EUFA 4HZUB 1QGDA 4IILA 4W5RA 3A27A 1ECFA 5HX7A 1ANKA 5TSDA 4UVIA 3ID6C 5A3VA 4BNVA 1CR2A 4BO1A 1JIUA 3P97A 4XD7A 2EGUA 2WMNB 1F7VA 2GESA 9LDBA 4K2AA 3G13A 3RYFA 1W581 1Y8CA 3AR5A 1RJFA 3KJQA 1XGKA 5H81A 4BWFB 4MUXA 3UPDA 4V1CA 4MNTA 3EF0A 1NMEA 1E4EA 1ZG3A 4AI6A 4IOLA 3IT1A 4F92B 3TMKA 1TAQA 2V4UA 3T3PB 4B32A 4OL9A 3WJ1A 5KTYA 4WT7A 2XKBA 2JJ2D 4RK5A 2B37A 3HUUA 4WRRA 4Z2YA 3AUAA 4PYLA 1NLZA 1KYVA 3FNFA 4F6LA 2V7XA 3FYUA 3RRJA 3NWPA 4TRJA 4A16A 2VQEB 1UK6A 2QZZA 5FWNA 5LDDC 4YP0A 4GAEA 4WW0A 1E2DA 3NHZA 2IF0A 1NLMA 4TL7A 3GRKA 3HDVA 4KAXA 4AP9A 3VZRA 3IHTA 3IKLA 3SOPA 4Q3BA 2Q4DA 4RIEA 4EUNA 5E9JA 2P62A 2D1QA 3OM9A 4WLFA 1CP2A 1L7AA 3GLRA 3MERA 2PX5A 5DGXA 4ETMA 5H16A 5IYZA 4E13A 3DPIA 1M73E 1E3DA 2WIBA 4D9EA 2VAXA 4M4SA 2YDYA 4CCYB 1JXMA 4FIDA 1KAEA 3D5TA 2PIAA 4DFDA 2AB0A 3G49A 4Z7JA 4IWNA 4DC1A 4H7KA 3ASUA 3WTBA 2FK7A 3W5JA 2W4QA 1M7BA 1Y1KE 3B7PA 2JHCA 4LECA 5BSHA 3PHIA 2I9PA 5IAAA 4ZQGA 5EJAA 2DE0X 4X0EA 1OXKB 3FI0A 4X95A 3QLUA 4A5OA 4WXMA 2XMRA 4LBYA 3AT1A 4RE5A 3LYLA 1KHHA 4EI8A 2JLCA 3FKSD 1JJAA 2ZSHA 3W1WA 1NKTA 3HK2A 5F4ZA 3CRNA 2F1IA 3I42A 4TPKA 1XPOA 4F4IA 1RXCA 3N5KA 1KO7A 4MUEA 3JARA 1O97C 1XZAA 4IV8A 4P36A 3TZBA 4EHHA 3GLGA 1CRPA 2IYPA 4QYIA 2AF3C 3H8WA 3ZHUA 1C9YA 3PT9A 3PSHA 4K26A 1JJFA 5BRNA 3TRHA 1CTQA 1ZCBA 1WL8A 4L8LA 1GDDA 3Q2KA 4MDHA 4BAGA 2ZT6A 1IEQA 2EKPA 5I7OA 1DO8A 4FI3F 1JLLA 3KOYA 4XD2A 1V3QE 3NJRA 2G1UA 2C2GA 3SX0A 3DVLA 1V8BA 1TJPB 2PUFA 1XRMA 2X8AA 2YFHA 3I45A 5EIAA 1C0EA 1GAEO 2PL1A 5EWLA 1Y4UA 1MZVA 4TKMA 4ZQHA 5DWQA 5H1YA 2ODEA 1JQ3A 1V5WA 1MH1A 1TUBA 3E22A 3KAJA 4ZAXA 5MN6A 1NM5A 3DAPA 4NJOA 2V6JA 3IQEA 4HRXA 4OHUA 1M6VB 2YWJA 1DXYA 3F7TA 2W48A 3KSUA 3BJEA 4YH1A 3WR5A 4LMBA 4DV6B 4F2DA 3ROZA 4WJKB 3GLVA 1Z56C 1BYIA 1KO1A 3E9ZA 5TPZD 1JHPA 1WZUA 2YW9A 1F20A 1Z5VA 2QRVA 3K0CC 3LQ2A 1UXOA 1E94E 2CGEA 5JY1A 4RDHA 1WY7A 4BLOA 4EHFA 3FPLA 3CGGA 3OD1A 3IOMA 1IY1A 1C7ZA 3PQ4A 2J31A 5ALHA 2RHMA 3OU2A 1QHGA 1J23A 2RARA 3KV3O 1ESZA 3L5KA 4H31A 1YB1A 1X7XB 1SC9A 3G0GA 3HP1A 2JGDB 3A4TA 3IDZA 3FTFA 5ILGA 1K2WA 3DL2A 2WHXA 3QX8A 4FLFA 1KEEB 1SUWA 2HHLA 3F3YA 4WX2B 4H4CA 2VSOA 3NBZC 2PFKA 4XQCA 5CH5A 4BO4A 1CUCA 3DVAA 4HNVA 2YJGA 3T41A 5KU1A 1W73A 1BX0A 3HYRA 2HTFA 3G1UA 3KJFA 3OUTA 1DAMA 3E53A 2HNKA 4HY3A 2V7VA 2ZRGA 1H6CA 3C7AA 3FCSB 4PO3X 4KX5A 4IG9A 4O4HA 5B5SA 4QOGA 3I8OA 2I4IA 3B1YA 3OPYI 1NVVQ 2ST1A 3DDNA 1QYVA 3LBAA 4G0PA 4QELA 4UJ5A 1G2IA 3A28A 4FWBA 4YP1A 2I6GA 3WWCA 3HDGA 3VNRA 2XF8A 2PUHA 4KXUA 4YAJA 1OAAA 3Q3IA 4J7UA 4OJTA 4BTLA 2E4YA 1MQAA 1CDZA 3QVSA 1V1JA 1IC6A 3WB1A 2NTYC 2PJZA 5KYYA 5IC6A 4OQXA 5ED0A 3PC3A 4H3KB 5DTEA 1T9KA 3LLVA 4MW6A 2ADOA 1VJCA 3CM0A 2Z95A 4J3FA 4QICA 4QD3A 2ZIXA 2EHDA 3ZV4A 3SBEA 2C04A 3R7DA 2FPIA 1U3WA 1X92A 3QFSA 3IA7A 2VJYA 3H1FA 1M1YA 3GD5A 3VKUA 2G7ZA 1OX6A 3QYJA 1J0AA 2IPXA 4JWKA 3W34A 2WB2A 4RD0A 3R8XA 3P5SA 5KOJB 3F5DA 3MJFA 4INPA 2JBHA 2FUKA 5DEIA 2NUTA 2YVAA 3PL5A 1ZI6A 3ETNA 1IPHA 1F3LA 2WK1A 3LT0A 3SC4A 1ADJA 3O8OA 2YV2A 4GLFA 4IKPA 4L0DA 2XY4A 4A9AA 4EG6A 2ZW9A 3BRWD 4P3PA 3ZH9B 5DYNA 1K2VN 1T5OA 1UFOA 3Q12A 3MOGA 1C9NA 2FU5C 5HJ5A 3CIFA 3KQYA 4X6LA 1NOJA 3P26A 5EHNA 2Y9PB 2Y77A 1NLUA 1ZVMA 2JJ2A 3LECA 3S6JA 1IU9A 4YFVA 5G1OA 4TLLB 4IDHA 4Q3OA 5J3JA 4EMBA 3RYCB 2WBLC 4ZEXA 1FSSA 2PM8A 1QS0B 4QDUA 2DH6A 1NX6A 2WAAA 2F64A 3T0IA 5CT9A 1EIZA 3BZBA 3FOBA 2RH9B 2FE4A 4B7CA 4B73A 5SZHB 1IHUA 1F3OA 1KFKB 2DUMA 1VLMA 1U2DC 5E2IA 3JY6A 2QV0A 3N2ZB 4QJ5A 4E07A 1UWKA 1E4EB 1N7GA 2XNCA 4LWZA 3W9SA 5KPJA 1W96A 2O8FA 4MAFA 3DD5A 1UIRA 1US8B 2PPLA 4KAFA 5C1PA 3SR4A 4AJHA 5JDIA 2OD7A 3ZHXA 4BFUA 3PJRA 4C5AA 1U2GA 2HLDD 3KWLA 3WK7A 3CY6A 4UNNA 5J5VA 4A0QA 4QEZA 1L7BA 1C0IA 4WL0A 2B82A 5DCLA 2CCJA 5FV7A 4A5SA 4RULA 2OO5A 4FHCA 1M1YE 3ZCRA 3BOSA 4MTCA 4J6EA 3O8CA 2GLTA 2OHOA 3QBTA 3ENNA 4IFBA 2HO5A 3M6IA 3SIXA 1RHUA 1WXFA 3RWOA 2W6IA 4FKMA 2D7DA 1GAXA 1AB6A 1GQQA 2PQ6A 3ESAA 2NSYA 4LV6A 1J0EA 1U3VA 3IBYA 1HRKA 2FN3A 2VQ3A 1JP7A 2VBGA 2A86A 5JYBA 5BQXA 1NVEA 3EYAA 1RJGA 2VKTA 2I6SA 2F1HA 3CZQA 4HPWA 4FP9A 4B3JA 2CJWA 3DYVA 1T5LA 4WXRA 1JAZA 5EE1A 2R8RA 4JR2A 2VTVA 2QMEA 2G88A 2HQ1A 1C3EA 2IYUA 5EIFA 2MCFA 5JAOA 4UXJA 3UYLA 1MA0A 1MRNA 1QANA 2Y1XA 3KXDA 4LQDA 1FNSA 1A8SA 1X6VA 4Y2XA 1RKVA 3PLNA 4G5HA 5KNDD 2C7QA 2OHIA 1J07A 3NOXA 4LDZA 1JEAA 3TLZA 1V5EA 2IZZA 3ZCUA 5CDUA 5LDHA 1BFUA 2PWZA 2VJOA 1GR0A 4BB9A 1P5FA 1APBA 4JI2B 1YS2X 3CJQA 3KELA 3GLGB 3ZR4B 4DIMA 1TJ5A 4RD3A 1GQFA 3C87A 4FSHA 2WJPA 1XJ5A 5IDQA 3ECAA 4GUAA 4DCSA 1TADA 2GEKA 2FN4A 3WGYA 2IVFA 1IY2A 1LTHR 1PL0A 3E9QA 4QXPA 4WLEA 3UUWA 4FSDA 1MA3A 3EVEA 4WJZA 4R4JA 3SKXA 3TMYA 5C1BA 1MD9A 3KBBA 4LV8B 3HCEA 4AJ2A 4GKAA 1G59A 3FZNA 3JATA 3ZWNA 1TO1E 4XFJA 4LTNA 1RVDA 2UUPA 4BRZA 1R18A 3INNA 5A3SA 2DWPA 4QREA 3TB4A 4YPOA 4BNWA 1JDBB 2XUQA 1Y6QA 4XM1A 1FNMA 1EJ2A 3BBLA 4FMCF 4EPVA 1A98A 1QLHA 3GLSA 5EJFA 3LNCA 3TQFA 4EZIA 3F6PA 2OXRA 4KO1S 3OE7A 1CCWA 3DXFA 5B2FA 2XUGA 4MQ6A 2R87A 1PQUA 5GVRA 2DWCA 2CD7A 3DW1X 1O0BA 1AGNA 2HA7A 4PICA 1CRZA 1ENPA 4G41A 4JH0A 4NZNA 5AVVA 4AKIA 1EP9A 4YDHB 5T4HA 1DOZA 1A2QA 2BF7A 5AKEA 1SKUA 4QG7A 1GY8A 2Q1YA 4QVIA 1ZUIA 4TN5A 1W4BA 4OIFA 4Q9JA 3U19A 3KHSA 1X7YB 4BB5A 4MRAA 5EIWA 2RKWA 1IXYA 5K0LA 3UC5A 3TZQA 2X13A 3GRFA 1Y3IA 3P9RA 5T67A 2PXAA 4Q4AB 4B3GA 3R9XB 1F2DA 1HQYE 2HLNA 4NCJA 2R8ZA 3U3XA 5HK9A 1JA9A 3VR5D 1E5XA 2J9FB 1JDJA 1HM5A 2XA1A 3MRSA 3B5IA 1PJCA 4JLWA 4GWGA 1TQDA 4BMDA 2PYZA 2VAVA 5AESA 4BO0A 1TTTA 1Z2OX 2Z30A 1ULTA 1CSEE 3N9IA 1G8YA 2FPOA 2XBUA 5A4FS 3L6UA 3OFNA 4RKRA 1YL5A 2XYVA 3QE4A 3A1TA 3DULA 4F72A 4AY6A 3EOZA 3NP7A 4RK0A 5LLDA 3MINA 4NCKA 2AZTA 4HD8A 4Y2RA 5AHKA 3DPSA 1LBSA 4Z7QB 2KQUA 3A7EA 4B7ZA 4KH1A 1MX1A 3MUEA 1H6AA 4L0QA 4CJXA 1DJQA 3FH0A 2YJ5A 5B3AA 3U3JA 3R6TA 4AJKA 2F00A 2AV6A 1FY2A 2CUKA 4IVPA 3RBXA 2CUNA 2SKCA 3FLMA 2M32A 1IEXA 1EFRA 1PW5A 1CY2A 3NHSA 4D4LA 1LQ2A 1Z5UA 2AJLI 1E58A 2B92A 2FEPA 1RWKA 2QRNA 3BSSA 3ER6A 4LISA 1Q0TA 2QXTA 4Z4QA 3KOUA 1P81A 1DIRA 2AX3A 1QOPB 2INGX 3HSSA 1PT5A 3M0EA 3M3HA 1RP1A 4WCVA 3PENA 1IN8A 4Q1VA 4YJHA 3RUCA 5CXQA 2ZR0A 1FDTA 1SKAA 2XNJA 5FV4A 2J3KA 4DDHA 1V6CA 4HCJA 1VI6A 2XWJI 4GYWA 2X0IA 5IYZF 5FOQA 3RVDA 3VAAA 2DZDA 2XGSA 2GFHA 1BS9A 1ZEMA 2E21A 4W9NA 4R1UA 4LXYA 3S1SA 1M2EA 1JEDA 3CLUD 3U3KA 3P9CA 4GNRA 1XR3A 1X8JA 4IIEA 5BORA 1A77A 3CRW1 1HK7A 3I9NA 1ZVQA 3ASYA 4WWHA 4RIFA 3AVOA 5H5JA 4CRWB 1DKRA 3TJMA 1PHPA 4TMVA 3W5IA 4J6FA 2OV1A 5CVDA 3WLLA 1IHDA 1H5QA 4NL4H 4P80A 1UPCA 3E81A 4GLJA 4ZKEA 4CHGA 2PZBA 5CCBA 3OE4A 1F5NA 3VYWA 2QTMA 2V54A 2HGSA 2QGZA 4J07A 5AI8A 3ZV6A 1GA1A 2WNHA 1J49A 4CUJA 1A9ZA 4BWVA 2NXEA 2WU0A 4YECA 4BRSA 2RBEA 3KUKA 4Y1EA 5CU7A 1Z17A 2SECE 2W6ID 1T0UA 8ATCA 3I0NA 3FZEA 1IATA 2XNDA 3QU2A 4QA9A 1DVRA 2BD0A 4HR7A 4JSRA 5CA0B 3ESQA 1VB5A 4H7PA 1ORWA 1HT0A 2FUNB 4I6EA 4XUDA 4BKRA 2HT1A 3VTKA 4AU1A 2HYIC 3ROPA 1SD2A 4PQYA 4Z9XA 1IVSA 1XXHB 1I51A 4H9GA 3UT0A 1QIFA 1GPYA 1YE3A 3GPBA 4LJ5A 2JF0A 3T1QA 1ADFA 4RELA 5JLAA 1DIOB 3AP3A 1GPWB 3FETA 3R41A 2QE7D 1ZC4A 5AO9A 5C8DA 3Q85A 4QXMA 5EWJB 1PR1A 5BOSA 1Y6RA 2HWXA 4U7JA 3RM3A 4CIWA 1YNOA 3WIDA 1PFVA 4Y8VA 4XJXA 1NPTO 1N3IA 4YUAA 1CEYA 1YTUA 1RYMA 3F7MA 3CNBA 4FFPA 4BECA 1P3DA 1Z0UA 3KKLA 4I8IA 1Q0HA 3N5CA 1LY1A 2L69A 3UUFA 3VPGA 1JGTA 5E9AA 2G5TA 4B85A 3IX7A 3PUXA 1JSLA 3I2IA 5K0BA 4BV3A 1XZEA 3G9ZA 4IOMA 1QIHA 3KLBA 2FE1A 1NVUQ 3TAUA 2UU9B 1JJBA 2ZKLA 5FOUA 1P7CA 1PJAA 4QZVA 3DE6X 1V1RA 2BFBA 4IIYA 5FKJA 4HMPA 3ZCQA 3PC2A 3BKWA 3NH9A 1TAUA 3KTFA 4LF8B 4KX3A 4GQIA 3WKBA 2ZWAA 1ZOSA 4OU4A 4R68A 4U2KA 3JQ7A 4M6WB 3C7TA 3HO6A 5HF6A 4AUNA 2GZRA 2W00A 4BNFA 4W6ZA 4MZDA 3FNBA 3LTEA 4XB2A 5CYFA 2AQHA 3QKIA 3ZHQA 2GM9A 2CNWA 1SCUA 2HCFA 1RQ2A 3C5CA 1ZQ9A 1ATIA 4LGMA 3AY0A 2QQEA 1YFZA 4RPLA 3PI7A 1LKZA 4HDSB 1JWBB 2H51A 3B48A 2JKVA 1ZOOA 2BFDB 4RZHA 1HSOA 1B8VA 2UYOA 3AUSA 3Q7EA 2HPAA 4D2IA 1AK2A 3KLNA 2CEAA 1VJTA 2BTOA 5FBLB 3FCUB 3SX2A 1E9BA 5M7EA 1R0XA 5L6LB 2JLZA 1K3TA 1XMQB 3DKIA 5CT6A 1SCDA 2QX8A 1FPQA 1MVNA 1KMIY 4NAHA 2ZRPA 1WEKA 4LYGA 2XRMA 1P9WA 3D59A 3TRDA 3ZKWB 3QOWA 4QDKA 2O0HA 5B4TA 1E6CA 3O3OB 5BW6B 2CJYA 1E2IA 1GGNA 2L0XA 1G8KA 1N2XA 1QFJA 1WVMA 3AB3A 2VO1A 3A3YA 3PVZA 5J5CA 3RFCA 1YI1A 4K81B 2QTCA 3DDWA 4HI0E 3VAYA 4OQZA 2IIBA 4DWVA 2A1IA 1QB7A 2I3AA 5F7XA 1SPXA 3DWGA 1FMJA 4HG2A 3OX4A 1P9OA 2HF7A 4X1KB 2P79A 5DM60 2VK8A 2PKCA 4NMXB 2IXEA 4FFBA 2BKUA 4E15A 3D1JA 5JG7A 4V1CB 1XWIA 1MJ5A 1KJNA 1NJGA 2HSDA 1BQ4A 1FVFA 3BTVA 3NM4A 4UCWA 3X0DA 1J0DA 4WAUA 3T7JA 3KRTA 5EIXA 4BXOA 4MYSA 1Y0BA 1MT0A 5I45A 3FM9A 3GP8A 2JVJA 5KU7A 4IGAA 4JGBA 2B5OA 5L4SA 1HE1C 3JVVA 1BSVA 4PC3A 1XDWA 2OGZA 3OKAA 3RRBA 3N6VA 3EDCA 4PO8A 1DC6A 2QY9A 4UTPA 3CLTD 1U9IA 4ZAVA 4PZYA 2PNFA 2QM0A 4ZANA 1XZDA 2P2NA 5JXIA 1YOBA 2HRDA 1ZRMA 2X0DA 1XMJA 2PGXA 4DPMA 4GE3A 2A0XA 1YR7A 3C3MA 4MPDA 4BP3A 5IULC 1W36B 3WYAA 1ILEA 1NRXA 3DHNA 3NCHA 3B8EA 2J0VA 1M6YA 2K87A 5F3RA 1EP1B 3VR2D 3B13B 1ZESA 3NG1A 3MSCA 1U2PA 3KT8A 1V3TA 5LMZA 1LPBB 4CGYA 2JLYA 2KB0A 3F2VA 4CMAA 4Q1DA 4X65B 1SUBA 1YZNA 4WOPA 2NUAB 4EY3A 1AMUA 1F8GA 1E1MA 2FTKE 4BE4A 1XDGA 4F91B 4KHPB 4QWWA 3LWZA 1MIOB 2V6MA 3ELUA 4O2AA 2ODTX 1W6RA 4BFLA 2DM6A 3EXIA 4XQ9A 3GJRA 1RWMA 4ARUA 1WW2A 1Q22A 4DDTA 3EJ6A 4NWIA 5DPMA 3AF1A 4DBVO 1CR1A 3OTQA 4BO3A 4QGSA 3K2IA 1MB4A 3ETDA 2QM3A 1E1QA 3BM5A 4AJ1A 1ZIDA 4B44A 3R6LA 1QFYA 4B40A 1YHYA 2TYSB 5CVCA 2Z2JA 3ESDA 1VP3A 1E1NA 1RRGA 1CLEA 2VG8A 3TLEA 1U6JA 3KQPA 2B83A 5DHPA 3EGDB 3ETJA 5CFOA 1U2GC 3DE4X 4KYIB 2W43A 3LSTA 2R4QA 1JB1A 4YJ2B 3RROA 1A9OA 2H9YA 3ODPA 4KGDA 1OI4A 5CNKA 2ABWA 3I28A 4F5WA 1B2LA 2NAFA 5CFNA 4N6OA 5AW4A 2EKBA 3CEJA 1XVIA 3IUNA 3FPEA 4K87A 4BFXA 4BKUA 4L5AA 2BGGA 1Y4SA 3F3KA 1E69A 1VI2A 2CJWB 1UMKA 3DXYA 4LXGA 3VNAA 3TKLA 4R8VA 3ILXA 3EK2A 1NNLA 1H4VB 4G84A 3PTZA 4Z4IA 3NP9A 2JW5A 4HGYA 4CI0B 4BJ3A 3EC2A 4ATNA 1A9TA 4HAXA 3VR0A 1FS6A 3H3FA 3ZXXA 1LW7A 3KSMA 3GEIA 2QAIA 1BRTA 5FH9A 1MQ8B 1JAXA 1AY0A 1NN3A 4Y2TA 5F2KA 3LHSA 4DIDA 4F71A 3I04A 5A7FA 2R1TB 4LZOA 2BKLA 4MIEA 1LI4A 2XQGA 3CVJA 3W6UA 2D4HA 4LK2A 4S0XA 4KBFA 3JZAA 3D7MA 4EL5A 2Z1NA 3R9WA 2Y0BA 2P1RA 1NDQA 4LMRA 4MVWA 4P08A 4JKOA 3Q2IA 4I4TF 3P71T 1Z73A 2OFXA 3V8BA 3J80A 3N76A 4QM6A 3JQGB 2ISSD 1ZMRA 2H2IA 1MP0A 4XI9A 4CUZA 2ZZNA 4F2GA 2Q45A 1HDXA 2I99A 1IG0A 4FEAA 4B6JA 2CLDX 4HH1A 4C1NA 4ERNA 1SXIA 4AO6A 1GZDA 5F2EA 2OZEA 2HA5A 3BERA 3VBCA 4F4JA 1JALA 2D2FA 5K8TA 3C24A 3A9UA 1R5BA 3HABA 2RG1A 1F14A 4ZO9A 3SLRA 3JWPA 3VSBA 3IV7A 4R1MA 4ZAZA 4MSUA 5KCMA 3SCZA 5E8JA 3SY8A 3V8PA 2ZB8A 3Q8XB 5I4KA 3AKYA 4KW7A 4LXXA 2XJ9A 1SHJA 1Y5LA 3OLWA 5CIQA 1A1SA 2XGGA 4PVDA 3BDVA 3NEJA 4B2YA 4D8WA 4E7OA 3S8EA 2BBWA 2R6CA 4K8OA 2JLXA 5AJUA 4WBXC 1D0SA 5E4YA 2C9BA 4W5OA 1Z25A 4GG1A 4V02A 5DT9A 5LOVA 1JSXA 4GBMA 3MRXA 1G8AA 3ICPA 1U7OA 1HO3A 2X15A 3GBPA 1P60A 5LBIA 3LW8A 4AJJA 5I47A 2QUKA 3GFPA 4NU6A 4N7RA 5JO9A 2ZYWX 5FUMA 3VKVA 1FL9A 2OAQ1 3CNLA 5I9BA 1KVRA 2E5LB 3TZKA 2OENG 5HDBB 3STHA 5KVQA 1TK2A 1G5FA 5KQMA 4A8TA 1W4CA 3AQIA 3R5XA 2GXQA 3D54D 5JCJD 2PKEA 1AGPA 2W6ZA 2E5WA 1SZJG 1O96A 1QVVA 1UQTA 4IDDA 1RHRA 4OGFA 4QOHA 3C3WA 3WJ2A 3TECE 4FEYA 2PKRA 5M34A 4C2UA 2DUNA 3OSUA 5J1SB 4EQ6B 2OAP1 5KNCH 4TLMB 4PZ9A 1DTSA 3QEMA 2XEXA 5HFNA 5BW5A 3I6ZA 4HWGA 5CIYA 2C3PA 3LAWA 3W5UA 3WGMA 2DFKB 2WJVA 4Z0PA 2GNOA 2P7IA 3EPPA 5DNAA 5G4LA 2EKZA 3M1YA 3K53A 3K1AA 1JQAA 5TQ0A 5LNK1 1A72A 1CUUA 1P7ZA 3JQFC 4DPKA 1UKEA 2J6BA 3K09A 1X7WA 4DXHA 1M2NA 1OGJA 3A9WA 3O6VA 1VE1A 3QUQA 3U3MA 3AKZA 5AKLA 3U7IA 3DEJA 2VTBB 4NFSA 1EDZA 3NHKA 1CBUA 1TVEA 3MLAA 1MB2A 2XYRA 1IB6A 1NW6A 4QUDA 3SBOA 2IEZA 1NR1A 5IM5A 3WXBA 3Q9NA 1QTRA 3FDZA 1AV6A 3DGEC 3WYNA 2ZJ2A 1M5TA 4PYMA 2P6MA 4G1EB 1VKHA 1L3CA 4PAWA 5KNCD 1UJ6A 5A2QA 4FOTA 4JUBA 5F9MA 1YZGA 4E88A 1GSIA 2GHRA 4R8MA 2J5BA 3WO1A 5J5AA 2IWHA 4C4SA 1S4MA 4BQFA 4FXPA 3HI4A 2EW8A 4P98A 4HLQB 4LSMA 4BNLA 3V7YA 4ER7A 5JXHA 3DW3X 1YZHA 3L43A 2VDKB 5IKOA 3KEOA 1E2LA 3MMXA 4YRLA 3JRXA 3WRYA 1MJNA 3FWNA 2V98A 4HDOB 2JIDA 4C6HA 2BGUA 3EXEB 4AN0A 4EKGA 3C6KA 3AV0B 3SYLA 5GVSA 3C3XA 3F67A 3L4JA 2KWIA 3FWZA 2WHEA 2BGTA 2Q4TA 1UL1X 3BN3A 2YZNA 3CVOA 3FHOA 3OQIB 4PZCA 2LZ0A 3WFIA 1NURA 4PONA 1AUXA 2JIQA 3ANSA 2NIPA 2PKQO 2YMQA 3A05A 1T8PA 3OH8A 3R6GA 1NMZA 4O2BF 1ZJYA 2I2CA 3MYYA 1R88A 3RS2A 2ONZA 3EFEA 2FP4B 5DM2A 1WUHS 2CXTA 1MX3A 1DPGA 1NGSA 1NQ5A 1Z4PX 4JXKA 4AMYA 1WBJB 4GLBA 2QUBA 4FDLA 2FYTA 3BKXA 3K3PA 2P5YA 4KIWA 5CA0A 2PT9A 3WIBA 5CB4B 2WIAA 3IQFA 5J2TB 4KJZA 2FN7A 5ALIA 4GZMA 2ZUFA 2PUEA 4JUDX 1G1MA 3GEDA 1MH9A 1UBNA 4ED9A 1UXGA 4OP2A 1XALA 4XR4A 3U44A 1Y82A 2XDWA 5IT4A 2EIHA 5CAEB 5LBUA 1YGPA 5JD3A 5G02A 1U0SY 3SR0A 2Y1DA 2HFKA 5KS2A 4IDAA 3VGPA 1OBFO 2J9YB 1U5BB 2QX4A 3ER8A 1H4SA 5BT8A 1SVUA 3FVVA 1KYYA 1QYCA 5CHYA 2OFPA 4DA0A 2GN8A 4RENA 4JT9A 4CF5A 5JMWA 1NXVA 4QL3A 1E9VA 2LCFA 2V96A 3B89A 1G2QA 3VTZA 1BWSA 3DEYX 4AMUA 4D26A 2DQKA 4PRYA 5E1OA 4UULA 1I01A 3A9CA 2IHKA 2ZTVA 3SZOA 5TQ2A 3S55A 4L8FA 4I1PA 2Q5HA 2H00A 2OZKA 3H4IA 4UMFA 4ZU1X 4ZCTA 1ZJJA 5CT4A 2I3DA 3FPHA 5K01A 3CVUA 2HLPA 2PX2A 2ZJOA 2PRKA 3AG6A 3FYHA 5FB3A 3NOVA 2JFGA 2W6NA 3E3AA 5FDFA 3KDSE 1EXDA 3RHZA 1K7YA 3T99A 5JD5A 4FLMA 1VSBA 5KI6A 2BJVA 1AE1A 1HZZC 1CU1A 1YKSA 2WSIA 2GTPA 4RACA 5I7EA 1KQFA 2FK8A 3QENA 3SNHA 3ZE2B 3O4JA 4PM4A 3NTQA 1V9CA 2VTDA 1O58A 4NATA 1QBKC 3UPTA 4JHXA 5A4JA 3PKZA 2RIPA 1PU2A 2OGTA 2Q3HA 3FOWA 3D6AA 2CV0A 2OCBA 4IJVA 1YRLA 4UE2A 1U28A 1DSSG 1MU0A 1IONA 3TIGA 4P7KA 4HDSA 2WT9A 3PFFA 4D9CA 1RI5A 1BNCA 1EFDN 5DB4A 2O7VA 5KNDH 2Q6OA 3EBLA 4NPAA 2P35A 2B78A 3HUTA 2FSUA 1KYXA 2F3TA 3PFCA 3IRVA 4PWZA 2YN2A 3DEHA 2X3UA 5DT2A 2VCHA 4YJKA 4MJ3A 3U1BA 1H3FA 3FXAA 1RI1A 2NZUG 3EIUA 4XUEA 3T9BA 1JMVA 5F5LA 4TXMA 1S2NA 1XT6A 3M6AA 2CL0X 3UUEA 3INRA 5C8ZA 1DZ3A 2C2OA 1W49A 4WXPA 1QZZA 3PC6A 5HWSA 4C4YA 1Y33E 2IUYA 2IZ1A 4CT5A 3V4RA 2Z08A 2NU7B 3RSCA 5K6AA 3L82B 3P4UA 3ONNA 1A5TA 3F78A 1Y5IA 4OFWA 4YCNA 1NBMD 3VSEA 1IULA 1UH5A 1W94A 2WUFA 4TYQA 4NBUA 4Y6QA 5FOVA 1OIVA 1KJYA 1TA4A 2GZAA 3ICOA 1XTRA 4BKMA 4QE3A 1RZUA 1NY6A 3BFPA 5JYCA 1MTZA 5CCDA 5FBRB 2YYYA 5E2AA 3IAEA 1GNTA 3FMFA 4J8PA 2YHAA 4HUQA 1QX3A 2DFDA 4K9SA 4F2WA 3HVIA 1PLJA 1QC5A 4ROSA 3LP8A 4E1VA 3M7IA 3KOXA 1BA3A 1TA9A 2OP1A 3BSFA 2O3SA 3TNYA 4EY7A 3BCUA 7REQB 3EB9A 2ZUSA 1Y7TA 1LW6E 1BEUB 3AHCA 3ESXA 4DIOA 2GO7A 4P3NA 2H85A 1WHTA 2YH2A 5FORA 4Q21A 4XSGA 1I6WA 4EJMA 1HNZB 1U0EA 4KQKA 3UMCA 3NHWA 4UC0A 1P9NA 1PUIA 2XUKA 1SQSA 2AUTA 4QEDA 1TAGA 2QG4A 3SBXA 5JXJA 1XTSA 4TWRA 4CMKA 4CKCB 4V0KA 4WOBA 1ADYA 1Q50A 4EA9A 4YP9A 1GV0A 5KTOA 5AHXA 4C03A 2OBBA 2CE7A 1UXIA 4JFAA 4ETNA 2HQSA 3L7KA 2P9TA 4EHBA 3HB0A 4Q7LA 5E6UB 4EHKA 3OBBA 4JJEA 2JIOA 2JIRA 1C41A 4PGHA 3ZDQA 3HCPA 2EJCA 3PNQA 3C3AA 5FIUA 4YRSA 5I51A 5HOQA 2WHPA 1YQDA 1AUQA 4II7A 5JASA 4G3XA 2E48A 1ZNQO 2J3HA 4F4HA 1T2DA 3TO5A 3WXMA 3HUDA 5JS1A 3AM1A 1TPZA 4J0CA 4R3UC 1D4AA 2O0MA 5K2MA 3ST7A 3PJGA 3S29A 3HEAA 1Z7GA 2H11A 4I4IA 4DZTA 1W1UA 1E18A 4ZVRA 3ZHYA 2ZR8A 1JTEA 4MHOA 1RPZA 1RS0A 2I65A 4LYDA 3OZXA 1XO1A 1OC2A 5JE8A 1X1TA 5DNUA 3KNZA 2O7SA 2AI3A 2XD4A 3GT3A 4LFBB 2W6JA 3L8ZA 3PUJA 1EZ1A 1N1MA 1ZEJA 3VJMA 3H1AA 2XE4A 1M2KA 2C83A 3DOJA 3F4LA 3OQIA 4N1AA 3HACA 3CUTA 2N47A 5J2TF 1XD8A 2AUNA 1EDEA 1SM4A 4KYTA 4OK6A 2NU8B 1H2YA 1ZRHA 2CNNA 1N5RA 1X9IA 2QHXA 3AINA 3HHEA 4M0CA 4D4MA 1NVFA 2RJNA 3OFJA 1R12A 2XSZD 3COZA 3LVFO 5AVSA 1JDZA 3D31A 5EXXA 3ED1A 1SBCA 1F9AA 1MKYA 3DTVD 2O8FB 1YFLA 3GLHE 3TEFA 2OZPA 2XTJA 2WYHA 3IAM1 4DZRA 2JAXA 4BJ1A 1PG2A 4QYIB 1YQWA 4MRNA 4BDTA 2R2GA 4M98A 2H5JA 2VSQA 2JRCA 3C7CB 4CM9A 1HYQA 3DFZA 3SGLA 1D1SA 2ECKA 1YGYA 4RTLA 2AZMA 1FRFS 2WVAA 4RHFA 3OT1B 4CDGA 5HQ3A 3HM9A 3AL0C 4P0TA 3U0VA 3G5TA 3FPBA 2D5LA 3UWPA 3BA6A 2ZVPX 2O8BB 3AKEA 4HDCA 2QNIA 3AK4A 1YIOA 5BSGA 1T9DA 2ZVDA 4LRXA 4MVJA 2J7PD 3NFRA 2O5CA 2WA1A 5AOCA 3HY6A 4S1WA 4WCFB 4YT8A 1VKOA 3R3ZA 4GSKA 4Q3DA 4DC9A 3A6LA 4AY4A 4CLOA 1UAGA 3FCCA 3W5DA 3L7CA 3OT4A 4G24A 1Y7IA 3V5NA 4E11A 1RC1A 4LJAA 5CMLA 1XRNA 1D0IA 1Y3BE 2O1EA 3W7VA 5K8IA 4B3SB 1B4DA 5F9HA 1X14A 1SQGA 4FQ8A 1XZ8A 4Y6PA 3DFMA 3AHFA 4YQZA 5F1KA 1UDRA 3NRJA 1B00A 2WWWA 1T0HB 4YCCA 2HA3A 3ACDA 2DWUA 4NG4A 2BMDA 3DVSX 3FY4A 1IZ9A 1Z35A 4IDCA 3G7UA 4UEJA 1R37A 4ZT3A 4BZXA 1IRIA 2Z5FA 4ESHA 6AT1A 4HDMA 1BU5A 1GFSA 3ETCA 5C3UA 1RPTA 2AJTA 5C3MA 2DPMA 1NTRA 1SIWA 4TV9B 1EE9A 2IPMA 2WHQA 1A4UA 1DRUA 3GJXC 3MM4A 4JKIA 1CZOA 1WABA 1BA2A 1UT8A 3BL6A 3DAGA 4I2NA 1WUJS 4IXNA 1ZMTA 5DIFA 3SPXA 1F60A 3E8MA 3OEED 3FTCA 3PRHA 1VTKA 2CD9A 3AKCA 5T64A 421PA 2WJWA 2I80A 4G8DA 4RH3A 5JZ9A 3UVEA 4D5GA 4I50A 3BE8A 2IEAA 1YR3A 1U9JA 2GAOA 1GXSB 1MOPA 4AZ3B 4YRIA 1FEZA 3IUYA 3IPXA 5HFAA 2PWBA 5HKOA 1SC4A 4EQ6A 3OHPA 5LIPA 1PR5A 1T8YA 3D7NA 2X5NA 3EC1A 3QHQA 4XAQA 5KDOA 1NNUA 1P4HA 2C0CA 2GVNA 2XA2A 1D1QA 3MNFA 5T57A 4JR0A 3QX3A 5E7JA 2WSBA 1CZNA 5JI3E 3NUGA 1T5TA 3MTBA 4I8DA 4AIRA 4YCAA 1B93A 1JE0A 1GKKA 2FPRA 4J2OA 4WUTA 5KX5F 4JS0A 4H17A 4M9QA 4L5YA 3ZW9A 3TQHA 4EF5A 5JADA 2VPQA 3N0VA 1QYRA 1MFPA 1XP5A 2JGIA 5CM2Z 1WUKS 4DB4A 3P20A 2YVKA 3PIRA 4QFMA 4EENA 1N5OX 1G42A 3THOA 2ZJ1A 3SJBA 3ZJVA 5KPDA 3LUKA 2DBRA 2HAEA 3KZMA 4MVJG 4LHWA 2CHFA 4J91A 1YA6A 4ZJYA 1J8MF 4KC0A 2GJ8A 3NHUA 5GGXA 4G0YA 2W0SA 4FYWA 2I2FA 1YZVA 4NNOA 3EXHC 4WZBB 1AZSC 2BELA 4US2R 5MHTA 5IW8A 1YJBA 1OH5A 3HZOA 2GVDC 2QUAA 3BWVA 1OZ0A 2HMYB 1ELOA 2PUAA 5ALUA 3UHOA 4OB7A 4A10A 3NZEA 1QK4A 1Z45A 4MPTA 2J0QA 3ZD7A 4JYCA 4ZOLB 5CPBA 1G6HA 3FYUB 4N5MA 4XLZA 4C0XA 2W90A 2JFNA 3ZCPA 4BRWA 4X8OA 3VR6H 3AJ9A 5CLHA 4PYIA 1ZSVA 1T5BA 5KJEA 3WQHA 2I7DA 3B1ZA 2I4OA 3KZNA 2PCJA 3ZDYB 1KY3A 3HB7A 1GPDG 1KPGA 1QGUB 4G86A 4GR4A 4KMSA 3A6PC 2DVMA 4ZRNA 1G5QA 2PANA 4HQFA 4UATA 3KUXA 2AOTB 4W6QA 1KDPA 3RASA 3TB6A 1XAJA 2XT6A 4IMPA 3D6UA 4ENPA 3K9LA 5IYZB 4Q00A 2B7BA 4UNSA 3WRYC 4C4AA 1ZRSA 1XEWX 1TD9A 1UBJS 2ZS8A 3CPSA 4QDOA 3JD1A 4ZVPA 1CC1S 2PGJA 4UZEA 5SZJA 4HYEA 2JD1A 1PYOA 3FB1A 1I80A 3R40A 4FCVA 4IZIA 4UASA 4D99A 3I72A 3GI1A 1U3CA 3H5OA 3O3CA 3PPYA 4WECA 5LQJA 2CL7X 1RWWA 2Y71A 2XUZA 1EEHA 4Q48A 4H3HB 4OHOA 3OQOA 4DIUA 1L5NA 1GA4A 1SBNE 2JANA 3NTUA 1BGXT 1LS1A 5ALFA 2RHHA 4COKA 4CNBA 2QRMA 1MBZA 2VT6A 3EN0A 3R5JA 4R0MA 3O91A 4DCTA 3MOIA 3M9LA 3OCZA 4KDRA 4HZIA 4H7IA 4Y1RB 1XNHA 3HY3A 1NL3A 1EMDA 4LHSA 5A4AA 3F90A 4M9RA 2D2IA 4GVPA 3OOEA 3E5RA 4AKGA 2CLSA 2MOKA 1BJRE 4Y2YA 2WLTA 4KUHA 1VBMA 4U63A 3VR1A 3KKNA 4GRIA 1ZN2A 3JWGA 1TGYA 4IRMA 4REQA 2K4MA 4P33A 2V9CA 5ILQA 3H2BA 1FTNA 1FP6A 4RCVA 4BN0A 3IB3A 5B2EA 1M6EX 1FFEA 3A3NA 1YK0A 1U04A 4PSDA 1K6XA 3VQTA 1NBAA 1E9SA 3R7WA 1TJNA 5LB2A 5C53B 3EGVA 2CLLB 2XLCA 3QBJA 1IQRA 2HTEA 2Q3LA 3EEYA 4A8JC 3DZJA 4BFZA 3E22B 5JALA 2YQ4A 4NZPA 1N0HA 3BTUA 4AG5A 5KOYA 3GROA 3CKYA 4MKHA 1CULC 1ACJA 1PKXA 1U1IA 5EJ9A 2IYWA 5FQOA 4EKYA 2GCGA 1MRSA 3BH6A 1U0OC 1G55A 2OBMA 3GJZA 4MUGA 3VV2A 5LXTA 1DGQA 3O4FA 3DAOA 1ODKA 1WXGA 2HEGA 2ECOA 1C4WA 1WEHA 4QHTA 4E7PA 3OI7A 2FLWA 2AT1A 2IOYA 2WKSA 2WQZA 3ZGLA 2R11A 4LNAA 4PFQA 1X1QA 3LX5A 1JFLA 2P1ZA 1U7XA 3DE7X 1I5RA 5FOXA 1FUIA 3GZ4A 1J56A 5FADA 3KWMA 1X38A 1N5MA 3BE6A 3ZTYA 4TMTA 3T35A 4Q4LA 4IDNA 1LLDA 1OI2A 4Q9DA 4QPCA 1PWZA 1DXHA 3OOWA 1OZAA 3JWEA 4JNCA 5DTMA 4FEEA 2V6BA 4U6QA 3LOUA 2WZQA 2Z56A 3ILYA 2HDWA 5B4VA 4QTUB 1JU4A 2O8NA 4ANFA 3AMVA 4PLZA 1O96B 4ZT4A 2Q1SA 4II2A 2PS3A 5EXSA 3PXBA 4RLSA 4ZPXA 5E8RA 3RVMA 4L8GA 2Y6VA 2P4EA 3R3VA 2OM6A 1LV7A 3WGKA 4PHHA 2O0JA 1CQPA 4XGIA 3RYHB 5T4BA 3U40A 1VPLA 1Y3DE 1PV4A 2M98A 4YYEA 1G2PA 4AS3A 1TK3A 2HQRA 3WGUA 2VJKA 3UXEA 3A1CA 4OBWA 3ZQKA 4E5UA 4N40A 3WL3A 2VAMA 4IUYA 1ZS9A 2X3FA 3M6XA 4JVSB 2X40A 1I2AA 3O2NA 5EWMA 4D98A 5EKUA 4MUJA 4UMEA 3BVPA 1CUWA 5LP1A 2BEUA 1DKPA 1U94A 1V7CA 5JSFA 3F7OA 5K4HA 4W7SA 3ZDDA 2WUWE 1WUTA 3V7FA 1JEEA 2QVZX 1WDTA 1A7JA 2HN9A 2K6GA 5J2UA 2VHWA 3KHKA 1RXSA 3OFND 1VYHA 2CEKA 4KNYA 2I1QA 2BP7A 2PIDA 2REBA 2DR2A 3DFFA 4J03A 1QIDA 1T9GS 4K9PA 3NDRA 2PBLA 1T3LA 3TLGA 5WRFA 5TY0A 3ROQA 1D07A 2PFSA 3BWBA 3G1TA 2JJ8A 3CO5A 2XYHA 3B53X 4HLDA 1A9QA 3NMUF 5ALWA 4WMLA 1RAIA 5CK5A 5HP4A 4D0LB 3I5XA 1ZUHA 3DCNA 3ROEA 3UWMA 3RVKA 2LGJA 4E4TA 1NIJA 1SG9A 1KJZA 2FQYA 5CNJA 3ZY4A 4CIBA 2CDBA 2A0WA 1O6GA 1RCUA 3CR8A 3ZI0A 3WWYA 3G0CA 2HDOA 4DLNA 3K7EA 1XF1A 1CVRA 3LWNA 5ALOA 5CG1A 1Z3CA 3G82C 1R10A 3R0JA 2XQVA 1DI0A 4HSGA 4F3CA 2RJOA 4IBOA 3C5HA 4LCBA 1DFHA 1NV8A 3RAJA 4B7UA 4Z3OA 4TTVA 4RZ2A 3PQ3A 3M5CA 4A6XA 5EGSA 3P2OA 4HWPA 3EVCA 2PAAA 4KN6A 3A26A 3A4LA 2DHCA 4G1BA 3RJMA 4MROA 2PG3A 3TLGB 2QRPA 1BMFD 1JIVA 2J4DA 4CMJA 5CB8A 1POXA 3HU3A 1U9ZA 2YMPA 4D0RA 1ECGA 1I0IA 1L4FA 1X39A 2XB6A 4EHDA 2HK9A 1M2FA 4YJHB 2ZRHA 2FZWA 3D8TA 4G07A 2CDRA 2JH3A 2QIOA 3HZHA 2VQ6A 2OAEA 1CQWA 3LHIA 5I9IA 4BXOB 1T5DX 3JCZA 4FTWA 3VHXB 1WR8A 1L9KA 2V8OA 4XYBA 3U37A 1WXIA 1JH9A 1B6TA 2HWUA 2ZBDA 4G1FA 1S3IA 1P73A 3HSYA 4HXYA 2IXFA 4C2BA 1FUEA 1HT1E 4LC9A 5BUZA 3G9TA 1L7XA 2GRUA 4BWYA 2FMUA 1JAIA 3OPQA 4KHZA 3SXPA 4ALKA 1QJCA 1U2SA 1Z7BA 3LC0A 4NEHB 1V39A 5HBRA 5IAKA 4O2LA 4ZPJA 1QGOA 2IYZA 4JGIA 4I3GA 1ZL0A 1YE8A 4QRDA 4IRXA 1EGVB 1RQLA 3W3AH 2IOFK 3WMWA 1T0PA 2YOGA 4ZV4A 3T5MA 4YRKA 2O2YA 4JZKA 2X4LA 2NXNA 3OZ7A 5CVVA 2OYCA 2FB9A 4KU4A 2MSWA 2VWGA 2OPHA 5T6BA 1O5IA 3T7KA 1JW9B 3F4KA 4FBLA 5EHGA 1NOKA 3HRHA 4Y3UA 3CSUA 3CNQS 3ZI4A 4ZHQA 1Y4DE 3QUCA 1VKZA 3PHHA 5THXA 1QVWA 3EZ9A 2FA9A 3GZNA 3DOHA 2GDZA 3NV7A 4UM7A 1KDYA 2F8MA 2NO1A 4MYDA 5EGNA 4YUYA 4ACBA 4UHFA 1JNYA 5E9QA 3CZCA 3U7EB 3K9NA 1HTWA 5KAMA 4AY5A 2EZ4A 4C3OB 1R6VA 3ZQJA 3OY7A 2D5AA 4B80A 3I6YA 4EW6A 1TKAA 5IKEA 5HRUA 3AO0B 4Q47A 2OPBA 4GMXA 3ZE9A 1WXDA 5DF1A 1PTJA 5K0JA 2O8BA 1YJQA 1YUMA 2OQVA 3V6MA 3VXKA 4HX2A 2GTIA 1T4DA 2YY5A 3LOPA 4G36A 4S2UA 5TGTA 3SC6A 3WGVA 4E22A 3A2NA 3JYPA 4PG7A 2FETA 1NHGA 2QJOA 3M6UA 2CSUA 4WCFA 4DQXA 3EG9A 3ITNA 1EFVA 3TVDA 3OD5A 2NUPA 4IJMA 3VHLB 3WLHA 1LDBA 2E4WA 2Q5IA 2O59A 3NKFA 2OCYC 3IHKA 2FWAA 1CJKC 5DLYA 5KYUB 2KS6A 1QTQA 4RX1A 4A6PA 1WBDA 4ZDIA 3V3KA 4Y7CA 1NXTA 1O2DA 3DUFA 1FW6A 1RZ3A 4LDJA 1CPYA 1SKYE 3A3PA 1NQAO 1SY7A 4EB3A 2O8EB 5EZYB 4P4NA 3LE8A 4UDYX 2WKWA 2ECQA 3ZZNA 1OU4A 4I5GA 3S70A 3I73A 2CXUA 5AK0A 2IJGX 1MW9X 4M0MA 3AVWA 3FMPB 1MDFA 2OEPA 1P3JA 4EKNB 5KTTA 1SA0B 2QMOA 5ELLA 4B4UA 1VM6A 4BQOA 4TMKA 4PS1A 2VAPA 1MENA 3U4HA 3UJHA 2R66A 3V4PB 5TC4A 2OBXA 4YDQA 1I7QB 5D1HA 1Y5RA 1GAJA 3R1IA 1E3JA 1Y81A 3KYIB 2VJMA 3A70A 4XRRA 1KDZA 4GWLA 1VCOA 2EEPA 1RXIA 1T91A 4QU0A 1OLXA 1OY1A 1P8JA 2Q6IA 2LW7A 3JQRA 3R6WA 3ZE6A 1NVWQ 3WLQA 3BIJA 4D4KA 2D3WA 1IN1A 1DJMA 2G72A 4MS3A 4UNIA 2QA5A 4HEHA 2C9OA 1IQ0A 5DBOA 5BWBA 4PN3A 4HUQB 2V5VA 2GK6A 4BX3A 3ZD9A 5AJTA 4ZGBA 3RHTA 3EWAA 2JBWA 4HDNA 1J06A 2O0LA 2PH1A 3CB4A 4LZZA 4MP6A 3MB8A 3YASA 3CG4A 4YI5A 1GUBA 1KVTA 3KDAA 4Y6LA 1D2EA 1Z8HA 4HFMA 3T95A 5KQSA 1KK1A 1ECBA 3TNLA 3ZLBA 2NXWA 2ANBA 3AETA 1KS9A 3O8QB 1PFKA 3DQPA 1R5JA 1EFPB 1ZD5A 2ATVA 3L7NA 3P9ZA 2ONKA 1YVRA 4RANA 1PFYA 2JI8A 2PH3A 1ESEA 4RO0A 3KP1A 2EIXA 2VP3A 3GRZA 3ORFA 4Y98A 4JFRA 3MCWA 3DAYA 2V9PA 1N0IA 4TWAA 1X86B 1D2MA 1QAMA 1RRKA 1J5EB 1BE0A 1PYGA 1TRKA 2YRFA 3N74A 4J76A 3DVRX 2AJDA 1YWGO 3VZBA 4ARZB 4BLTA 5I7WA 3LXUX 1BFKA 1KERA 1P4JA 1SAYA 4L08A 4NY1A 2Q99A 2BW0A 1JAHA 2CVQA 1FFCA 4K9OA 3WWDA 3TF5A 3DAHA 3LFTA 4DIKA 3F4BA 3AY3A 4Q4HB 1XEAA 2BDTA 4R0NA 4LUCA 2IP2A 1J8YF 3WGHA 1J9EA 4JLOA 3S27A 5EY5B 3NVAA 4OHFA 5CM9C 3NH6A 4UMDA 5IMSA 1GUZA 1QHIA 1UEJA 1OWMA 3IKTA 1QCYA 2XKAA 4XARA 3BD9A 4JCCA 4FHZA 3PQFA 4HWOA 4MVJE 1T2VA 1JKJA 2BMEA 1GL3A 3OCUA 1DC3A 5ES4B 2I8LA 2WB4A 3TQTA 3TTSA 5FR1A 3KFVA 3VU8A 4A1FA 3ZJTA 2X14A 3AF2A 4FYKA 4JMLA 4RL6A 5EOVA 4HYYA 3TR6A 3ZG6A 1CE8B 2Q29A 3KJEA 1Q20A 3B3AA 4U9IS 4UNPA 4RTOA 3E18A 1N1GA 3C3DA 4OQFA 5REQA 3M33A 2ONJA 1KGSA 3UB4A 2B69A 3RVQA 3TGWA 3VU0A 4E2WA 5IAOA 4OXIA 2QE7A 3PDWA 3ERCA 3CH5A 3LGSA 2FFAA 2QT0A 1PJTA 4NCHA 4RDCA 3BL8A 4ZQCB 1EP2B 4XJSA 2ZI7A 1DEHA 2BKXA 4NESA 2DPYA 3W8DA 1FYVA 5LN1A 3KS9A 4LN1A 3BMCB 4JAVC 1GZVA 3AFNA 4KLCA 5FUYA 3TCKA 4LV5B 1EUCA 4E46A 4E6PA 5TF4A 5D3KA 3CZ4A 4L5BA 4RSMA 2Q2WA 3JYOA 3M1LA 3IHWA 2G3YA 3ZOKA 4EG5A 1PR9A 3IEUA 4B47A 1Z75A 3WLTA 3RNLA 3JZDA 4TTAA 1ZD4A 4NBVA 2BYTA 2I2AA 3H6GA 4XW2A 1MGPA 1XPJA 4PG6A 2IUSA 2P9JA 4KXNA 3B6ZA 3QKSB 4YCMA 2FHSA 1OKKA 1RSZA 4CV2A 1GWNA 2VT2A 2WY2D 1HDIA 4CLOB 1L5HB 4MUYA 4IRUB 1D6SA 1I1NA 1OWNA 3W6NA 5TT0A 4KWIA 4MARA 1WO8A 4R5MA 1NONA 1KTIA 1GADO 3EUFA 3QF7A 2PX0A 1Z39A 4DLBA 1N78A 3PNBA 1C9DB 1EFUA 3PYXA 1Q0SA 1SRRA 1QBGA 3LBHA 1CNEA 1F4PA 1BMTA 1Z26A 2I1LA 3L9XA 5IAGA 1PZNA 2RJ3A 3VO1A 2OVFA 1TD1A 1SCNE 2JDID 2X5OA 2XNSA 3MS7A 3OPNA 1RLUA 2OYSA 4UUNA 3W9UA 1Y9EA 3P9YA 3I01A 4RK6A 1OKKD 3A1WA 2OV8A 4MMYB 3TM5A 3SVTA 1W36D 4NDZA 1A1VA 2E87A 2F48A 3UAYA 3OTIA 4KNVA 4B76A 1RW4A 2NO0A 1U2QA 1L0BA 1S1CA 4DLYA 3IO3A 4OM8A 4IIGA 1RVV1 1SEPA 1SEVA 2BZ1A 1CZKA 2Z2KA 3CPJB 4Q9IA 4X8LA 4CDNA 4TROA 5CFZA 5KC8A 3N2GB 3BS4A 1E9CA 1IH8A 3K9CA 3PB3A 1Z6QA 1S2DA 1GXSA 4UAGA 3S4YA 1DG9A 1AMNA 3CIOA 3QV1A 4WLOA 3UFXA 1SXJB 2D0PB 2WPNA 5JW6A 1JHUA 5LYYA 1VA4A 2R1VB 2WHRA 4C7XA 2AFHE 3IUBA 1LPOA 3OZAA 4BCDA 3DE5X 4TX1A 2X1LA 1WS6A 2ZBPA 1T2EA 3ZVLA 3LK7A 1DUVG 1BJTA 1TZJA 2D2VA 1G41A 1ZM7A 2FDXA 2ZS9A 3PQ5A 5FBWB 2F8TA 2DHEA 5IN4A 2E3JA 3F98A 1ZJZA 5JCOC 1IM2A 3BXFA 1CEQA 1JQEA 1P0QA 3KKEA 3LKVA 3QYFA 1HDGO 2WFAA 2H1LA 1HC7A 2LPMA 1J2UA 3CLRC 4J43A 2OLEA 4R8KA 1ENOA 3R3WA 4IKEA 4ASUD 4BUCA 4EARA 2NYVA 5DCUA 1RI3A 2EDCA 4OVKA 3UJCA 1T3GA 4J2HA 1YQ9A 1PRYA 2B8NA 4UREA 2CHVA 4WKGA 5JC8A 4I1VA 2VOEA 1PG5A 3EIFA 3JVDA 1T8RA 3IOCA 4RVGA 3B1KA 5BVGB 1YHNA 2PJRA 1P1RA 2BFNA 5J4KA 3RADC 4RJJA 3SLGA 5EJIA 4P7JA 1U7ZA 5TVGA 4KIGA 2V5AA 3ECSA 4XB6B 3LX4A 3V1NA 3BXEA 1BU8A 1QE0A 3DDCA 3HWRA 3LCMA 4D80A 4IGEA 1I4EB 1UBCA 2CDNA 1USGA 4ZOLA 1E9DA 1YZQA 5AOBA 4DILA 4BX0A 5BY2A 1DIBA 3DMRA 4MS1B 4U5XA 2Z09A 1FFWA 3OY2A 2G6BA 1FX1A 4YRNA 3AP2A 3DCIA 2AI1A 2B1JA 3E7FA 3THWA 3IXLA 1M2JA 2Y9MB 4JQCA 3DKKA 3RQIA 3UAVA 3PGLA 2FN9A 1OLSA 4N18A 2H6EA 3UGQA 1GTG1 3Q7RA 5CDFA 3W8NA 1E6MA 1OX4A 1WSBA 2WTUA 3ZGZA 4QTYA 4EY4A 3ZE1B 2O8VA 4WA7A 4WJLA 3P0RA 3VH3A 3ITDA 1JKIA 4OF4A 2Q49A 3P8ZA 3NOOA 1FJGB 1I6LA 1NXQA 1PR0A 3OIWA 4A1OA 5DEOA 4ZV7A 3GFOA 1D2RA 4I9UA 1DAIA 2BSAA 5ALEA 5L8VA 2WQ6A 5GY7A 1LGYA 4IVQA 1OB5A 3K8YA 3ZZ1A 3OETA 5T8KA 3U80A 4F1WA 2P9YA 3CRMA 4JDPA 4BNHA 4IIJB 5I4IA 4ME6A 2R5FA 1NP3A 3DLBA 2H18A 1U2RA 5IJ9B 1EGMB 2VDNB 2P65A 2IYXA 1G2OA 1TFUA 5JBNA 2YXLA 2Z1MA 4EJFA 1JPVA 3H8JA 2VHJA 4D8UA 2PMCA 1IZ7A 3ZHZA 4H1TA 5BSKA 4I55A 4OEHA 1ABBA 1QFSA 2OCLA 3NWJA 3RYTC 4ABTA 2BPOA 4RSHA 4B8WA 3TL6A 1JNXX 2WTXA 5AFSA 1KKUA 5EIEA 3V7WA 4HAIA 4ZVVA 5LPNA 4JB0A 2ALJA 2JCVA 4G0VA 4YLGA 2OORC 4B31A 1P1KA 4XCVA 3B3FA 5IBRA 1EPUA 4GT1A 4J0DA 1WV1A 5J2TA 1Z6YA 2Q5CA 3LQYA 4L1KA 5JVDB 2XB8A 3D4LA 1FRQA 1Q1ZA 3NQ41 4M8IA 2EFHB 3GJ7A 5I5GA 4HRVA 1Y3FE 1O8CA 5K6RA 1I3MA 2CBGA 3WMRA 3QE2A 1SUPA 4XYGA 1JHZA 1GPLA 1HH4A 4Z9FA 3UHFA 5B3LA 5ICCA 1F0KA 3GYBA 1ZGAA 1KC1A 3JW8A 1U8UA 1GR1A 3MQ4A 1MAWA 1GD1O 2QJTA 3OURA 4O0LA 3GGPA 1PO7A 4B6QA 1NTOA 1CEXA 1XRLA 3IT3A 2VH2A 3OU7A 4YRPA 3UO8B 1KBOA 1N3YA 2J3DA 4RY0A 2ZCVA 3CWCA 3PG5A 1M2GA 2OHFA 1FXSA 1P80A 1KZ1A 2CWWA 2ZB7A 2ZRIA 3AONB 3NEAA 4Y9UA 1L8QA 2YNMC 5JQGB 1NVMB 2WYUA 2VUTA 1XDDA 3KJXA 5IDXA