1VE0A

Crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
MKIISKEFTVKTRSRFDSIDITEQVSEAIKGINNGIAHVIVKHTTCAIIINEAESGLMKDFLNWAKKLVPPDGEFEHNIIDNNGHAHVISAIIGNSRVVPIIEGKLDLGTWQRIILLEFDGPRTRTVLVKSMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the uncharacterized protein ST2072 from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Metal binding protein
molecule keywords hypothetical protein (ST2072)
total genus 32
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1ve0A00
1VMJA 1VE0A 2P6HA 1VMHA 1VPHA 2P6CA 1XBFA 2CU5A 1VMFA
chains in the Genus database with same CATH superfamily
2ZPXA 1QXPA 2ZX4A 5FPVA 1RUJ2 1BK0A 4JAAA 4HVQA 5KXEA 3TB0A 2WDBA 5IVCA 4AEDB 1ULOA 1CZTA 5K0UB 4L92A 4ET7A 4IW3A 2VMHA 2ZEZA 4P5HA 2CSGA 1PVC2 3RJRA 3O1PA 2NP0A 5T5OA 1X50A 3BOPA 3HN3A 4KU7A 2VXJA 1ZZ6A 1EUUA 3EHKA 1W8OA 4UAPA 3SC7X 2OUHA 4XYXA 3GF6A 3VDDB 3WF4A 4CPBD 3PLQA 1Y3TA 4YM1A 3ZN5A 1W06A 1DQ0A 1UZWA 1DIWA 4N90A 2PHLA 4R9BA 3SEEA 2BVVA 2J1VA 2RS11 2HBUA 4NIGA 4Y24A 1UL9A 4Q8LA 1UU4A 4FOVA 2ZGLA 1ZNPA 2ADEA 4OUSA 3ZFGB 1T6GC 3MEPA 4UW3A 4D8MA 5ACA2 2Q8OA 2FD8A 1YQ8A 4RS5B 4NIDA 1DP0A 3M2MA 1GZTA 3FUQA 5ACA3 4IV1A 1YFXA 1W9SA 4A6OA 4MYEA 1UY4A 5I8SA 2W91A 1EP0A 3WDWA 2H0BA 5ISLA 1FMD1 1N1VA 2IVIB 3VBOA 1UOBA 2KD7A 3SEPA 2ZHNA 3NRUA 3VDDA 2CDOA 3LOBA 3JXSA 4AGGA 1RXGA 2R042 1V9U1 3WP6A 3ZFEA 3LB9A 3GYDA 3C7FA 1S0JA 5IVVA 4KH9A 3O1TA 2E33A 4JX0A 2A3WA 4XJ8A 5C71A 3EQEA 4QPGA 1PIV1 3ZFGA 2Z79A 3WVJA 3GHNA 4IL7A 4JKMA 1G9AA 4YPJA 1GSLA 5HCBA 3SHRA 1QJY2 4CPBA 4IEPA 3DYPA 4EWAA 1ASJ1 2BTVC 3ZFFC 2OW4A 4Y5Z0 3UNPA 3ACFA 3FWEA 2R073 1VIWB 3OSDA 4TYSA 4BCUA 3ZYFA 4LBMA 4QQ2A 3RDIA 3WNKA 5KWRA 2E7TA 5CFCC 1ND2C 4DUXA 2Y8KA 4NVPA 2BU9A 5LK5A 4CCOA 3WCRA 5FZDA 2WS91 4MSVA 5IFPA 3WDYA 4BXFA 3DGTA 1NZIA 1LHWA 1LJ7A 1L7RA 1RHI3 3PNAA 1WW7A 4F8AA 2YB7A 1POV1 5F37A 3R0RA 5FO8B 1JZ7A 2O8OA 3MW4A 2VNVA 3OD4A 4ZXEA 1LOGA 2B42B 2HWB2 3HBKA 2YUEA 3MGUA 4FI9A 4W6WA 5AVPA 1NT0A 2F6BA 2IWGB 3SNMA 3X29B 3GZEA 3HR9A 3BTXA 1WGPA 4XABA 4I2OA 5IFTA 1IS5A 3I7DA 4LR4A 3I59A 3G6JB 3UGGA 4Q4W3 4BE3A 5HCAA 1YC61 2WSUA 3WG2A 2DCTA 2D93A 2BEOA 4XDPA 2TUNA 3GZUC 3B01A 5HXMA 3J7LA 2C1FA 1RC6A 3I2DA 4Y5TA 1O4TA 2NYYA 4MH0E 4LNVA 2PELA 2WNVA 4Y1ZA 1RUD1 5DDJ1 2WNUA 3R4SA 5JUVA 5I91A 4CCEA 1QDCA 1D4M1 1Z0HA 2WC2A 3JB8A 4LBNA 2W39A 4TXWA 2YGLA 3MFAA 1K42A 2NQYA 4BLIA 1GZCA 4MO3M 3KT1A 4YZ3A 3AP4A 5A7WB 3HVDA 3KT4A 3RZLA 3HT2A 4QQOA 4NPMA 4FP3A 3CKHA 1UXXX 2WZEA 5I0DA 3ZO0B 5L7OC 2EIDA 2HWB3 1MACA 1W6QA 1XSQA 2ZHLA 3OOXA 4MLOA 5FKBA 1QJX2 2HWE2 4AFMA 3DEMA 1WWYA 2QQLA 4B4QA 4B4PA 3ZXEA 1JOJA 4YVSB 3SH3A 3BB6A 3GDBA 1RUC2 3HIFA 2D6NA 3ZYGA 4Y20A 2VZPA 1O8PA 1S0FA 4UBGA 5FYYA 3VBUB 3RZMA 2K46A 3OPZA 4G4FA 4MADA 3LAGA 4UT5A 2DDUA 2Q30A 2BFUS 4Q4X2 4LBJA 3J9SA 4U2AA 2Y6JA 4XE9A 5A3TA 4XVHA 3T30A 2X53S 3AP9A 3J7NA 4UFHA 1T6BX 4E4DX 2LTNA 2VAUA 3VZNA 1GV9A 3Q8BA 1XJAA 4GALA 2YC2A 4QGNA 4XIKA 3NAPA 5IK5A 2J7MA 4WM7C 3C7GA 2ZOEB 3HWJA 1FPN3 4CZSA 2JDUA 5C3OA 1PO11 4C1WA 4AE2A 3CO2A 1D0GA 1XU1A 2PA7A 3EJKA 1N1YA 4LJHA 2GALA 2QBXA 1R64A 5IAXA 4IQPA 2JDAA 1POV3 2P3JA 3FFZA 3N9MA 3WF2A 3CZJA 1VP6A 4CDQC 4URTA 4B8EA 4OHYA 2H6BA 3TYJA 3O1VA 3O7OA 3LF7A 3NJZA 4OUEA 3L2HA 4CXXA 1WLDA 5HCFA 1DZQA 3FE5A 1PZ9A 3KCXA 2MEV3 1KDMA 5KHHA 5EYYA 2ZMNA 3KSCA 4CCDA 4M3CB 1NXD1 4C8DA 3OEAA 2UWBA 3BALA 3NAPB 1VBE1 3MV11 4WM8C 3UGHA 2YXSA 3WNNA 5EHDA 3IPVB 4O7XA 4X6RB 4Y3OA 3RRDA 4FBFA 3IAQA 1VR3A 2DCJA 1CAUA 3IDAA 3JUUA 5LBCA 5I0SA 3JD72 4LTAA 4HLTA 4URAA 4N53B 2BV4A 4OCTA 1H8TB 4EE2A 2C24A 2RVAA 3NO8A 5KBFA 2AC1A 3S0MA 1AXZA 1TVGA 2E51A 4AI8A 4OI0A 1PGL1 2WRAA 4UW4A 4NRQA 4JRLA 4HN0A 2W1WA 5C8CB 1HKDA 1SG3A 3LCPA 1V70A 1E5RA 3URFA 1LB2A 1GU3A 3RWNA 1FYUA 5FMCA 4A45A 2GDFA 3OY8B 5JLVA 1V9U3 1Q43A 1Q8VA 1FMD3 4OZOA 3SISA 1H0BA 4GMP1 2K9ZA 2IXCA 1TMF1 2EXHA 3VHPA 5A1LA 2VUAA 4FFHA 2LALA 1SMVA 2WT2A 4LPLA 3H50A 4XBQA 5BNNC 5K4LA 1JH5A 2EF6A 3E5QA 1AJOA 4N9HA 3K51A 3WUCA 4BQWA 4NR1A 1AR83 3NMBA 1J58A 3BODA 4W65A 3MFCA 3NNFA 4M4RA 1HRI1 4NAMA 4PI2A 1ULDA 4XF0A 2FDHA 4XCAA 2AH2A 2GC3A 2J1UA 2MEV2 3VLBB 5FPXA 5KXCA 3I2OA 2DUPA 3KGLA 2UYBA 3ZPYA 5D8AC 2TNFA 1ZZBA 4DXRA 2DUQA 2J1TA 1JYNA 2FCUA 5A7PA 2ADDA 3RMXA 3HNMA 5FZHA 3M70A 5KC6A 2BNMA 4WZCA 3KQRA 1PZ8A 4N43C 3VBRB 3GBFA 4D6QA 1YLLA 4O61A 1F9KA 3M3OA 4OHVA 3UKNA 3ZM8A 1W6NA 2VU9A 5DQ0A 3ZSLA 4W6XA 4AI3A 4IEYA 5CA6A 1DLLA 5T3NA 3VBFC 5DMYA 3AYDA 1T2XA 2JDMA 3B3QE 3LA7A 1BEV3 3GZAA 5A33A 4TZDA 3LDBA 1ULGA 2RR13 4TLFA 4ASKA 5FQ0B 2DURA 1OD3A 2VMGA 4DIQA 4C0HA 4M0NA 4MXVA 2R041 2RS12 4BQXA 1R092 2XBO3 1IPJA 2BZDA 4XEZA 1G9FA 1OFNA 5CIRA 2CL2A 1IS4A 2WFF3 1WCKA 3PURA 4QXKA 3LPFA 3L2YA 4GMP0 2MEV1 2VZ3A 3KMHA 1QNYA 4COWA 2R49A 1UMHA 2K0GA 2OPWA 3IT8A 5C3SA 5JMOA 1AR92 3ZFFB 2ZEWA 2WIIB 3W20A 2QCSB 4YARA 4K1YA 1N1SA 2WQZC 3KD4A 3VBUC 3AC0A 4HVOA 3ZYBA 4MX3A 4CCJA 4Q29A 3E6CC 3NJXA 5F3IA 2XQRA 4GAZA 4HFSA 1BCXA 1E57A 2VM9A 3DN7A 4XOGA 3APBA 4DUWA 2JDHA 3IMMA 3N35A 3FHIB 3HNYM 4GQ7A 4AEJA 3JBG2 5C9AB 1MS4A 3O1UA 2QQIA 4UF0A 3VGIA 2Q0AA 2WINB 3UYJA 1V6NA 3RFRA 4L8QA 4W4ZA 1YFYA 5GZCA 2XMLA 5EV7A 1TMF3 1CESA 4MZUA 4V1PA 2VZ1A 2X29A 1QKQA 4YVWB 4JGZC 3O0WA 2AENA 1LGBA 4XQWA 1F8VA 2RS31 1UNBA 4GMP3 4AHYA 3VDBA 1YFWA 1KDKA 4C1XA 4XJAA 3DKWA 2A1XA 5BNPC 5IATA 3N4MA 5AFBA 4OLLA 5LZ6A 4J6GA 3LSEA 2WLPA 4RGGA 1HB1A 2QQMA 4QPIB 2Y64A 2YY1A 5AVAA 1IGOA 3IKWA 1QWRA 2GH8A 3AKTA 1YRZA 1QIQA 3J8F3 4L2NA 4IETA 5EPAA 1R093 4CU6A 1ZM1A 5C4WA 5BPXA 3TNPB 2XJVA 2R063 4LO5B 2B39A 3G7DA 2VOVA 1UQXA 5DUVA 4BH9A 3SCFA 4DXTA 4RGKA 4AFBA 1NE6A 1OC1A 2PN5A 3LKJA 5I0UA 3I4IA 2KM2A 5I8TA 4FAHA 1OURA 1MS5A 3OD0A 5EJZB 3T09A 2X10A 3C7OA 2A6WA 1RUG3 2FZ1A 1CX4A 2PLV3 2EICA 3IIIA 3MBWA 3TN92 2IXHA 4BDVB 1H1AA 2YDEA 3JCIA 4XILA 1L3JA 1RITA 1GNYA 1VAVA 3D0SA 3LZZA 5TSWA 3OB8A 4DZGA 3Q8AA 3S5QA 4DMIA 1AL23 3J8F1 1Q3EA 4NPLA 5BV6A 1QEXA 5JXIA 4ARYA 4ISRA 1JYXA 5F5IA 1CZVA 2GMEA 5A6ZA 2RJLA 4RQPA 4XFAA 4XJUA 3UKTA 4EYUA 1W9WA 1W0OA 2YU2A 3THDA 3VBRA 4CCCA 1O3SA 3ABZA 4META 4O9GA 3BU7A 1R083 5FZFA 3VKFC 4CEYC 1AUYA 1C57A 1QH7A 4Q0UA 1Z7S1 3CIHA 3POEA 1AR82 3LPGA 4CCLA 4E4SA 4FT8A 1OKOA 1ZX5A 3AZYA 1PIV3 1ST8A 4HKWA 2PMWB 1YEWA 3AZXA 2LRPA 3OBZA 5JOYA 4KMQA 3Q8FA 4XACA 1HJGA 3CJIB 3ACLA 3WF1A 5CFDA 4EZHA 2A7AA 1PO13 3AMNA 2D7FA 3KV6A 3LFMA 4NWWA 1K5MB 2ZA9A 3OUJA 3LDKA 5FZCA 5A3PA 2XJPA 4QAWA 1FOD1 2UU8A 3PVOA 1UMIA 5C5UA 1H4GA 5CISA 1LULA 5LATA 3POSA 3ETQA 4LULA 1Y9MA 4ZXKA 4ATEA 2DFCA 2XH6A 4I09A 4I02A 3H7JA 2WLQA 1OI6A 2E7AA 3T2OA 4NOTA 3FHAA 3PTYA 4QHOA 4R9CA 5DAQA 1QQP2 5G05L 4M4PA 3GXUA 4IXLA 1NCRA 4MXWB 1GP5A 2XONA 4EN8B 4K8FA 5KXBA 3W21A 2D3SA 3EO6A 3JD73 1OA3A 3MIGA 1NQDA 1XNKA 4OI1A 3N3HA 5JSOA 4Y5SA 1RUD2 4E27A 1YO8A 3JZVA 5A7QA 1RUNA 1AYM1 3VBOB 1AR61 2R7EB 2XBO2 5FPZA 1RINA 1X36A 2ZGSA 5CFDB 2BBVA 2R30A 4Z2WA 1NY71 4N7IA 3U14A 5A3NA 2GMPA 2GNMA 4YGBA 1TQ5A 3BPZA 3ZMNA 3NNGA 3GBWA 3VBSA 4RL7A 3ILNA 1V00A 3NNMA 4K21A 2BUKA 1ND3C 3AKPA 5FYUA 5L9BA 5HPOA 3MIDA 5FTTC 3MLKA 2HWD2 5H9RA 1C5HA 2WWJA 5T50A 1WW6A 3MDPA 3MIEA 5GZFA 1I5ZA 3KM5A 3NV4A 1VALA 4KWLA 4ZU7A 2B5HA 4HT1T 1CN1A 4UYBA 4XQ4A 4L9BA 4Y22A 1NCRB 3P3PA 3FBMA 2B8MA 3OEBA 4GWIA 4CP0A 1JMUB 1GUIA 2P6CA 4K3UA 3WW2A 3H8OA 5FK8A 1QOOA 4CEYA 2E26A 1XE7A 2HLEA 2V73A 3DKQA 2GH2A 1LGNA 1BMV2 1VJ2A 4YWAA 1HRV3 1ENXA 3HNBM 3GBGA 2RR11 2HEWF 4CCMA 2YHJA 5LBEA 3U75A 3PJYA 4I30A 4TSVA 1CWPA 2QFEA 3ES1A 3FHQA 4QPIC 4QXHA 4AQ6A 4IEZA 3MIHA 3UESA 1OPOA 5JPMB 3F2ZA 1JU4A 2AACA 4L0PA 4ASLA 3WNLA 1AR81 5A3LA 1OPMA 2BQPA 2VGDA 2GU9A 1CZSA 1XYPA 2J1RA 3KHBA 2PHXA 5FP7A 4YFZA 3V64A 1HIXA 4A4AA 3IIAA 4R8HA 2Y60A 4Z2AA 1RIRA 1RUC3 2AEYA 1ZBA1 4NROA 4P9XA 2FMYA 3WP5A 4B29A 1UYXA 2WZR2 1UOFA 2X09A 5A3UA 1RUF2 5EYXA 3OPWA 1NLQA 3JU9A 1MZEA 2ZXQA 2XJTA 5EWSA 5FZEA 1UYZA 4LLOA 4DNYA 5C9AC 2ZX2A 4XJWA 3WLUA 2RMU2 1I9RA 2V4AA 5HCHA 1FX5A 1XXNA 1RUI2 4JDNA 4PBPA 1O4YA 3WQ1A 2P17A 3LOIA 1VBD3 2ZGOA 4BQ3A 1UIKA 1NQJA 1C3HA 1O7FA 2OQ7A 5GALA 1H6XA 1C1FA 1AZDA 3I3BA 5FLHA 2AEZA 4BK5A 1VBA1 3PVBB 4WM8B 3SLIA 1E5HA 4PHZA 2XJUA 4YZ5A 3WCSA 1HN1A 4PF5A 3D4KA 2QJVA 1QH6A 1R091 1RUE1 1MZFA 2Q1ZB 1LNSA 5JZGC 1NXMA 3KWVA 4X8PA 3E5XA 2JG9A 3R4DB 4FCAA 1JODA 1UKRA 2JECA 2RS53 3TEXA 2UYAA 1G6NA 2P3IA 5L19A 4W8JA 1DQ6A 1PZ7A 2PFWA 3ILFA 2W68A 4Y33A 5JCTA 2PTMA 1VPHA 3T1MA 3SMHA 2PLV2 1OUSA 2C5DA 3KF5A 3T4HB 4RA0A 1LOBA 2PQSA 1S2EA 1US3A 3LQCA 4UBHA 3A7QA 3PJQA 4GB31 4XJZA 1SPPB 3O1SA 4XTPA 1AX2A 4KG8A 3LD8A 4P02B 1X9PA 3BIEA 5LY2A 2ZGUA 1YJKA 1HB2A 2RV9A 1DQ1A 3FMGA 1RXFA 4HSLA 1Y4WA 4EN9B 4W6YA 4CDWC 1AR71 1YQ2A 4RYDA 1I6XA 1FV3A 4IV3A 3M8LA 5FZ6A 1KITA 3WQBA 5FZGA 1U5ZA 4B7KA 3I3EA 1RTVA 1C8M1 1VBE2 5FY5A 4ZS2A 2P4EA 2VUJA 2W2IA 3MW3A 4FVVA 3S7EA 5F5CA 3B5LB 4AI2A 3USUB 5FOJB 1TME3 4G9SB 1W2TA 5LA9A 1YJLA 3O14A 3H1WA 2KR2A 1W6OA 4WVWA 4BPZA 3BPSA 2W08A 4Q8KA 2XJQA 3GJAA 1RMU2 1EY2A 3POIA 5E16A 2HWC3 1VRH3 2D43A 4QX0A 4Q27A 1AL0G 1R1A1 1KGYA 4JTOA 2HJIA 4EROA 4XMIA 1GOGA 3AXEA 3S5AA 1F5JA 3OGRA 3QCWA 2DV9A 4E2GA 1PX4A 3MF6A 2GC2A 1AJKA 1XU2A 2B45X 2R062 1A3KA 2N7GA 3S30A 5FZ4A 4QGLA 3POFA 4CUAA 5FXZA 1YI9A 2Z5WA 4MGQA 4HG6B 1WD4A 1GMMA 3IPVA 5C7GA 2VBBA 2Y33A 3FJSA 2Z4FA 1V6OA 4YG3A 1FT9A 1C28A 3DYMA 4FFGA 2ZGTA 4XIOA 4YGEA 2PHFA 4CP9A 1TME2 5BNNA 3CLPA 1U5YA 2QE3A 3OUIA 2YC0A 4LXLA 2FHRA 3P1IA 1PHMA 4RSUA 3K75B 4UFJA 1PMIA 3IDBB 5BXXA 3TWIA 2I2SA 1G86A 4OHXA 3VKMA 1SLCA 3UK9A 4K7JA 2VMCA 3OYWA 1CGPA 3WF3A 3ZYRA 1OOPA 1FXZA 5FP8A 1QOSA 1GOHA 2CWMA 1G8WA 2CV6A 5A3WA 4LA2A 4RHV1 3AP5A 3CHXA 4OZXA 1VBC1 4Y20B 4Y1XA 4NHXA 2EAKA 1X9TA 3I2FA 2ET1A 1EV11 1RUF1 2YFZA 5FR3A 3VUOA 1QQP1 1JXNA 1DDLA 5FK7A 5FREA 2WO1A 1LHUA 2BFUL 2P37A 3ECQA 3H1YA 4P9YA 3QBQA 5FIXA 3KQ4B 5JOZA 2OA2A 2YPDA 4RN5A 4A41A 1HRI3 3AVSA 1WW5A 2IC1A 3DCQA 1UPIA 3RZGA 4YG0A 1NY72 1W8NA 4PIYA 2HWF2 4GIQA 4JRAA 2D5FA 2KA3A 1B09A 1FPN2 4LO6B 2WQ8A 4BIOA 2CNAA 3DXUA 4AFCA 2JDPA 3B9CA 4LBOA 1W9YA 2FBEA 2JB4A 2ARBA 5FZ7A 4I01A 5AC91 5FYSA 2GNBA 4YZ4A 2R32A 1O91A 4N53A 4CDUC 1O5LA 1WMFA 2VBDA 1YCIA 1VMFA 2JG9C 3H3ZA 3THPA 1Q8QA 4XUOA 1OKQA 2C6SA 5AFEA 1XRUA 4PLNA 5C6CA 4LKDA 1WKYA 1OH4A 1ASJ3 3ZXFA 1SLLA 4OMCA 3A21A 3OCPA 5H9SA 1NCQB 4DFSA 4FTSA 2VE1A 3I2GA 3TRSB 3NNJA 3USUA 4HONA 3I54A 4CEWB 1OLMA 1W9TA 4DO0A 3N36A 4QXCA 3A0NA 5FMOL 5K8SA 2F4LA 1RMU1 2C26A 3NQHA 1JOPA 1W6OB 2G9FA 2C9KA 3FLTA 4GWNA 4HPKB 2ENRA 1ZYBA 1AYN1 5FPBA 1VB2A 5JXGA 2AUYA 1AVBA 5JOXA 4QB6A 1PNFA 1CAWA 1BMV1 1HV0A 2RS13 2ZGRA 1UIJA 5KR7A 2UWAA 3U4SA 2Y6GA 4RR3B 4R4XA 2VQ0A 4RGAA 5J09A 2WZR1 5FLJA 2YPJA 2JIGA 2H6CA 4P5YA 4LK7A 3K3NA 5FPLA 3ACHA 1YIPA 4HMZA 3WW4A 4ITCA 4CDWA 3V56A 3ZSMA 5A1FA 2G4IA 3PVNA 1CR7A 5DZFA 1I1EA 3VKLA 5FOBB 4RFRB 2XVLA 1FOD2 4YZ1A 2DCZA 1RUJ3 3OTFA 3U37A 5LK7B 4FOWA 2YBPA 4Q4Y3 5FYBA 4G3YC 3FX3A 2A3XA 4P9JA 2RR12 1ND2B 4GB32 2WNUC 2XWJB 5CKNA 2WNVC 5DUXA 1H9WA 2CGPA 4MGTA 4XFFA 2JD4A 1EAH2 4GB33 4W50A 2YG0A 1H2LA 1IKQA 2MPFA 5GZDA 3EBRA 4I0AA 2HH9A 1IOAA 2XUMA 1UXZA 3AFKA 3NV1A 1UF2C 2IXIA 4YW7A 1CQ9A 1W04A 2JG8B 4GWMA 4PLOA 4BWOA 2XJSA 2E32A 3WW1A 4AVAA 1PMHX 4DXZA 4M00A 3WNOA 3PU8A 3O1OA 3AMQA 4NMIA 1M4WA 3WDXA 4AZZA 1AYM3 1LESA 1QJU2 4DEQA 1BLZA 3ATGA 1XNDA 3C7EA 1SACA 3V0AA 5FQ0A 1UOGA 2BRTA 1DLCA 2XJRA 1WA6X 4PIZA 5A3OA 1GNHA 4KU8A 4D7TA 3DECA 2BGPA 3POWA 3ST7A 5C9AA 2ZS6B 2UY8A 4AOCA 2D98A 2QQOA 5CFCA 2GNTA 3HMYA 1MS8A 1H6YA 1A6CA 3FLRA 3K4DA 4GKXA 5LA0A 3R05A 4LOTA 4AFDA 4Q2FA 2FMDA 4S2HA 1OQ1A 3Q8EA 5C3RA 1XOYA 3ZFFA 2QVSB 1RUH2 4AR2A 2IFRA 3D3AA 1STMA 2LROA 4JHTA 4BISA 2AZ5A 1VE0A 5FDBA 2A73B 4FQ4A 4RFT0 4QMAA 3RGBA 2V09A 4NN0A 3AB0A 4E2SA 3V0BB 3NKTA 4XCBA 3ZFGC 1XNBA 4LHSA 2OYZA 3KF3A 5IHRA 4WVMB 4B4RA 2Q5TA 1B35C 4H14A 5IVEA 1Y43B 3IWZA 3KB5A 1C8NA 1FNZA 4Y1UA 1D4M3 2AYHA 2P2KA 2JE7A 2PHDA 4K8RB 4LBQB 4QPIA 1G9DA 3U1XA 4H2AA 1C4RA 2L9LA 2VOKA 2YZ4A 1K3IA 3WNMA 2DTWA 2ILMA 2VW0A 1JI6A 2VZUA 3AKSA 3FFQA 2RE9A 4HPKA 1QHDA 3VHNA 1OQDA 1XYOA 1SLIA 1PIV2 2UWCA 3VBRC 4UFMA 4LKEA 4RQPC 2NM1A 2Z42A 3NVCA 3NWKA 4Z92B 1WCDJ 3ZXLA 1S0CA 4XUQA 3LEMA 4ZU4A 1C8M2 4FXKB 1QY4A 2ZJCA 5LEKA 1RVF3 2VZQA 3AP6A 3DL3A 4EQVA 1LOAA 1V0AA 4QKFA 3TN91 2Q1FA 1HXS2 1B35A 2K2SA 2ZX3A 5BNPB 4XPVA 3M3QA 4LEJA 1D2SA 4B1MA 4HOOA 2ZTNA 3KCYA 5F2WA 3VL8A 3MUY1 2Q1MA 1D4VB 4AVCA 4RQPB 2BWCA 4LHNA 2FDFA 4COYA 2W9XA 2WS93 2J1SA 1H2MA 1PGW1 2XWBB 4QQHA 3AMMA 3P5BA 2WNOA 1JTZX 2Y6KA 2WT0A 4P00B 1O6UA 2QQVA 3PTRB 1RGSA 4JZRA 2AGSA 4QDQA 3SKVA 4KWUA 4CUCA 2BJSA 1VMHA 4DUVA 4AQ2A 2RDSA 3T0AA 1LHVA 4CU9A 2DU0A 3MV01 1UO9A 2W92A 3T0DA 3MF9A 4LBKA 4BXSV 4CP1A 3WNPA 4WZFA 1GP4A 1UCXA 5BNPA 4XF1A 3ON7A 3KVBA 3POJA 3J8F2 3LWCA 4OQ8A 4EN0A 1OFSA 1Q5OA 4AHWA 4EWEA 1WMXA 3B02A 2RG4A 4HETA 2VQUA 4NE9A 5FYIA 1IHMA 2VNRA 1W6MB 4INDA 4JGZA 5JI9A 3MI8A 5BUVA 3PDQA 2DBIA 1UZZA 5DDJ3 3SITA 2B9UA 3H8UA 3ZKUA 4GH4B 1LHNA 1NX9A 2WT1A 1SFYA 2VTXJ 2J1EA 1HW5A 3OGGA 4KBBA 4D94A 4QKNA 2XPJA 4DRVA 4YSFA 4KGQA 1GOFA 3S57A 1BBT2 4ASMB 3HJRA 2RMU3 2QQJA 4LE3A 1AR73 2XKPA 1P8JA 3T0BA 1GYKA 1W8FA 1S0IA 4YFWA 4J1XA 5FY7A 4DOUA 3O0XA 4JCKA 4R9DA 3RYRA 1DF0A 1BHGA 1UZ0A 4FXGB 2RDRA 2TEPA 4P9GA 1VBE3 4V2WA 4GXLA 1N3PA 2CYFA 4LHKA 4MXWA 5SV8A 1DG6A 1RHI1 3KZ4C 5HV0A 1OHFA 2VW1A 5FP4A 2BOJA 4IDZA 5CADA 4AYUA 5DZGA 1A8DA 2VL4A 1GZ9A 1REDA 2XLGA 5IAVA 3S6PA 1WA4A 2LS6A 1HXS1 3BYWA 4QHBA 2Q8CA 4GULA 1W8TA 3MPPG 2OS2A 1KJRA 2RM21 1RYYA 3D0JA 4JGYB 1UYPA 5FBJA 3WF0A 4BQ5A 4CE8A 4Z8BA 5LRSA 4ES8A 3M3IA 4QB2A 1G7YA 2VH9A 1W2UA 1IQDC 1BBT3 4YW5A 2JE9A 3RQ0A 1AYN2 4QDRA 4A42A 5GLUA 4HXCA 3MLLA 4N43A 2WNVB 3MHZA 4NIIA 3EB7A 2ZGNA 4LO8A 2W47A 3RMYA 3RNSA 1DGRN 4IV1B 4PJYA 1SPPA 3NW4A 1DYOA 5FV3A 2PYTA 2ZGMA 4HK8A 3MLJA 1GWKA 4XFIA 2RS33 1JN2P 3KV9A 4BJ0A 1FMD2 4F3JA 3T3YA 5GZEA 3RI9A 4IV3B 3U10A 2J22A 2R16A 5FZOB 1SZBA 4L97A 3WDTA 3LIHA 3N7LA 2XUEA 4CDUA 4Q4V3 2ZZQA 4LKFA 4N53C 1F15A 5FYHA 2XG3A 3C2UA 4XTMA 1CAXA 5FJHA 1PO12 2NZ9A 5JMCA 2SBAA 4MG2A 1VLNA 3IMNA 4H55A 3IZOA 3UT0A 2DU1A 4QHZA 4AQTA 3VBHB 4LLFA 5FXWA 3MPBA 2B46X 3GZTB 1EV13 4FO9A 4KWJA 4LUKA 3VBUA 2ZGKA 4QU1A 4GD4A 4NUBA 1OF4A 3NKGA 3AZVA 3PMEA 2D6KA 5DN2A 2EIBA 3UKVA 2WABA 1UZYA 1NAEA 4OI4A 1JBCA 4IEVA 4A3XA 4UI9L 4OVEA 5C8WA 1KD7A 3TEWA 1JUIA 1W3XA 5FZMA 2VC9A 5LASA 2BPA2 2YV8A 2YU1A 4IEWA 3TEZA 4IESA 1UY3A 3VDAA 2BGCA 2I74A 2VVEA 4JTNA 3I3DA 5APAA 4BMEA 4CVUA 4PIXA 1H30A 2ERFA 1CX1A 1SQ4A 4Q4Y1 3N7MA 5AC93 1O8SA 3LFIA 3GALA 3ZXJA 5K7PA 2NN8A 5IT6A 2WFF1 2FQPA 3IB3A 1UY1A 4CXWA 1JYWA 1HQNA 4BYYA 3KV5A 3J7HA 1DCSA 4WM8A 1Q8OA 1U0AA 2A75A 1OOPC 1UMZA 4Q4W2 4LUMA 5GKAC 5FZKA 2WAAA 3IDCB 3WNXA 4FPJA 4LT5A 4CXYA 1V6MA 5K9YA 4MGYE 3TEYA 4XQDA 2ARXA 2E7QA 4D0QA 3GCWA 4HN1A 4CDXB 3ZPOA 1PX3A 4CCKA 2RJKA 2W46A 3GGLA 2P3KA 3P6BA 2WR9A 1SCSA 2WYSA 5D8AA 1DGWA 5DAPA 4BHPA 1XYNA 1FPN1 4DQAA 4CDQA 4OHZA 1J1LA 4ONUA 4AXOA 1UWWA 1GNZA 2VUCA 1PNGA 2O14A 4B7EA 5FZ0A 2WNUB 2QQKA 3PMSA 5L9VA 4QDSA 4RHV3 5BNOC 3UL2A 1MEC3 3PUHA 2CGNA 5FY8A 3OF1A 3ZIXA 4KL1A 4UFLA 3M7AA 5F39A 5C70A 1SLAA 4BMBA 1D7PM 4WVZA 4E4HA 4PI0A 3BVCA 2F4PA 2WN3A 3VD7A 5LCWL 2PHRA 2VTXA 3I97A 1ODNA 4AL9A 5LY1A 2HWD3 4F7ZA 1O3TA 1TMF2 4YYOA 3ZXDA 4HSJA 5FPAA 2VULA 2W1UA 5D8AB 1RUOA 5BNQA 2W1SA 2XHKA 5DAVA 3AL6A 4GZ9A 3ZYJB 2D6LX 2YYOA 3BGAA 3WHTA 2PHWA 2FCVA 3Q8CA 1MS9A 2E6VA 4ORFA 4Z82A 2QZ2A 3R6SA 4FAGA 3KHCA 3PIGA 5FY4A 5GLWA 2EA7A 2DVGA 3KGZA 5IVJA 4IEOA 2DVBA 1DQ5A 5CG8A 4M3CF 3BIWE 5IVYA 4IV3C 1H1MA 1JW6A 4F83A 4YM3A 1VBC2 5I93A 3WEZA 2JG9B 3D82A 2BYVE 4QKBA 3FN9A 5FZOA 3N7JA 4XUNA 4E4ZA 2WFF2 5EJ3A 1CAXB 3RI8A 1GR3A 1EPZA 3JBG3 5JWPA 1YQ5A 2IUWA 5DG2A 1R1ZA 2D3RA 1O3QA 3VBHA 4XZPA 3FZ3A 4QPYA 4OMDA 2VW2A 1PM7A 4OYUA 4MUVA 1RVF1 3OGJA 1MS1A 3CEWA 2G1MA 3TN93 4AFAA 2VZOA 3AZWA 2JDNA 1UX7A 3HAGA 3ZR6A 1E5IA 1W6PB 2XLAA 1W9FA 3CZUA 4YGCA 3ILRA 5J98B 1AYM2 1QJU3 1QJY1 1ZRFA 2JWPA 3AK0A 2IXKA 4RR3A 3CL1A 4FPYA 5JZGA 2GC0A 1AX0A 3EYPA 4O65A 1H8VA 1NLRA 1W0PA 3POBA 4AVTA 1HXS3 3NAPC 1O3RA 1ZREA 3ZFEB 4IERA 4QQPA 4KGGA 3ZSJA 2ZKNA 5KXDA 2VNOA 2EAAA 3WP3A 2DF7A 3DPRB 1N47A 2WO7A 4NWVA 5A7OA 4KQ7A 3VL9A 1JZ5A 4K6BA 2A71A 2WS92 3HBZA 3ZXGA 4Y26A 3PUAA 4YM0A 1QJX3 2HWE3 4Q4X1 3ACIA 1RUI1 1OVSA 3WT3A 4BZ4A 3HD8B 3NNLA 4B3NA 1ND2A 2NMOA 4ZZ8A 1JYTA 4EJRA 4Y1YA 3K48A 5FZ8A 2RS51 4LBQD 4LITA 4AWDA 3UETA 5T5LA 2VVDA 3M3CA 4I0BA 5T54A 1KEXA 4XC9A 3HPNA 2DCKA 3N9QA 2VOXA 4UF0B 5JPNB 3TBDA 4XZUG 4MGZE 5JXHA 2VO5A 2EVXA 2VQTA 5F3EA 2JKBA 3UJQA 3INAA 1DZTA 5IK4A 2PQQA 1GWLA 5JIUA 1W39A 2XLFA 1W2AX 3RJ2X 2Y38A 5CB7A 4CSWA 1N3OA 2CU5A 1OVPA 4XF9A 5E88A 2VPVA 4OQ9A 2CGOA 4QT6A 4CYDA 3N7KA 5DDJ2 2WBKA 2PHUA 4AG4A 4E8CA 3PHMA 5JAXA 5HBAA 2GNDA 4HBNA 1X8MA 3VDDC 4HKLA 4BB3A 3T2PA 1TZOA 3AJYA 1W0NA 2WJSA 3THCA 2OVUA 3RYKA 1MVEA 1OLQA 1GQPA 1OUXA 5A6XA 3HQUA 1W8ZA 5KHKA 1NCQA 4BU2A 4HVRA 4JQTA 4IV1C 2HEVF 4IE0A 1J84A 4Q0SA 4C90A 4CEWA 3AFGA 3SCGA 2Y26A 4IEQA 1LEDA 2I45A 5HI0A 2WKKA 1OA4A 3T2QA 4PQQA 1GANA 1DYPA 2XL7A 3JD71 1IPSA 2OX0A 3QH6A 2R0HA 3T1LA 3QOPA 2E31A 4NIHA 1H8TA 3WHUA 1ND3A 1YQCA 1ULFA 2E53A 3VBSC 4DB5A 2OPKA 3HT1A 1I3HA 3VZOA 1SEFA 1NUKA 5A7NA 4BIFA 1BVVA 1DHKB 5ABJB 4MV2A 1G9CA 4PF1A 3ZSEA 2XBO1 2WN2A 5L9RA 4COZA 4NHKA 1R1A2 4NHMA 1MQTC 5EFUA 1NCRC 2W94A 3BTAA 4S2FA 4JHZA 1S2BA 5CKQA 1VBD1 1HJFA 3W5MA 1V6JA 4LIVA 2PLV1 1FNYA 5IK8A 2ARCA 1BEV2 2EXJA 3D8CA 4Q0QA 1H9PA 4RD7A 3ZVXA 1MS3A 1SFNA 3T2TA 3NL1A 4MVTA 2UURA 5BNOB 2HYXA 5FZ1A 3SH5A 1X33A 5FLIA 3VD9A 1VBA3 5CFDC 2A6YA 1OD5A 1EAH3 5JZGB 3M4FA 1IZ3A 1B35B 2QUOA 2DBNA 5IJRA 3VB9A 5D2AA 4PCRA 4R4ZA 4XMAA 4Z1VA 4GH4C 5ANQA 3KT7A 3RYPA 3U11A 2YROA 4UFIA 5CYYA 1HLCA 1UZVA 5CVRA 2YGMA 5EP9A 3VHRA 4ARXA 3VBOC 3BTYA 1W8HA 2B9VA 4XXPA 1IPKA 2O8QA 1ENRA 4Q0VA 1BVP1 1LOEA 1RUI3 1W6NB 1O4ZA 1FAYA 4D3WA 5B4NA 1Z78A 3Q9OA 3VN4A 1NLSA 1JHJA 5CG9A 1RUH1 1GFF2 5F7UA 1XBFA 1WUVA 1QF3A 2W1QA 4YVSC 1CAWB 2XL9A 1GBGA 1QDOA 5FP9A 5FP3A 4ES9A 4OUMA 2DWRA 1AF9A 2A6ZA 4KNCA 1HQWA 1ZBA2 2R1BA 2ATFA 3JB4C 4M3CA 4CUGA 3ME2A 2AR6A 2D6MA 1JZ2A 4DEVA 1BZWA 1CJPA 3F95A 3E5UA 1ZBA3 2W87A 2YBSA 4I0WB 1OLME 4FQZA 3M1HA 5B4XA 2VG9A 5A7SA 2HBTA 3O1RA 1PO21 1VBD2 1LGCA 2V5YA 3CJIC 2Q8DA 5DUWA 2XOMA 1S4CA 1YIFA 1J83A 5F5AA 1U12A 1JZ6A 1QU0A 5I0RA 1QXJA 3T4VA 3CMGA 5LBBA 1K12A 2PXJA 1WMDA 3I2JA 4LHLA 2PAEA 1DGRA 5F8PA 5C4WC 1FATA 3RZHA 1ASJ2 5EQUA 1KFUL 3PUIA 4QU2A 1JZ4A 1W05A 3ASIA 1RUG2 4E8DA 5C8CA 4FFIA 4CRQA 2SLIA 1AR63 5B2GB 2R1DA 5FY9A 1H2KA 3RG0A 3NSTA 2VQAA 3GCXA 5FY0A 3WOGA 2A70A 4AI1A 2OZ6A 3AZZA 2H0VA 3BTZA 1PGSA 4ZHNA 1PK6B 3K4AA 1HX6A 1CIYA 2QZ3A 4D7YA 1SCRA 1J59A 4V2VA 3R4UA 3BCWA 3BN6A 4SBVA 5J36A 2LM3A 4UFKA 1OXCA 1XNAA 1PGW2 2XB6C 5H9QA 3ZYIB 4M01A 4AI0A 2ZX1A 2ETEA 3IAPA 5FYZA 1Y9GA 3UV9A 5JR2A 3WG4A 1KQRA 3BOWA 4AEDC 4R9AA 1OSGA 1COV2 1VBB2 3VZLA 3N9PA 3HN1A 4Q4X3 3IN9A 3UGFA 4UW6A 3VD4A 5LB6A 1OH3A 3B00A 3J26N 4FPGA 1NZCA 2HWF3 5EJ1B 4QGMA 3E6DA 4L11A 4BLJA 4N9IA 1FOD3 2WWUA 5C4WB 3HQXA 4J25A 5FZ3A 2V4VA 1K45A 1SHWB 2O0OA 1U5XA 4CDXC 4U36A 2D97A 2ZKLA 5J96B 1BBT1 3H7YA 5J37A 3AYEA 4MOAA 1DQ2A 1S2KA 5FZBA 1POQA 3TNQA 4FSJA 1XNCA 4NIAA 3K4ZA 3PUQA 3ALQA 5AC92 2RM22 3E6BA 5K0UA 1RUE2 3B7MA 5FY1A 2XXZA 1ZA4A 2R6QA 4Q1RA 3MYXA 3W58A 1JUHA 1K5MC 1V9U2 2JE8A 1ACCA 2OUJA 3EXUA 2HWC1 4WVMA 2IXLA 3N9LA 2B7YA 3QH7A 4XDOA 1DGLA 4CCNA 4OFGA 1V6LA 4UWDA 5I0TA 1QJU1 4HKOA 5FBZA 2VCAA 4BQ2A 2D5HA 4UXAA 3BI3A 4CDQB 5C3QA 4XFHA 4FPOB 4ZKTB 4XHXA 1J3PA 1ZZ8A 4CDUB 5FMBA 2QQPA 1APNA 3RSJA 2J42A 4QB1A 3VBFA 3ZSKA 3MW2A 2VZRA 3LGRA 5E6HA 1W8WA 1Z7S3 2JG8C 1UYYA 4ZPIA 3K3OA 4RS5A 3WD5A 5M0TA 1OQEA 1ULEA 1UY2A 3LA3A 3VZMA 1CAVA 5F32A 1LKNA 1R082 1QNWA 3CJXA 2RS32 3FC0A 1YQ6A 2ORXA 1YNAA 2VXRA 3BUCA 2BERA 2BGOA 1J3QA 2JDYA 2BNOA 3OBRA 4OI2A 1MZ5A 2ID4A 4EN7B 4FPCA 4YW3A 1XB9A 2Y34A 4TLGA 5D1IA 5E1RA 3ZDSA 3W5NA 1AL22 2DUOA 1D2QA 4YRDA 3LEGA 4S2GA 2QQNA 4YW1A 3I8TA 4JQRA 1WLTA 2VZVA 3M3EA 3U0ZA 4LK6A 3AMPA 4QPGB 2XR4A 3ZN4A 2ZGPA 3HOBA 3VKOA 3H8RA 1DQ4A 1F4AA 1N1TA 3GM8A 5BYNA 1JOBA 1LR5A 1LU1A 3AJZA 2WAOA 4OHWA 4QWNA 4XF3A 4AEMA 2C4XA 4XURA 2XKOA 2BDRA 5FUNA 4FPEA 3ZXKA 2B4KA 1EAH1 4NHLA 1QMJA 1TNFA 4D6SA 4PT6A 3DF0A 2F17A 1R1A3 3QLQA 5CAZA 3PVEA 1LENA 3J4UH 2X5IB 3AX4A 1OA2A 4UW5A 1PK6A 1KS5A 3QD6A 4JGYC 1AR91 2JX9A 4PDWC 1A34A 5GZGA 2DFBA 1LCLA 4QXBA 5FZLA 4CTEA 5ABJC 3LA2A 1D0HA 2Y0IA 1HRI2 3LSDA 5A80A 2OKXA 4JGZB 1SDDB 2OXBA 1J1TA 1VRBA 4PBOA 1YFUA 4AEDA 1ULCA 2QTWB 4ZS3A 5BY5A 2ZMLA 5C5TA 5F3CA 2NPIA 1LOFC 1YXWA 2XVKA 1AXYA 3DYOA 4OULA 5FRAA 5LA2A 4R52A 3LEKA 4CP9B 3ETPA 2QQWA 1CD3G 1QOTA 1Q8SA 2GSYA 2Y6LA 4P9LA 4AVSA 4WBBA 5BNNB 4YGDA 1HQLA 1NA1C 3LIGA 5CKMA 3KV4A 5T52A 3PU3A 3ROUA 4GA9A 4IGOA 5J48A 1ENQA 2C0ZA 4LMFA 3ZYPA 2ZAAA 2W5FA 2RS52 3OYWB 4QQLA 2GC1A 4MHRA 2PHTA 5FXVA 4LO7A 4FTEA 3DXTA 5E8AA 1EUTA 1RHI2 4FTBA 5C8CC 4A6SA 5A32B 1S0GA 1IS3A 2WQ4A 1REEA 1XPWA 3OJBA 1CIWA 2XHNA 3ORJA 4A44A 1RMU3 2YMZA 1X82A 3LDRA 2Y0OA 2HWC2 4XW3A 1URXA 1WCQA 2ZZJA 1S0BA 2CWSA 3B94A 4WM7A 1NYWA 5JI7A 3S7IA 5KHJA 3CJIA 1PVXA 1C1LA 2QDNA 5DXDA 5JIAA 3ZYHA 2ZABA 1ODMA 4NHYA 4QD2A 4L99A 4C91A 1HN0A 5JR7B 3OGVA 2JENA 4DY5A 1CJDA 3CU7A 1F35A 3RPQA 3ZMOA 1MZ6A 5EXOA 4XUTA 2O1QA 3THTA 1BEV1 2WZR3 2Z2SB 4KI5M 4QX5A 5EZWA 1IS6A 5FUIA 3RVHA 1UPSA 2WO2A 4YVSA 5L36A 4N43B 3NV2A 3RZZA 1NE4A 2P1BA 5FMDA 2ZACA 1PGL2 4C0BA 1UOJA 1XC6A 5DAXA 3K77A 1CAVB 1XE8A 5FZIA 1HDKA 3O12A 3KVAA 3RWKX 4Z07A 1CVNA 1OBNA 1ZBE3 2D3PA 2CAUA 1WLWA 2QKDA 1N3QA 3B93A 4MGIE 4DY3A 5L7OA 2OZJA 2RMU1 1MQTB 3D5OA 1ZBE2 1RB8G 1ALYA 4FFFA 1KRIA 5FZ9A 3ZLIA 2RHPA 1TEIA 3CNAA 1XQNA 4P14A 2ARAA 4FPLA 5FO9B 4AAPA 4IEUA 1RUH3 1TE1B 1HRV1 1VMJA 2GN7A 2ZCWA 4GJYA 4AHZA 1LU2A 1WMEA 3B69A 4X8NA 4XF4A 1IQAA 5T5JA 2ZHMA 1NKGA 1YWKA 2JIJA 1O5UA 2VUDA 3H0OA 4E9KA 5F6LB 4BQ1A 1DU3D 1KFXL 2ZEXA 3BKZA 2FDIA 4A7YA 4KBZA 1WBFA 2RM23 3E1F1 3ZIWA 5JDBA 2HKXA 1X7NA 2CTVA 2LUWA 2VCMA 2VZTA 1AR62 3MUZ1 3HQRA 3TAYA 4CUBA 2P5BA 5L7OB 5A6QA 1E5SA 1MQTA 1RVF2 4AAXA 5A70A 4LBLA 4J1WA 1W28A 2DYCA 2DVFA 2X5IA 3ENRA 4P08A 1PO22 1QJFA 2BVBA 3POGA 4HZFA 2LW8A 3JQXA 3WQ0A 2VCBA 1W90A 4I3PA 5KHGA 1KS4A 1ZRRA 4JC1A 3PUSA 3VKNA 3H42B 1ZA7A 3T08A 2GAUA 1RUD3 4A7ZA 2A5ZA 1RUG1 1H8TC 4K40A 1QGLA 1YI7A 3I49A 3AXDA 2ZMKA 1EV12 4X6QB 1QQP3 2WWSA 3LEIA 5A7WA 2QDRA 3VHOA 2X5IC 4WVVA 4COVA 1RUE3 4AHXA 1O59A 4BA6A 4H7LA 2VVFA 4XUPA 1OMIA 2V72A 2ZEYA 4MGKE 4CEWC 2G9ZA 2W52A 2R0FA 5SV5A 2ORZA 3AP7A 4JKKA 1HB4A 3NJVA 4GWJA 3AL5A 3NV3A 4ISQA 4TN7A 1NCQC 2VMIA 2JB8A 2XDVA 3OBTA 3RS6A 5LEJA 4ZU5A 5FWEA 3MZHA 4JV4A 3H3LA 5A32A 4YG6A 3AM2A 3DPRA 4AW7A 5HXVA 4QPGC 3C3VA 4H7MA 3PIJA 5J1XA 4AEKA 2G19A 2QNKA 4ZZ5A 1JZ3A 1CONA 5FYVA 1AX1A 2UY9A 4LE4A 3WV6A 3JQWA 4P9WA 3MO4A 1F5FA 1LTEA 4WM7B 3USSA 3ZFEC 1U5IA 1W6PA 2DTYA 4QM8A 4D6RA 2WFPA 4EN6B 5FJKA 1ZBE1 1VBA2 3DPRC 5A6YA 1JYVA 1FV2A 1IG0A 1W2NA 1COV3 1VBB3 4Y1VA 2JXAA 3I59B 5GJ6A 5FYTA 5GLTA 5FYMA 5DAWA 1C8M3 3OUHA 2GMMA 4AGVA 5CFCB 4XBLA 1OOPB 4DS0A 3I3QA 4K1ZA 3O0VA 1DFQA 4ZY9A 4DRRA 5DABA 1ONAA 1TME1 2P3YA 3A0KA 5G04L 3I3MA 4YZ2A 5KHIA 2VR4A 3UJOA 3KS7A 5F2SA 2EALA 5JVVA 4LA3A 1UKGA 3LE0A 2NMNA 4H3WA 3WW3A 5JSPA 1QJX1 2HWE1 1W03A 2WA4A 1PMJX 1GLHA 1NG0A 1ZZCA 5FKCA 1S0DA 2GP5A 4ATFA 4PQ9A 1J3RA 3AYCA 3ES4A 1GKBA 4P9IA 1OF3A 5C33A 3VDCA 5F9TA 1NA1B 1VAMA 2A6VA 2WZ8A 3QACA 4NO4A 3WX5A 3OPTA 2VMFA 1YHFA 2VY0A 2VZSA 4XDQA 4LBQA 1W6QB 5FUPA 5CNAA 3VZKA 2VOTA 4BQYA 2DVAA 1AR72 1SDWA 2JDKA 2VD7A 4XBNA 4RR3C 4Q4Y2 5ERLA 1OLRA 1POV0 2ZX0A 4QPWA 1HB3A 1LECA 4IE5A 3WXPA 2JD9A 1ZZ9A 1UU6A 1CAUB 3WR0A 4A3ZA 1HV1A 2VMDA 1CPMA 3H8XA 3E97A 4XXAA 5FXXA 1LEMA 1RJ8A 4JVAA 1RUJ1 4XHBA 5DPNA 5IVFA 5F6KA 4NRPA 1MPXA 2IVJA 5IW0A 4JDOA 2V5DA 3VBHC 1HRV2 4CU8A 4IUGA 4QX1A 1NA1A 5F3GA 3MIFA 3WG1A 3WSOA 3ITQA 4Q0PA 5L73A 3WINE 3W59A 1DBNA 1WBLA 5FCCA 3OGSA 5HV4A 4JKLA 1ZZ7A 5FAXA 5IWFA 1LOFA 3GJBA 5DG1A 1V6IA 4XJ9A 1AR93 2W3JA 4QKDA 3U78A 2GZWA 4Q4V1 2PAKA 1MR5A 2BWAA 2KXLA 1RUC1 3K46A 1AYN3 4LOSA 2J1AA 2A3YA 1PVC1 3VD5A 1ND3B 4YNIA 2IXJA 2VJXA 3P3NA 4XFBA 1PK6C 3O1MA 4AK3A 3V0AB 4EWDA 3SCHA 1TG7A 2MHFA 1ENSA 5FO7B 2OIIA 1EPWA 2FDGA 2BNNA 5A1AA 2A6XA 3CDZB 3CBNA 2QQUA 3ZN6B 5CZKA 5IK7A 3AKRA 1WD3A 4TWTA 5CU1A 4LQRA 1A8MA 1AXKA 1LRHA 2P34A 3KCCA 4BM8A 2Y6HA 1XNTA 1KJLA 3VZJA 4AVVA 1BXHA 2WSVA 4B1LA 3MIBA 1FI2A 2D40A 3ELNA 3A22A 4SLIA 2Q8EA 3TOJA 4DXSA 4EZ4A 4COUA 3OBAA 1NOVA 1W99A 2FCTA 4XAEA 1SBDA 4O9EA 5GM0A 1WLCA 1GWMA 4HANA 5A3MA 1W6MA 4YVWC 4EV0A 1ZVFA 4FPFA 3GNEA 3FBYA 2E63A 2G9GA 3N9NA 4NPRA 4YW2A 3I2IA 4YW4A 4WV8A 1L7LA 5FZAA 4AQSA 5A33B 3U4XA 4FP2A 2D44A 1VRH1 2FDKA 3WQ7A 2Z69A 3H3UA 3IBMA 5BNOA 5CEHA 1Q8PA 1DYKA 3FUOA 2JICA 4KG0A 4QX8A 1BYHA 4CP2A 2EXIA 4LO4B 2OQ6A 2CDPA 1Y9QA 2WUHA 1JZ8A 2DCYA 2RDNA 1JU3A 2R072 2R043 4A2UA 3DUIA 5LRRA 1L7QA 4IGQA 3OY8A 3CQOA 3RZKA 1BJQA 2OT7A 1BQPA 4K9SA 4YLZA 3NJYA 5GLZA 4RS5C 4PLMA 5D21A 2JG8A 4Q1PA 4QM9A 2P6HA 2X8KA 5ACA1 5GLVA 1DGWX 1S55A 1MEC1 1XE0A 3AYAA 2BW8A 3RZJA 1M06G 4M3CE 3FL7A 4YM2A 4DPNA 2WL1A 4TTGA 2FZ2A 4KWKA 2X05A 2E9QA 5JOWA 1SLBA 2WO3A 2YBKA 3H9AA 1UAIA 1JS9A 1C5IA 1D4M2 1QJZA 2HWD1 4IGPA 3H1MA 1VRH2 5ABJA 1S1AA 2BBAA 2VOWA 4JGYA 4PDWA 1K5MA 2ZBJA 4IEXA 5CBLA 4MGSA 1UX6A 2VNGA 4JDMA 1WZXA 4BOWA 4I3GA 1K5JA 5K0UC 1UU5A 2IFWA 4Q4V2 1GICA 1BK1A 2WA3A 1ZRIA 4Y4RA 4XFCA 2FDJA 5FFOC 3ZR5A 1KXGA 2AREA 2EIEA 2JEMA 2GP3A 3DV8A 5EIYB 2WNEA 4NRMA 4BK4A 2IZWA 3AMHA 5JSRA 1MEC2 1WCUA 2CAVA 5LBFA 3V0BA 1MS0A 1YUDA 1YYNA 1ULPA 4DINB 4Y4YA 5FPUA 3L9JT 3WDVA 5IUQA 1QJEA 4Q5OA 4QX3A 1LHOA 1AL21 4XETA 1GQGA 1RJ7A 4XAAA 2HWF1 2ES3A 4PDWB 1H4HA 1TNRA 5C3PA 1F31A 2ET7A 1F2NA 3O5SA 2NLRA 3ZKYA 4CDWB 1GZWB 4AVBA 2JDZA 4N8MA 4GKYA 1CPNA 3GHMA 2HYKA 1IG3A 1PM4A 1UN1A 1R081 1Z7S2 4FPKA 4IE6A 4NJ4A 1ZRDA 4E2QA 3B9IA 2WZPP 2W0XA 1H1IA 3CF6E 1QXRA 3WP4A 2ZGQA 2Q4SA 1UY0A 4LORA 4YW6A 4N7UA 4Y22B 4MHUA 2CY6A 1QJY3 2W95A 1V6KA 1LOCA 4FPHA 4IE7A 3AVRA 4Q4W1 5DUUA 5FMOS 3VV1A 5ANNA 3ZN6A 5I8YA 2BOIA 4RHV2 2PAMA 4FOQA 5LWBA 1SBEA 2VCCA 3POYA 4QX7A 5E89A 5FWJA 4HK9A 3ZXAC 5JXJA 4S2DA 2YC4A 1VB4A 1Y7BA 1AHSA 2DVDA 2EIGA 4XFGA 5LW9A 3WDUA 1BKZA 2VTFA 1JHNA 1PO23 1GZWA 3V65A 3AKQA 1Q56A 2RDQA 3I2KA 5T55A 2XQXA 2D6PA 4A7KA 1DZRA 3ZDVA 4YVWA 4HL0A 1EYBA 1JYCA 3IDEA 3U07A 4QX2A 4LKSA 1H2NA 5J3UA 4GJZA 4BQ4A 2JJ6A 1W8UA 2YFUA 1ZRCA 5FYCA 1US2A 3KLSA 3SKJE 1RUF3 1GP6A 1OT5A 4CA9A 5IVBA 2C9AA 1VBC3 1XSRA 5KC5A 3PL0A 3IM0A 3MICA 1UD1A 4CDXA 5F5QA 1SBFA 1W3VA 3JBG1 1SLTA 1GQHA 2VBPA 1WCSA 2R061 2HWB1 4AI9A 1F4HA 4D7SA 2ZAHA 3C8XA 2I07B 3BU0A 3D6EA 2VMEA 3VBFB 4Q26A 5H9PA 1PVC3 3ZOIA 1MVQA 3EMRA 4NAOA 5DZEA 2RJ2A 3I2HA 2VECA 5T5PA 2EXKA 4FOYA 4M0HA 2MNGA 3A23A 2D6OX 3C7HA 3WG3A 2R071 2CHHA 3SQOA 3WZ1A 4D69A 1COV1 1VBB1 5F1RA 5IYYA 5LA1A 4ZONA 4GH4A 3WUDA 1X8EA 1G9BA 3HEIA 3J7MA 2BP6A 3OG2A 1SFPA 2TBVA 3A4UA 4K20A 4UOJA 1W2OA 2XGXA 2ZHKA 3ZX7A 1UW8A 1WW4A 2GN3A 2XVGA 1I5PA 3FLPA 3K2OA 4IE4A 2WYFA 3W9AA 4CEYB 1A78A 1LAJA 1IKPA 1VAKA 3ACGA 1JYIA 1LODA 2JKXA 3SH4A 3VBSB 3SXWA 3WY6A 2Y6FA 4CU7A 4AGRA 3VD3A 4AF9A 2HEYF 3N9OA 1S0EA 1REFA 1RL3A 5J7MA 4LIUA
chains in the Genus database with same CATH topology
1VMJA 1VE0A 2P6HA 1VMHA 1VPHA 2P6CA 1XBFA 2CU5A 1VMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMJ A;  1VE0 A;  2P6H A;  1VMH A;  1VPH A;  2P6C A;  1XBF A;  2CU5 A;  1VMF A; 
#chains in the Genus database with same CATH topology
 2ZPX A;  1QXP A;  2ZX4 A;  5FPV A;  1RUJ 2;  1BK0 A;  4JAA A;  4HVQ A;  5KXE A;  3TB0 A;  2WDB A;  5IVC A;  4AED B;  1ULO A;  1CZT A;  5K0U B;  4L92 A;  4ET7 A;  4IW3 A;  2VMH A;  2ZEZ A;  4P5H A;  2CSG A;  1PVC 2;  3RJR A;  3O1P A;  2NP0 A;  5T5O A;  1X50 A;  3BOP A;  3HN3 A;  4KU7 A;  2VXJ A;  1ZZ6 A;  1EUU A;  3EHK A;  1W8O A;  4UAP A;  3SC7 X;  2OUH A;  4XYX A;  3GF6 A;  3VDD B;  3WF4 A;  4CPB D;  3PLQ A;  1Y3T A;  4YM1 A;  3ZN5 A;  1W06 A;  1DQ0 A;  1UZW A;  1DIW A;  4N90 A;  2PHL A;  4R9B A;  3SEE A;  2BVV A;  2J1V A;  2RS1 1;  2HBU A;  4NIG A;  4Y24 A;  1UL9 A;  4Q8L A;  1UU4 A;  4FOV A;  2ZGL A;  1ZNP A;  2ADE A;  4OUS A;  3ZFG B;  1T6G C;  3MEP A;  4UW3 A;  4D8M A;  5ACA 2;  2Q8O A;  2FD8 A;  1YQ8 A;  4RS5 B;  4NID A;  1DP0 A;  3M2M A;  1GZT A;  3FUQ A;  5ACA 3;  4IV1 A;  1YFX A;  1W9S A;  4A6O A;  4MYE A;  1UY4 A;  5I8S A;  2W91 A;  1EP0 A;  3WDW A;  2H0B A;  5ISL A;  1FMD 1;  1N1V A;  2IVI B;  3VBO A;  1UOB A;  2KD7 A;  3SEP A;  2ZHN A;  3NRU A;  3VDD A;  2CDO A;  3LOB A;  3JXS A;  4AGG A;  1RXG A;  2R04 2;  1V9U 1;  3WP6 A;  3ZFE A;  3LB9 A;  3GYD A;  3C7F A;  1S0J A;  5IVV A;  4KH9 A;  3O1T A;  2E33 A;  4JX0 A;  2A3W A;  4XJ8 A;  5C71 A;  3EQE A;  4QPG A;  1PIV 1;  3ZFG A;  2Z79 A;  3WVJ A;  3GHN A;  4IL7 A;  4JKM A;  1G9A A;  4YPJ A;  1GSL A;  5HCB A;  3SHR A;  1QJY 2;  4CPB A;  4IEP A;  3DYP A;  4EWA A;  1ASJ 1;  2BTV C;  3ZFF C;  2OW4 A;  4Y5Z 0;  3UNP A;  3ACF A;  3FWE A;  2R07 3;  1VIW B;  3OSD A;  4TYS A;  4BCU A;  3ZYF A;  4LBM A;  4QQ2 A;  3RDI A;  3WNK A;  5KWR A;  2E7T A;  5CFC C;  1ND2 C;  4DUX A;  2Y8K A;  4NVP A;  2BU9 A;  5LK5 A;  4CCO A;  3WCR A;  5FZD A;  2WS9 1;  4MSV A;  5IFP A;  3WDY A;  4BXF A;  3DGT A;  1NZI A;  1LHW A;  1LJ7 A;  1L7R A;  1RHI 3;  3PNA A;  1WW7 A;  4F8A A;  2YB7 A;  1POV 1;  5F37 A;  3R0R A;  5FO8 B;  1JZ7 A;  2O8O A;  3MW4 A;  2VNV A;  3OD4 A;  4ZXE A;  1LOG A;  2B42 B;  2HWB 2;  3HBK A;  2YUE A;  3MGU A;  4FI9 A;  4W6W A;  5AVP A;  1NT0 A;  2F6B A;  2IWG B;  3SNM A;  3X29 B;  3GZE A;  3HR9 A;  3BTX A;  1WGP A;  4XAB A;  4I2O A;  5IFT A;  1IS5 A;  3I7D A;  4LR4 A;  3I59 A;  3G6J B;  3UGG A;  4Q4W 3;  4BE3 A;  5HCA A;  1YC6 1;  2WSU A;  3WG2 A;  2DCT A;  2D93 A;  2BEO A;  4XDP A;  2TUN A;  3GZU C;  3B01 A;  5HXM A;  3J7L A;  2C1F A;  1RC6 A;  3I2D A;  4Y5T A;  1O4T A;  2NYY A;  4MH0 E;  4LNV A;  2PEL A;  2WNV A;  4Y1Z A;  1RUD 1;  5DDJ 1;  2WNU A;  3R4S A;  5JUV A;  5I91 A;  4CCE A;  1QDC A;  1D4M 1;  1Z0H A;  2WC2 A;  3JB8 A;  4LBN A;  2W39 A;  4TXW A;  2YGL A;  3MFA A;  1K42 A;  2NQY A;  4BLI A;  1GZC A;  4MO3 M;  3KT1 A;  4YZ3 A;  3AP4 A;  5A7W B;  3HVD A;  3KT4 A;  3RZL A;  3HT2 A;  4QQO A;  4NPM A;  4FP3 A;  3CKH A;  1UXX X;  2WZE A;  5I0D A;  3ZO0 B;  5L7O C;  2EID A;  2HWB 3;  1MAC A;  1W6Q A;  1XSQ A;  2ZHL A;  3OOX A;  4MLO A;  5FKB A;  1QJX 2;  2HWE 2;  4AFM A;  3DEM A;  1WWY A;  2QQL A;  4B4Q A;  4B4P A;  3ZXE A;  1JOJ A;  4YVS B;  3SH3 A;  3BB6 A;  3GDB A;  1RUC 2;  3HIF A;  2D6N A;  3ZYG A;  4Y20 A;  2VZP A;  1O8P A;  1S0F A;  4UBG A;  5FYY A;  3VBU B;  3RZM A;  2K46 A;  3OPZ A;  4G4F A;  4MAD A;  3LAG A;  4UT5 A;  2DDU A;  2Q30 A;  2BFU S;  4Q4X 2;  4LBJ A;  3J9S A;  4U2A A;  2Y6J A;  4XE9 A;  5A3T A;  4XVH A;  3T30 A;  2X53 S;  3AP9 A;  3J7N A;  4UFH A;  1T6B X;  4E4D X;  2LTN A;  2VAU A;  3VZN A;  1GV9 A;  3Q8B A;  1XJA A;  4GAL A;  2YC2 A;  4QGN A;  4XIK A;  3NAP A;  5IK5 A;  2J7M A;  4WM7 C;  3C7G A;  2ZOE B;  3HWJ A;  1FPN 3;  4CZS A;  2JDU A;  5C3O A;  1PO1 1;  4C1W A;  4AE2 A;  3CO2 A;  1D0G A;  1XU1 A;  2PA7 A;  3EJK A;  1N1Y A;  4LJH A;  2GAL A;  2QBX A;  1R64 A;  5IAX A;  4IQP A;  2JDA A;  1POV 3;  2P3J A;  3FFZ A;  3N9M A;  3WF2 A;  3CZJ A;  1VP6 A;  4CDQ C;  4URT A;  4B8E A;  4OHY A;  2H6B A;  3TYJ A;  3O1V A;  3O7O A;  3LF7 A;  3NJZ A;  4OUE A;  3L2H A;  4CXX A;  1WLD A;  5HCF A;  1DZQ A;  3FE5 A;  1PZ9 A;  3KCX A;  2MEV 3;  1KDM A;  5KHH A;  5EYY A;  2ZMN A;  3KSC A;  4CCD A;  4M3C B;  1NXD 1;  4C8D A;  3OEA A;  2UWB A;  3BAL A;  3NAP B;  1VBE 1;  3MV1 1;  4WM8 C;  3UGH A;  2YXS A;  3WNN A;  5EHD A;  3IPV B;  4O7X A;  4X6R B;  4Y3O A;  3RRD A;  4FBF A;  3IAQ A;  1VR3 A;  2DCJ A;  1CAU A;  3IDA A;  3JUU A;  5LBC A;  5I0S A;  3JD7 2;  4LTA A;  4HLT A;  4URA A;  4N53 B;  2BV4 A;  4OCT A;  1H8T B;  4EE2 A;  2C24 A;  2RVA A;  3NO8 A;  5KBF A;  2AC1 A;  3S0M A;  1AXZ A;  1TVG A;  2E51 A;  4AI8 A;  4OI0 A;  1PGL 1;  2WRA A;  4UW4 A;  4NRQ A;  4JRL A;  4HN0 A;  2W1W A;  5C8C B;  1HKD A;  1SG3 A;  3LCP A;  1V70 A;  1E5R A;  3URF A;  1LB2 A;  1GU3 A;  3RWN A;  1FYU A;  5FMC A;  4A45 A;  2GDF A;  3OY8 B;  5JLV A;  1V9U 3;  1Q43 A;  1Q8V A;  1FMD 3;  4OZO A;  3SIS A;  1H0B A;  4GMP 1;  2K9Z A;  2IXC A;  1TMF 1;  2EXH A;  3VHP A;  5A1L A;  2VUA A;  4FFH A;  2LAL A;  1SMV A;  2WT2 A;  4LPL A;  3H50 A;  4XBQ A;  5BNN C;  5K4L A;  1JH5 A;  2EF6 A;  3E5Q A;  1AJO A;  4N9H A;  3K51 A;  3WUC A;  4BQW A;  4NR1 A;  1AR8 3;  3NMB A;  1J58 A;  3BOD A;  4W65 A;  3MFC A;  3NNF A;  4M4R A;  1HRI 1;  4NAM A;  4PI2 A;  1ULD A;  4XF0 A;  2FDH A;  4XCA A;  2AH2 A;  2GC3 A;  2J1U A;  2MEV 2;  3VLB B;  5FPX A;  5KXC A;  3I2O A;  2DUP A;  3KGL A;  2UYB A;  3ZPY A;  5D8A C;  2TNF A;  1ZZB A;  4DXR A;  2DUQ A;  2J1T A;  1JYN A;  2FCU A;  5A7P A;  2ADD A;  3RMX A;  3HNM A;  5FZH A;  3M70 A;  5KC6 A;  2BNM A;  4WZC A;  3KQR A;  1PZ8 A;  4N43 C;  3VBR B;  3GBF A;  4D6Q A;  1YLL A;  4O61 A;  1F9K A;  3M3O A;  4OHV A;  3UKN A;  3ZM8 A;  1W6N A;  2VU9 A;  5DQ0 A;  3ZSL A;  4W6X A;  4AI3 A;  4IEY A;  5CA6 A;  1DLL A;  5T3N A;  3VBF C;  5DMY A;  3AYD A;  1T2X A;  2JDM A;  3B3Q E;  3LA7 A;  1BEV 3;  3GZA A;  5A33 A;  4TZD A;  3LDB A;  1ULG A;  2RR1 3;  4TLF A;  4ASK A;  5FQ0 B;  2DUR A;  1OD3 A;  2VMG A;  4DIQ A;  4C0H A;  4M0N A;  4MXV A;  2R04 1;  2RS1 2;  4BQX A;  1R09 2;  2XBO 3;  1IPJ A;  2BZD A;  4XEZ A;  1G9F A;  1OFN A;  5CIR A;  2CL2 A;  1IS4 A;  2WFF 3;  1WCK A;  3PUR A;  4QXK A;  3LPF A;  3L2Y A;  4GMP 0;  2MEV 1;  2VZ3 A;  3KMH A;  1QNY A;  4COW A;  2R49 A;  1UMH A;  2K0G A;  2OPW A;  3IT8 A;  5C3S A;  5JMO A;  1AR9 2;  3ZFF B;  2ZEW A;  2WII B;  3W20 A;  2QCS B;  4YAR A;  4K1Y A;  1N1S A;  2WQZ C;  3KD4 A;  3VBU C;  3AC0 A;  4HVO A;  3ZYB A;  4MX3 A;  4CCJ A;  4Q29 A;  3E6C C;  3NJX A;  5F3I A;  2XQR A;  4GAZ A;  4HFS A;  1BCX A;  1E57 A;  2VM9 A;  3DN7 A;  4XOG A;  3APB A;  4DUW A;  2JDH A;  3IMM A;  3N35 A;  3FHI B;  3HNY M;  4GQ7 A;  4AEJ A;  3JBG 2;  5C9A B;  1MS4 A;  3O1U A;  2QQI A;  4UF0 A;  3VGI A;  2Q0A A;  2WIN B;  3UYJ A;  1V6N A;  3RFR A;  4L8Q A;  4W4Z A;  1YFY A;  5GZC A;  2XML A;  5EV7 A;  1TMF 3;  1CES A;  4MZU A;  4V1P A;  2VZ1 A;  2X29 A;  1QKQ A;  4YVW B;  4JGZ C;  3O0W A;  2AEN A;  1LGB A;  4XQW A;  1F8V A;  2RS3 1;  1UNB A;  4GMP 3;  4AHY A;  3VDB A;  1YFW A;  1KDK A;  4C1X A;  4XJA A;  3DKW A;  2A1X A;  5BNP C;  5IAT A;  3N4M A;  5AFB A;  4OLL A;  5LZ6 A;  4J6G A;  3LSE A;  2WLP A;  4RGG A;  1HB1 A;  2QQM A;  4QPI B;  2Y64 A;  2YY1 A;  5AVA A;  1IGO A;  3IKW A;  1QWR A;  2GH8 A;  3AKT A;  1YRZ A;  1QIQ A;  3J8F 3;  4L2N A;  4IET A;  5EPA A;  1R09 3;  4CU6 A;  1ZM1 A;  5C4W A;  5BPX A;  3TNP B;  2XJV A;  2R06 3;  4LO5 B;  2B39 A;  3G7D A;  2VOV A;  1UQX A;  5DUV A;  4BH9 A;  3SCF A;  4DXT A;  4RGK A;  4AFB A;  1NE6 A;  1OC1 A;  2PN5 A;  3LKJ A;  5I0U A;  3I4I A;  2KM2 A;  5I8T A;  4FAH A;  1OUR A;  1MS5 A;  3OD0 A;  5EJZ B;  3T09 A;  2X10 A;  3C7O A;  2A6W A;  1RUG 3;  2FZ1 A;  1CX4 A;  2PLV 3;  2EIC A;  3III A;  3MBW A;  3TN9 2;  2IXH A;  4BDV B;  1H1A A;  2YDE A;  3JCI A;  4XIL A;  1L3J A;  1RIT A;  1GNY A;  1VAV A;  3D0S A;  3LZZ A;  5TSW A;  3OB8 A;  4DZG A;  3Q8A A;  3S5Q A;  4DMI A;  1AL2 3;  3J8F 1;  1Q3E A;  4NPL A;  5BV6 A;  1QEX A;  5JXI A;  4ARY A;  4ISR A;  1JYX A;  5F5I A;  1CZV A;  2GME A;  5A6Z A;  2RJL A;  4RQP A;  4XFA A;  4XJU A;  3UKT A;  4EYU A;  1W9W A;  1W0O A;  2YU2 A;  3THD A;  3VBR A;  4CCC A;  1O3S A;  3ABZ A;  4MET A;  4O9G A;  3BU7 A;  1R08 3;  5FZF A;  3VKF C;  4CEY C;  1AUY A;  1C57 A;  1QH7 A;  4Q0U A;  1Z7S 1;  3CIH A;  3POE A;  1AR8 2;  3LPG A;  4CCL A;  4E4S A;  4FT8 A;  1OKO A;  1ZX5 A;  3AZY A;  1PIV 3;  1ST8 A;  4HKW A;  2PMW B;  1YEW A;  3AZX A;  2LRP A;  3OBZ A;  5JOY A;  4KMQ A;  3Q8F A;  4XAC A;  1HJG A;  3CJI B;  3ACL A;  3WF1 A;  5CFD A;  4EZH A;  2A7A A;  1PO1 3;  3AMN A;  2D7F A;  3KV6 A;  3LFM A;  4NWW A;  1K5M B;  2ZA9 A;  3OUJ A;  3LDK A;  5FZC A;  5A3P A;  2XJP A;  4QAW A;  1FOD 1;  2UU8 A;  3PVO A;  1UMI A;  5C5U A;  1H4G A;  5CIS A;  1LUL A;  5LAT A;  3POS A;  3ETQ A;  4LUL A;  1Y9M A;  4ZXK A;  4ATE A;  2DFC A;  2XH6 A;  4I09 A;  4I02 A;  3H7J A;  2WLQ A;  1OI6 A;  2E7A A;  3T2O A;  4NOT A;  3FHA A;  3PTY A;  4QHO A;  4R9C A;  5DAQ A;  1QQP 2;  5G05 L;  4M4P A;  3GXU A;  4IXL A;  1NCR A;  4MXW B;  1GP5 A;  2XON A;  4EN8 B;  4K8F A;  5KXB A;  3W21 A;  2D3S A;  3EO6 A;  3JD7 3;  1OA3 A;  3MIG A;  1NQD A;  1XNK A;  4OI1 A;  3N3H A;  5JSO A;  4Y5S A;  1RUD 2;  4E27 A;  1YO8 A;  3JZV A;  5A7Q A;  1RUN A;  1AYM 1;  3VBO B;  1AR6 1;  2R7E B;  2XBO 2;  5FPZ A;  1RIN A;  1X36 A;  2ZGS A;  5CFD B;  2BBV A;  2R30 A;  4Z2W A;  1NY7 1;  4N7I A;  3U14 A;  5A3N A;  2GMP A;  2GNM A;  4YGB A;  1TQ5 A;  3BPZ A;  3ZMN A;  3NNG A;  3GBW A;  3VBS A;  4RL7 A;  3ILN A;  1V00 A;  3NNM A;  4K21 A;  2BUK A;  1ND3 C;  3AKP A;  5FYU A;  5L9B A;  5HPO A;  3MID A;  5FTT C;  3MLK A;  2HWD 2;  5H9R A;  1C5H A;  2WWJ A;  5T50 A;  1WW6 A;  3MDP A;  3MIE A;  5GZF A;  1I5Z A;  3KM5 A;  3NV4 A;  1VAL A;  4KWL A;  4ZU7 A;  2B5H A;  4HT1 T;  1CN1 A;  4UYB A;  4XQ4 A;  4L9B A;  4Y22 A;  1NCR B;  3P3P A;  3FBM A;  2B8M A;  3OEB A;  4GWI A;  4CP0 A;  1JMU B;  1GUI A;  2P6C A;  4K3U A;  3WW2 A;  3H8O A;  5FK8 A;  1QOO A;  4CEY A;  2E26 A;  1XE7 A;  2HLE A;  2V73 A;  3DKQ A;  2GH2 A;  1LGN A;  1BMV 2;  1VJ2 A;  4YWA A;  1HRV 3;  1ENX A;  3HNB M;  3GBG A;  2RR1 1;  2HEW F;  4CCM A;  2YHJ A;  5LBE A;  3U75 A;  3PJY A;  4I30 A;  4TSV A;  1CWP A;  2QFE A;  3ES1 A;  3FHQ A;  4QPI C;  4QXH A;  4AQ6 A;  4IEZ A;  3MIH A;  3UES A;  1OPO A;  5JPM B;  3F2Z A;  1JU4 A;  2AAC A;  4L0P A;  4ASL A;  3WNL A;  1AR8 1;  5A3L A;  1OPM A;  2BQP A;  2VGD A;  2GU9 A;  1CZS A;  1XYP A;  2J1R A;  3KHB A;  2PHX A;  5FP7 A;  4YFZ A;  3V64 A;  1HIX A;  4A4A A;  3IIA A;  4R8H A;  2Y60 A;  4Z2A A;  1RIR A;  1RUC 3;  2AEY A;  1ZBA 1;  4NRO A;  4P9X A;  2FMY A;  3WP5 A;  4B29 A;  1UYX A;  2WZR 2;  1UOF A;  2X09 A;  5A3U A;  1RUF 2;  5EYX A;  3OPW A;  1NLQ A;  3JU9 A;  1MZE A;  2ZXQ A;  2XJT A;  5EWS A;  5FZE A;  1UYZ A;  4LLO A;  4DNY A;  5C9A C;  2ZX2 A;  4XJW A;  3WLU A;  2RMU 2;  1I9R A;  2V4A A;  5HCH A;  1FX5 A;  1XXN A;  1RUI 2;  4JDN A;  4PBP A;  1O4Y A;  3WQ1 A;  2P17 A;  3LOI A;  1VBD 3;  2ZGO A;  4BQ3 A;  1UIK A;  1NQJ A;  1C3H A;  1O7F A;  2OQ7 A;  5GAL A;  1H6X A;  1C1F A;  1AZD A;  3I3B A;  5FLH A;  2AEZ A;  4BK5 A;  1VBA 1;  3PVB B;  4WM8 B;  3SLI A;  1E5H A;  4PHZ A;  2XJU A;  4YZ5 A;  3WCS A;  1HN1 A;  4PF5 A;  3D4K A;  2QJV A;  1QH6 A;  1R09 1;  1RUE 1;  1MZF A;  2Q1Z B;  1LNS A;  5JZG C;  1NXM A;  3KWV A;  4X8P A;  3E5X A;  2JG9 A;  3R4D B;  4FCA A;  1JOD A;  1UKR A;  2JEC A;  2RS5 3;  3TEX A;  2UYA A;  1G6N A;  2P3I A;  5L19 A;  4W8J A;  1DQ6 A;  1PZ7 A;  2PFW A;  3ILF A;  2W68 A;  4Y33 A;  5JCT A;  2PTM A;  1VPH A;  3T1M A;  3SMH A;  2PLV 2;  1OUS A;  2C5D A;  3KF5 A;  3T4H B;  4RA0 A;  1LOB A;  2PQS A;  1S2E A;  1US3 A;  3LQC A;  4UBH A;  3A7Q A;  3PJQ A;  4GB3 1;  4XJZ A;  1SPP B;  3O1S A;  4XTP A;  1AX2 A;  4KG8 A;  3LD8 A;  4P02 B;  1X9P A;  3BIE A;  5LY2 A;  2ZGU A;  1YJK A;  1HB2 A;  2RV9 A;  1DQ1 A;  3FMG A;  1RXF A;  4HSL A;  1Y4W A;  4EN9 B;  4W6Y A;  4CDW C;  1AR7 1;  1YQ2 A;  4RYD A;  1I6X A;  1FV3 A;  4IV3 A;  3M8L A;  5FZ6 A;  1KIT A;  3WQB A;  5FZG A;  1U5Z A;  4B7K A;  3I3E A;  1RTV A;  1C8M 1;  1VBE 2;  5FY5 A;  4ZS2 A;  2P4E A;  2VUJ A;  2W2I A;  3MW3 A;  4FVV A;  3S7E A;  5F5C A;  3B5L B;  4AI2 A;  3USU B;  5FOJ B;  1TME 3;  4G9S B;  1W2T A;  5LA9 A;  1YJL A;  3O14 A;  3H1W A;  2KR2 A;  1W6O A;  4WVW A;  4BPZ A;  3BPS A;  2W08 A;  4Q8K A;  2XJQ A;  3GJA A;  1RMU 2;  1EY2 A;  3POI A;  5E16 A;  2HWC 3;  1VRH 3;  2D43 A;  4QX0 A;  4Q27 A;  1AL0 G;  1R1A 1;  1KGY A;  4JTO A;  2HJI A;  4ERO A;  4XMI A;  1GOG A;  3AXE A;  3S5A A;  1F5J A;  3OGR A;  3QCW A;  2DV9 A;  4E2G A;  1PX4 A;  3MF6 A;  2GC2 A;  1AJK A;  1XU2 A;  2B45 X;  2R06 2;  1A3K A;  2N7G A;  3S30 A;  5FZ4 A;  4QGL A;  3POF A;  4CUA A;  5FXZ A;  1YI9 A;  2Z5W A;  4MGQ A;  4HG6 B;  1WD4 A;  1GMM A;  3IPV A;  5C7G A;  2VBB A;  2Y33 A;  3FJS A;  2Z4F A;  1V6O A;  4YG3 A;  1FT9 A;  1C28 A;  3DYM A;  4FFG A;  2ZGT A;  4XIO A;  4YGE A;  2PHF A;  4CP9 A;  1TME 2;  5BNN A;  3CLP A;  1U5Y A;  2QE3 A;  3OUI A;  2YC0 A;  4LXL A;  2FHR A;  3P1I A;  1PHM A;  4RSU A;  3K75 B;  4UFJ A;  1PMI A;  3IDB B;  5BXX A;  3TWI A;  2I2S A;  1G86 A;  4OHX A;  3VKM A;  1SLC A;  3UK9 A;  4K7J A;  2VMC A;  3OYW A;  1CGP A;  3WF3 A;  3ZYR A;  1OOP A;  1FXZ A;  5FP8 A;  1QOS A;  1GOH A;  2CWM A;  1G8W A;  2CV6 A;  5A3W A;  4LA2 A;  4RHV 1;  3AP5 A;  3CHX A;  4OZX A;  1VBC 1;  4Y20 B;  4Y1X A;  4NHX A;  2EAK A;  1X9T A;  3I2F A;  2ET1 A;  1EV1 1;  1RUF 1;  2YFZ A;  5FR3 A;  3VUO A;  1QQP 1;  1JXN A;  1DDL A;  5FK7 A;  5FRE A;  2WO1 A;  1LHU A;  2BFU L;  2P37 A;  3ECQ A;  3H1Y A;  4P9Y A;  3QBQ A;  5FIX A;  3KQ4 B;  5JOZ A;  2OA2 A;  2YPD A;  4RN5 A;  4A41 A;  1HRI 3;  3AVS A;  1WW5 A;  2IC1 A;  3DCQ A;  1UPI A;  3RZG A;  4YG0 A;  1NY7 2;  1W8N A;  4PIY A;  2HWF 2;  4GIQ A;  4JRA A;  2D5F A;  2KA3 A;  1B09 A;  1FPN 2;  4LO6 B;  2WQ8 A;  4BIO A;  2CNA A;  3DXU A;  4AFC A;  2JDP A;  3B9C A;  4LBO A;  1W9Y A;  2FBE A;  2JB4 A;  2ARB A;  5FZ7 A;  4I01 A;  5AC9 1;  5FYS A;  2GNB A;  4YZ4 A;  2R32 A;  1O91 A;  4N53 A;  4CDU C;  1O5L A;  1WMF A;  2VBD A;  1YCI A;  1VMF A;  2JG9 C;  3H3Z A;  3THP A;  1Q8Q A;  4XUO A;  1OKQ A;  2C6S A;  5AFE A;  1XRU A;  4PLN A;  5C6C A;  4LKD A;  1WKY A;  1OH4 A;  1ASJ 3;  3ZXF A;  1SLL A;  4OMC A;  3A21 A;  3OCP A;  5H9S A;  1NCQ B;  4DFS A;  4FTS A;  2VE1 A;  3I2G A;  3TRS B;  3NNJ A;  3USU A;  4HON A;  3I54 A;  4CEW B;  1OLM A;  1W9T A;  4DO0 A;  3N36 A;  4QXC A;  3A0N A;  5FMO L;  5K8S A;  2F4L A;  1RMU 1;  2C26 A;  3NQH A;  1JOP A;  1W6O B;  2G9F A;  2C9K A;  3FLT A;  4GWN A;  4HPK B;  2ENR A;  1ZYB A;  1AYN 1;  5FPB A;  1VB2 A;  5JXG A;  2AUY A;  1AVB A;  5JOX A;  4QB6 A;  1PNF A;  1CAW A;  1BMV 1;  1HV0 A;  2RS1 3;  2ZGR A;  1UIJ A;  5KR7 A;  2UWA A;  3U4S A;  2Y6G A;  4RR3 B;  4R4X A;  2VQ0 A;  4RGA A;  5J09 A;  2WZR 1;  5FLJ A;  2YPJ A;  2JIG A;  2H6C A;  4P5Y A;  4LK7 A;  3K3N A;  5FPL A;  3ACH A;  1YIP A;  4HMZ A;  3WW4 A;  4ITC A;  4CDW A;  3V56 A;  3ZSM A;  5A1F A;  2G4I A;  3PVN A;  1CR7 A;  5DZF A;  1I1E A;  3VKL A;  5FOB B;  4RFR B;  2XVL A;  1FOD 2;  4YZ1 A;  2DCZ A;  1RUJ 3;  3OTF A;  3U37 A;  5LK7 B;  4FOW A;  2YBP A;  4Q4Y 3;  5FYB A;  4G3Y C;  3FX3 A;  2A3X A;  4P9J A;  2RR1 2;  1ND2 B;  4GB3 2;  2WNU C;  2XWJ B;  5CKN A;  2WNV C;  5DUX A;  1H9W A;  2CGP A;  4MGT A;  4XFF A;  2JD4 A;  1EAH 2;  4GB3 3;  4W50 A;  2YG0 A;  1H2L A;  1IKQ A;  2MPF A;  5GZD A;  3EBR A;  4I0A A;  2HH9 A;  1IOA A;  2XUM A;  1UXZ A;  3AFK A;  3NV1 A;  1UF2 C;  2IXI A;  4YW7 A;  1CQ9 A;  1W04 A;  2JG8 B;  4GWM A;  4PLO A;  4BWO A;  2XJS A;  2E32 A;  3WW1 A;  4AVA A;  1PMH X;  4DXZ A;  4M00 A;  3WNO A;  3PU8 A;  3O1O A;  3AMQ A;  4NMI A;  1M4W A;  3WDX A;  4AZZ A;  1AYM 3;  1LES A;  1QJU 2;  4DEQ A;  1BLZ A;  3ATG A;  1XND A;  3C7E A;  1SAC A;  3V0A A;  5FQ0 A;  1UOG A;  2BRT A;  1DLC A;  2XJR A;  1WA6 X;  4PIZ A;  5A3O A;  1GNH A;  4KU8 A;  4D7T A;  3DEC A;  2BGP A;  3POW A;  3ST7 A;  5C9A A;  2ZS6 B;  2UY8 A;  4AOC A;  2D98 A;  2QQO A;  5CFC A;  2GNT A;  3HMY A;  1MS8 A;  1H6Y A;  1A6C A;  3FLR A;  3K4D A;  4GKX A;  5LA0 A;  3R05 A;  4LOT A;  4AFD A;  4Q2F A;  2FMD A;  4S2H A;  1OQ1 A;  3Q8E A;  5C3R A;  1XOY A;  3ZFF A;  2QVS B;  1RUH 2;  4AR2 A;  2IFR A;  3D3A A;  1STM A;  2LRO A;  4JHT A;  4BIS A;  2AZ5 A;  1VE0 A;  5FDB A;  2A73 B;  4FQ4 A;  4RFT 0;  4QMA A;  3RGB A;  2V09 A;  4NN0 A;  3AB0 A;  4E2S A;  3V0B B;  3NKT A;  4XCB A;  3ZFG C;  1XNB A;  4LHS A;  2OYZ A;  3KF3 A;  5IHR A;  4WVM B;  4B4R A;  2Q5T A;  1B35 C;  4H14 A;  5IVE A;  1Y43 B;  3IWZ A;  3KB5 A;  1C8N A;  1FNZ A;  4Y1U A;  1D4M 3;  2AYH A;  2P2K A;  2JE7 A;  2PHD A;  4K8R B;  4LBQ B;  4QPI A;  1G9D A;  3U1X A;  4H2A A;  1C4R A;  2L9L A;  2VOK A;  2YZ4 A;  1K3I A;  3WNM A;  2DTW A;  2ILM A;  2VW0 A;  1JI6 A;  2VZU A;  3AKS A;  3FFQ A;  2RE9 A;  4HPK A;  1QHD A;  3VHN A;  1OQD A;  1XYO A;  1SLI A;  1PIV 2;  2UWC A;  3VBR C;  4UFM A;  4LKE A;  4RQP C;  2NM1 A;  2Z42 A;  3NVC A;  3NWK A;  4Z92 B;  1WCD J;  3ZXL A;  1S0C A;  4XUQ A;  3LEM A;  4ZU4 A;  1C8M 2;  4FXK B;  1QY4 A;  2ZJC A;  5LEK A;  1RVF 3;  2VZQ A;  3AP6 A;  3DL3 A;  4EQV A;  1LOA A;  1V0A A;  4QKF A;  3TN9 1;  2Q1F A;  1HXS 2;  1B35 A;  2K2S A;  2ZX3 A;  5BNP B;  4XPV A;  3M3Q A;  4LEJ A;  1D2S A;  4B1M A;  4HOO A;  2ZTN A;  3KCY A;  5F2W A;  3VL8 A;  3MUY 1;  2Q1M A;  1D4V B;  4AVC A;  4RQP B;  2BWC A;  4LHN A;  2FDF A;  4COY A;  2W9X A;  2WS9 3;  2J1S A;  1H2M A;  1PGW 1;  2XWB B;  4QQH A;  3AMM A;  3P5B A;  2WNO A;  1JTZ X;  2Y6K A;  2WT0 A;  4P00 B;  1O6U A;  2QQV A;  3PTR B;  1RGS A;  4JZR A;  2AGS A;  4QDQ A;  3SKV A;  4KWU A;  4CUC A;  2BJS A;  1VMH A;  4DUV A;  4AQ2 A;  2RDS A;  3T0A A;  1LHV A;  4CU9 A;  2DU0 A;  3MV0 1;  1UO9 A;  2W92 A;  3T0D A;  3MF9 A;  4LBK A;  4BXS V;  4CP1 A;  3WNP A;  4WZF A;  1GP4 A;  1UCX A;  5BNP A;  4XF1 A;  3ON7 A;  3KVB A;  3POJ A;  3J8F 2;  3LWC A;  4OQ8 A;  4EN0 A;  1OFS A;  1Q5O A;  4AHW A;  4EWE A;  1WMX A;  3B02 A;  2RG4 A;  4HET A;  2VQU A;  4NE9 A;  5FYI A;  1IHM A;  2VNR A;  1W6M B;  4IND A;  4JGZ A;  5JI9 A;  3MI8 A;  5BUV A;  3PDQ A;  2DBI A;  1UZZ A;  5DDJ 3;  3SIT A;  2B9U A;  3H8U A;  3ZKU A;  4GH4 B;  1LHN A;  1NX9 A;  2WT1 A;  1SFY A;  2VTX J;  2J1E A;  1HW5 A;  3OGG A;  4KBB A;  4D94 A;  4QKN A;  2XPJ A;  4DRV A;  4YSF A;  4KGQ A;  1GOF A;  3S57 A;  1BBT 2;  4ASM B;  3HJR A;  2RMU 3;  2QQJ A;  4LE3 A;  1AR7 3;  2XKP A;  1P8J A;  3T0B A;  1GYK A;  1W8F A;  1S0I A;  4YFW A;  4J1X A;  5FY7 A;  4DOU A;  3O0X A;  4JCK A;  4R9D A;  3RYR A;  1DF0 A;  1BHG A;  1UZ0 A;  4FXG B;  2RDR A;  2TEP A;  4P9G A;  1VBE 3;  4V2W A;  4GXL A;  1N3P A;  2CYF A;  4LHK A;  4MXW A;  5SV8 A;  1DG6 A;  1RHI 1;  3KZ4 C;  5HV0 A;  1OHF A;  2VW1 A;  5FP4 A;  2BOJ A;  4IDZ A;  5CAD A;  4AYU A;  5DZG A;  1A8D A;  2VL4 A;  1GZ9 A;  1RED A;  2XLG A;  5IAV A;  3S6P A;  1WA4 A;  2LS6 A;  1HXS 1;  3BYW A;  4QHB A;  2Q8C A;  4GUL A;  1W8T A;  3MPP G;  2OS2 A;  1KJR A;  2RM2 1;  1RYY A;  3D0J A;  4JGY B;  1UYP A;  5FBJ A;  3WF0 A;  4BQ5 A;  4CE8 A;  4Z8B A;  5LRS A;  4ES8 A;  3M3I A;  4QB2 A;  1G7Y A;  2VH9 A;  1W2U A;  1IQD C;  1BBT 3;  4YW5 A;  2JE9 A;  3RQ0 A;  1AYN 2;  4QDR A;  4A42 A;  5GLU A;  4HXC A;  3MLL A;  4N43 A;  2WNV B;  3MHZ A;  4NII A;  3EB7 A;  2ZGN A;  4LO8 A;  2W47 A;  3RMY A;  3RNS A;  1DGR N;  4IV1 B;  4PJY A;  1SPP A;  3NW4 A;  1DYO A;  5FV3 A;  2PYT A;  2ZGM A;  4HK8 A;  3MLJ A;  1GWK A;  4XFI A;  2RS3 3;  1JN2 P;  3KV9 A;  4BJ0 A;  1FMD 2;  4F3J A;  3T3Y A;  5GZE A;  3RI9 A;  4IV3 B;  3U10 A;  2J22 A;  2R16 A;  5FZO B;  1SZB A;  4L97 A;  3WDT A;  3LIH A;  3N7L A;  2XUE A;  4CDU A;  4Q4V 3;  2ZZQ A;  4LKF A;  4N53 C;  1F15 A;  5FYH A;  2XG3 A;  3C2U A;  4XTM A;  1CAX A;  5FJH A;  1PO1 2;  2NZ9 A;  5JMC A;  2SBA A;  4MG2 A;  1VLN A;  3IMN A;  4H55 A;  3IZO A;  3UT0 A;  2DU1 A;  4QHZ A;  4AQT A;  3VBH B;  4LLF A;  5FXW A;  3MPB A;  2B46 X;  3GZT B;  1EV1 3;  4FO9 A;  4KWJ A;  4LUK A;  3VBU A;  2ZGK A;  4QU1 A;  4GD4 A;  4NUB A;  1OF4 A;  3NKG A;  3AZV A;  3PME A;  2D6K A;  5DN2 A;  2EIB A;  3UKV A;  2WAB A;  1UZY A;  1NAE A;  4OI4 A;  1JBC A;  4IEV A;  4A3X A;  4UI9 L;  4OVE A;  5C8W A;  1KD7 A;  3TEW A;  1JUI A;  1W3X A;  5FZM A;  2VC9 A;  5LAS A;  2BPA 2;  2YV8 A;  2YU1 A;  4IEW A;  3TEZ A;  4IES A;  1UY3 A;  3VDA A;  2BGC A;  2I74 A;  2VVE A;  4JTN A;  3I3D A;  5APA A;  4BME A;  4CVU A;  4PIX A;  1H30 A;  2ERF A;  1CX1 A;  1SQ4 A;  4Q4Y 1;  3N7M A;  5AC9 3;  1O8S A;  3LFI A;  3GAL A;  3ZXJ A;  5K7P A;  2NN8 A;  5IT6 A;  2WFF 1;  2FQP A;  3IB3 A;  1UY1 A;  4CXW A;  1JYW A;  1HQN A;  4BYY A;  3KV5 A;  3J7H A;  1DCS A;  4WM8 A;  1Q8O A;  1U0A A;  2A75 A;  1OOP C;  1UMZ A;  4Q4W 2;  4LUM A;  5GKA C;  5FZK A;  2WAA A;  3IDC B;  3WNX A;  4FPJ A;  4LT5 A;  4CXY A;  1V6M A;  5K9Y A;  4MGY E;  3TEY A;  4XQD A;  2ARX A;  2E7Q A;  4D0Q A;  3GCW A;  4HN1 A;  4CDX B;  3ZPO A;  1PX3 A;  4CCK A;  2RJK A;  2W46 A;  3GGL A;  2P3K A;  3P6B A;  2WR9 A;  1SCS A;  2WYS A;  5D8A A;  1DGW A;  5DAP A;  4BHP A;  1XYN A;  1FPN 1;  4DQA A;  4CDQ A;  4OHZ A;  1J1L A;  4ONU A;  4AXO A;  1UWW A;  1GNZ A;  2VUC A;  1PNG A;  2O14 A;  4B7E A;  5FZ0 A;  2WNU B;  2QQK A;  3PMS A;  5L9V A;  4QDS A;  4RHV 3;  5BNO C;  3UL2 A;  1MEC 3;  3PUH A;  2CGN A;  5FY8 A;  3OF1 A;  3ZIX A;  4KL1 A;  4UFL A;  3M7A A;  5F39 A;  5C70 A;  1SLA A;  4BMB A;  1D7P M;  4WVZ A;  4E4H A;  4PI0 A;  3BVC A;  2F4P A;  2WN3 A;  3VD7 A;  5LCW L;  2PHR A;  2VTX A;  3I97 A;  1ODN A;  4AL9 A;  5LY1 A;  2HWD 3;  4F7Z A;  1O3T A;  1TMF 2;  4YYO A;  3ZXD A;  4HSJ A;  5FPA A;  2VUL A;  2W1U A;  5D8A B;  1RUO A;  5BNQ A;  2W1S A;  2XHK A;  5DAV A;  3AL6 A;  4GZ9 A;  3ZYJ B;  2D6L X;  2YYO A;  3BGA A;  3WHT A;  2PHW A;  2FCV A;  3Q8C A;  1MS9 A;  2E6V A;  4ORF A;  4Z82 A;  2QZ2 A;  3R6S A;  4FAG A;  3KHC A;  3PIG A;  5FY4 A;  5GLW A;  2EA7 A;  2DVG A;  3KGZ A;  5IVJ A;  4IEO A;  2DVB A;  1DQ5 A;  5CG8 A;  4M3C F;  3BIW E;  5IVY A;  4IV3 C;  1H1M A;  1JW6 A;  4F83 A;  4YM3 A;  1VBC 2;  5I93 A;  3WEZ A;  2JG9 B;  3D82 A;  2BYV E;  4QKB A;  3FN9 A;  5FZO A;  3N7J A;  4XUN A;  4E4Z A;  2WFF 2;  5EJ3 A;  1CAX B;  3RI8 A;  1GR3 A;  1EPZ A;  3JBG 3;  5JWP A;  1YQ5 A;  2IUW A;  5DG2 A;  1R1Z A;  2D3R A;  1O3Q A;  3VBH A;  4XZP A;  3FZ3 A;  4QPY A;  4OMD A;  2VW2 A;  1PM7 A;  4OYU A;  4MUV A;  1RVF 1;  3OGJ A;  1MS1 A;  3CEW A;  2G1M A;  3TN9 3;  4AFA A;  2VZO A;  3AZW A;  2JDN A;  1UX7 A;  3HAG A;  3ZR6 A;  1E5I A;  1W6P B;  2XLA A;  1W9F A;  3CZU A;  4YGC A;  3ILR A;  5J98 B;  1AYM 2;  1QJU 3;  1QJY 1;  1ZRF A;  2JWP A;  3AK0 A;  2IXK A;  4RR3 A;  3CL1 A;  4FPY A;  5JZG A;  2GC0 A;  1AX0 A;  3EYP A;  4O65 A;  1H8V A;  1NLR A;  1W0P A;  3POB A;  4AVT A;  1HXS 3;  3NAP C;  1O3R A;  1ZRE A;  3ZFE B;  4IER A;  4QQP A;  4KGG A;  3ZSJ A;  2ZKN A;  5KXD A;  2VNO A;  2EAA A;  3WP3 A;  2DF7 A;  3DPR B;  1N47 A;  2WO7 A;  4NWV A;  5A7O A;  4KQ7 A;  3VL9 A;  1JZ5 A;  4K6B A;  2A71 A;  2WS9 2;  3HBZ A;  3ZXG A;  4Y26 A;  3PUA A;  4YM0 A;  1QJX 3;  2HWE 3;  4Q4X 1;  3ACI A;  1RUI 1;  1OVS A;  3WT3 A;  4BZ4 A;  3HD8 B;  3NNL A;  4B3N A;  1ND2 A;  2NMO A;  4ZZ8 A;  1JYT A;  4EJR A;  4Y1Y A;  3K48 A;  5FZ8 A;  2RS5 1;  4LBQ D;  4LIT A;  4AWD A;  3UET A;  5T5L A;  2VVD A;  3M3C A;  4I0B A;  5T54 A;  1KEX A;  4XC9 A;  3HPN A;  2DCK A;  3N9Q A;  2VOX A;  4UF0 B;  5JPN B;  3TBD A;  4XZU G;  4MGZ E;  5JXH A;  2VO5 A;  2EVX A;  2VQT A;  5F3E A;  2JKB A;  3UJQ A;  3INA A;  1DZT A;  5IK4 A;  2PQQ A;  1GWL A;  5JIU A;  1W39 A;  2XLF A;  1W2A X;  3RJ2 X;  2Y38 A;  5CB7 A;  4CSW A;  1N3O A;  2CU5 A;  1OVP A;  4XF9 A;  5E88 A;  2VPV A;  4OQ9 A;  2CGO A;  4QT6 A;  4CYD A;  3N7K A;  5DDJ 2;  2WBK A;  2PHU A;  4AG4 A;  4E8C A;  3PHM A;  5JAX A;  5HBA A;  2GND A;  4HBN A;  1X8M A;  3VDD C;  4HKL A;  4BB3 A;  3T2P A;  1TZO A;  3AJY A;  1W0N A;  2WJS A;  3THC A;  2OVU A;  3RYK A;  1MVE A;  1OLQ A;  1GQP A;  1OUX A;  5A6X A;  3HQU A;  1W8Z A;  5KHK A;  1NCQ A;  4BU2 A;  4HVR A;  4JQT A;  4IV1 C;  2HEV F;  4IE0 A;  1J84 A;  4Q0S A;  4C90 A;  4CEW A;  3AFG A;  3SCG A;  2Y26 A;  4IEQ A;  1LED A;  2I45 A;  5HI0 A;  2WKK A;  1OA4 A;  3T2Q A;  4PQQ A;  1GAN A;  1DYP A;  2XL7 A;  3JD7 1;  1IPS A;  2OX0 A;  3QH6 A;  2R0H A;  3T1L A;  3QOP A;  2E31 A;  4NIH A;  1H8T A;  3WHU A;  1ND3 A;  1YQC A;  1ULF A;  2E53 A;  3VBS C;  4DB5 A;  2OPK A;  3HT1 A;  1I3H A;  3VZO A;  1SEF A;  1NUK A;  5A7N A;  4BIF A;  1BVV A;  1DHK B;  5ABJ B;  4MV2 A;  1G9C A;  4PF1 A;  3ZSE A;  2XBO 1;  2WN2 A;  5L9R A;  4COZ A;  4NHK A;  1R1A 2;  4NHM A;  1MQT C;  5EFU A;  1NCR C;  2W94 A;  3BTA A;  4S2F A;  4JHZ A;  1S2B A;  5CKQ A;  1VBD 1;  1HJF A;  3W5M A;  1V6J A;  4LIV A;  2PLV 1;  1FNY A;  5IK8 A;  2ARC A;  1BEV 2;  2EXJ A;  3D8C A;  4Q0Q A;  1H9P A;  4RD7 A;  3ZVX A;  1MS3 A;  1SFN A;  3T2T A;  3NL1 A;  4MVT A;  2UUR A;  5BNO B;  2HYX A;  5FZ1 A;  3SH5 A;  1X33 A;  5FLI A;  3VD9 A;  1VBA 3;  5CFD C;  2A6Y A;  1OD5 A;  1EAH 3;  5JZG B;  3M4F A;  1IZ3 A;  1B35 B;  2QUO A;  2DBN A;  5IJR A;  3VB9 A;  5D2A A;  4PCR A;  4R4Z A;  4XMA A;  4Z1V A;  4GH4 C;  5ANQ A;  3KT7 A;  3RYP A;  3U11 A;  2YRO A;  4UFI A;  5CYY A;  1HLC A;  1UZV A;  5CVR A;  2YGM A;  5EP9 A;  3VHR A;  4ARX A;  3VBO C;  3BTY A;  1W8H A;  2B9V A;  4XXP A;  1IPK A;  2O8Q A;  1ENR A;  4Q0V A;  1BVP 1;  1LOE A;  1RUI 3;  1W6N B;  1O4Z A;  1FAY A;  4D3W A;  5B4N A;  1Z78 A;  3Q9O A;  3VN4 A;  1NLS A;  1JHJ A;  5CG9 A;  1RUH 1;  1GFF 2;  5F7U A;  1XBF A;  1WUV A;  1QF3 A;  2W1Q A;  4YVS C;  1CAW B;  2XL9 A;  1GBG A;  1QDO A;  5FP9 A;  5FP3 A;  4ES9 A;  4OUM A;  2DWR A;  1AF9 A;  2A6Z A;  4KNC A;  1HQW A;  1ZBA 2;  2R1B A;  2ATF A;  3JB4 C;  4M3C A;  4CUG A;  3ME2 A;  2AR6 A;  2D6M A;  1JZ2 A;  4DEV A;  1BZW A;  1CJP A;  3F95 A;  3E5U A;  1ZBA 3;  2W87 A;  2YBS A;  4I0W B;  1OLM E;  4FQZ A;  3M1H A;  5B4X A;  2VG9 A;  5A7S A;  2HBT A;  3O1R A;  1PO2 1;  1VBD 2;  1LGC A;  2V5Y A;  3CJI C;  2Q8D A;  5DUW A;  2XOM A;  1S4C A;  1YIF A;  1J83 A;  5F5A A;  1U12 A;  1JZ6 A;  1QU0 A;  5I0R A;  1QXJ A;  3T4V A;  3CMG A;  5LBB A;  1K12 A;  2PXJ A;  1WMD A;  3I2J A;  4LHL A;  2PAE A;  1DGR A;  5F8P A;  5C4W C;  1FAT A;  3RZH A;  1ASJ 2;  5EQU A;  1KFU L;  3PUI A;  4QU2 A;  1JZ4 A;  1W05 A;  3ASI A;  1RUG 2;  4E8D A;  5C8C A;  4FFI A;  4CRQ A;  2SLI A;  1AR6 3;  5B2G B;  2R1D A;  5FY9 A;  1H2K A;  3RG0 A;  3NST A;  2VQA A;  3GCX A;  5FY0 A;  3WOG A;  2A70 A;  4AI1 A;  2OZ6 A;  3AZZ A;  2H0V A;  3BTZ A;  1PGS A;  4ZHN A;  1PK6 B;  3K4A A;  1HX6 A;  1CIY A;  2QZ3 A;  4D7Y A;  1SCR A;  1J59 A;  4V2V A;  3R4U A;  3BCW A;  3BN6 A;  4SBV A;  5J36 A;  2LM3 A;  4UFK A;  1OXC A;  1XNA A;  1PGW 2;  2XB6 C;  5H9Q A;  3ZYI B;  4M01 A;  4AI0 A;  2ZX1 A;  2ETE A;  3IAP A;  5FYZ A;  1Y9G A;  3UV9 A;  5JR2 A;  3WG4 A;  1KQR A;  3BOW A;  4AED C;  4R9A A;  1OSG A;  1COV 2;  1VBB 2;  3VZL A;  3N9P A;  3HN1 A;  4Q4X 3;  3IN9 A;  3UGF A;  4UW6 A;  3VD4 A;  5LB6 A;  1OH3 A;  3B00 A;  3J26 N;  4FPG A;  1NZC A;  2HWF 3;  5EJ1 B;  4QGM A;  3E6D A;  4L11 A;  4BLJ A;  4N9I A;  1FOD 3;  2WWU A;  5C4W B;  3HQX A;  4J25 A;  5FZ3 A;  2V4V A;  1K45 A;  1SHW B;  2O0O A;  1U5X A;  4CDX C;  4U36 A;  2D97 A;  2ZKL A;  5J96 B;  1BBT 1;  3H7Y A;  5J37 A;  3AYE A;  4MOA A;  1DQ2 A;  1S2K A;  5FZB A;  1POQ A;  3TNQ A;  4FSJ A;  1XNC A;  4NIA A;  3K4Z A;  3PUQ A;  3ALQ A;  5AC9 2;  2RM2 2;  3E6B A;  5K0U A;  1RUE 2;  3B7M A;  5FY1 A;  2XXZ A;  1ZA4 A;  2R6Q A;  4Q1R A;  3MYX A;  3W58 A;  1JUH A;  1K5M C;  1V9U 2;  2JE8 A;  1ACC A;  2OUJ A;  3EXU A;  2HWC 1;  4WVM A;  2IXL A;  3N9L A;  2B7Y A;  3QH7 A;  4XDO A;  1DGL A;  4CCN A;  4OFG A;  1V6L A;  4UWD A;  5I0T A;  1QJU 1;  4HKO A;  5FBZ A;  2VCA A;  4BQ2 A;  2D5H A;  4UXA A;  3BI3 A;  4CDQ B;  5C3Q A;  4XFH A;  4FPO B;  4ZKT B;  4XHX A;  1J3P A;  1ZZ8 A;  4CDU B;  5FMB A;  2QQP A;  1APN A;  3RSJ A;  2J42 A;  4QB1 A;  3VBF A;  3ZSK A;  3MW2 A;  2VZR A;  3LGR A;  5E6H A;  1W8W A;  1Z7S 3;  2JG8 C;  1UYY A;  4ZPI A;  3K3O A;  4RS5 A;  3WD5 A;  5M0T A;  1OQE A;  1ULE A;  1UY2 A;  3LA3 A;  3VZM A;  1CAV A;  5F32 A;  1LKN A;  1R08 2;  1QNW A;  3CJX A;  2RS3 2;  3FC0 A;  1YQ6 A;  2ORX A;  1YNA A;  2VXR A;  3BUC A;  2BER A;  2BGO A;  1J3Q A;  2JDY A;  2BNO A;  3OBR A;  4OI2 A;  1MZ5 A;  2ID4 A;  4EN7 B;  4FPC A;  4YW3 A;  1XB9 A;  2Y34 A;  4TLG A;  5D1I A;  5E1R A;  3ZDS A;  3W5N A;  1AL2 2;  2DUO A;  1D2Q A;  4YRD A;  3LEG A;  4S2G A;  2QQN A;  4YW1 A;  3I8T A;  4JQR A;  1WLT A;  2VZV A;  3M3E A;  3U0Z A;  4LK6 A;  3AMP A;  4QPG B;  2XR4 A;  3ZN4 A;  2ZGP A;  3HOB A;  3VKO A;  3H8R A;  1DQ4 A;  1F4A A;  1N1T A;  3GM8 A;  5BYN A;  1JOB A;  1LR5 A;  1LU1 A;  3AJZ A;  2WAO A;  4OHW A;  4QWN A;  4XF3 A;  4AEM A;  2C4X A;  4XUR A;  2XKO A;  2BDR A;  5FUN A;  4FPE A;  3ZXK A;  2B4K A;  1EAH 1;  4NHL A;  1QMJ A;  1TNF A;  4D6S A;  4PT6 A;  3DF0 A;  2F17 A;  1R1A 3;  3QLQ A;  5CAZ A;  3PVE A;  1LEN A;  3J4U H;  2X5I B;  3AX4 A;  1OA2 A;  4UW5 A;  1PK6 A;  1KS5 A;  3QD6 A;  4JGY C;  1AR9 1;  2JX9 A;  4PDW C;  1A34 A;  5GZG A;  2DFB A;  1LCL A;  4QXB A;  5FZL A;  4CTE A;  5ABJ C;  3LA2 A;  1D0H A;  2Y0I A;  1HRI 2;  3LSD A;  5A80 A;  2OKX A;  4JGZ B;  1SDD B;  2OXB A;  1J1T A;  1VRB A;  4PBO A;  1YFU A;  4AED A;  1ULC A;  2QTW B;  4ZS3 A;  5BY5 A;  2ZML A;  5C5T A;  5F3C A;  2NPI A;  1LOF C;  1YXW A;  2XVK A;  1AXY A;  3DYO A;  4OUL A;  5FRA A;  5LA2 A;  4R52 A;  3LEK A;  4CP9 B;  3ETP A;  2QQW A;  1CD3 G;  1QOT A;  1Q8S A;  2GSY A;  2Y6L A;  4P9L A;  4AVS A;  4WBB A;  5BNN B;  4YGD A;  1HQL A;  1NA1 C;  3LIG A;  5CKM A;  3KV4 A;  5T52 A;  3PU3 A;  3ROU A;  4GA9 A;  4IGO A;  5J48 A;  1ENQ A;  2C0Z A;  4LMF A;  3ZYP A;  2ZAA A;  2W5F A;  2RS5 2;  3OYW B;  4QQL A;  2GC1 A;  4MHR A;  2PHT A;  5FXV A;  4LO7 A;  4FTE A;  3DXT A;  5E8A A;  1EUT A;  1RHI 2;  4FTB A;  5C8C C;  4A6S A;  5A32 B;  1S0G A;  1IS3 A;  2WQ4 A;  1REE A;  1XPW A;  3OJB A;  1CIW A;  2XHN A;  3ORJ A;  4A44 A;  1RMU 3;  2YMZ A;  1X82 A;  3LDR A;  2Y0O A;  2HWC 2;  4XW3 A;  1URX A;  1WCQ A;  2ZZJ A;  1S0B A;  2CWS A;  3B94 A;  4WM7 A;  1NYW A;  5JI7 A;  3S7I A;  5KHJ A;  3CJI A;  1PVX A;  1C1L A;  2QDN A;  5DXD A;  5JIA A;  3ZYH A;  2ZAB A;  1ODM A;  4NHY A;  4QD2 A;  4L99 A;  4C91 A;  1HN0 A;  5JR7 B;  3OGV A;  2JEN A;  4DY5 A;  1CJD A;  3CU7 A;  1F35 A;  3RPQ A;  3ZMO A;  1MZ6 A;  5EXO A;  4XUT A;  2O1Q A;  3THT A;  1BEV 1;  2WZR 3;  2Z2S B;  4KI5 M;  4QX5 A;  5EZW A;  1IS6 A;  5FUI A;  3RVH A;  1UPS A;  2WO2 A;  4YVS A;  5L36 A;  4N43 B;  3NV2 A;  3RZZ A;  1NE4 A;  2P1B A;  5FMD A;  2ZAC A;  1PGL 2;  4C0B A;  1UOJ A;  1XC6 A;  5DAX A;  3K77 A;  1CAV B;  1XE8 A;  5FZI A;  1HDK A;  3O12 A;  3KVA A;  3RWK X;  4Z07 A;  1CVN A;  1OBN A;  1ZBE 3;  2D3P A;  2CAU A;  1WLW A;  2QKD A;  1N3Q A;  3B93 A;  4MGI E;  4DY3 A;  5L7O A;  2OZJ A;  2RMU 1;  1MQT B;  3D5O A;  1ZBE 2;  1RB8 G;  1ALY A;  4FFF A;  1KRI A;  5FZ9 A;  3ZLI A;  2RHP A;  1TEI A;  3CNA A;  1XQN A;  4P14 A;  2ARA A;  4FPL A;  5FO9 B;  4AAP A;  4IEU A;  1RUH 3;  1TE1 B;  1HRV 1;  1VMJ A;  2GN7 A;  2ZCW A;  4GJY A;  4AHZ A;  1LU2 A;  1WME A;  3B69 A;  4X8N A;  4XF4 A;  1IQA A;  5T5J A;  2ZHM A;  1NKG A;  1YWK A;  2JIJ A;  1O5U A;  2VUD A;  3H0O A;  4E9K A;  5F6L B;  4BQ1 A;  1DU3 D;  1KFX L;  2ZEX A;  3BKZ A;  2FDI A;  4A7Y A;  4KBZ A;  1WBF A;  2RM2 3;  3E1F 1;  3ZIW A;  5JDB A;  2HKX A;  1X7N A;  2CTV A;  2LUW A;  2VCM A;  2VZT A;  1AR6 2;  3MUZ 1;  3HQR A;  3TAY A;  4CUB A;  2P5B A;  5L7O B;  5A6Q A;  1E5S A;  1MQT A;  1RVF 2;  4AAX A;  5A70 A;  4LBL A;  4J1W A;  1W28 A;  2DYC A;  2DVF A;  2X5I A;  3ENR A;  4P08 A;  1PO2 2;  1QJF A;  2BVB A;  3POG A;  4HZF A;  2LW8 A;  3JQX A;  3WQ0 A;  2VCB A;  1W90 A;  4I3P A;  5KHG A;  1KS4 A;  1ZRR A;  4JC1 A;  3PUS A;  3VKN A;  3H42 B;  1ZA7 A;  3T08 A;  2GAU A;  1RUD 3;  4A7Z A;  2A5Z A;  1RUG 1;  1H8T C;  4K40 A;  1QGL A;  1YI7 A;  3I49 A;  3AXD A;  2ZMK A;  1EV1 2;  4X6Q B;  1QQP 3;  2WWS A;  3LEI A;  5A7W A;  2QDR A;  3VHO A;  2X5I C;  4WVV A;  4COV A;  1RUE 3;  4AHX A;  1O59 A;  4BA6 A;  4H7L A;  2VVF A;  4XUP A;  1OMI A;  2V72 A;  2ZEY A;  4MGK E;  4CEW C;  2G9Z A;  2W52 A;  2R0F A;  5SV5 A;  2ORZ A;  3AP7 A;  4JKK A;  1HB4 A;  3NJV A;  4GWJ A;  3AL5 A;  3NV3 A;  4ISQ A;  4TN7 A;  1NCQ C;  2VMI A;  2JB8 A;  2XDV A;  3OBT A;  3RS6 A;  5LEJ A;  4ZU5 A;  5FWE A;  3MZH A;  4JV4 A;  3H3L A;  5A32 A;  4YG6 A;  3AM2 A;  3DPR A;  4AW7 A;  5HXV A;  4QPG C;  3C3V A;  4H7M A;  3PIJ A;  5J1X A;  4AEK A;  2G19 A;  2QNK A;  4ZZ5 A;  1JZ3 A;  1CON A;  5FYV A;  1AX1 A;  2UY9 A;  4LE4 A;  3WV6 A;  3JQW A;  4P9W A;  3MO4 A;  1F5F A;  1LTE A;  4WM7 B;  3USS A;  3ZFE C;  1U5I A;  1W6P A;  2DTY A;  4QM8 A;  4D6R A;  2WFP A;  4EN6 B;  5FJK A;  1ZBE 1;  1VBA 2;  3DPR C;  5A6Y A;  1JYV A;  1FV2 A;  1IG0 A;  1W2N A;  1COV 3;  1VBB 3;  4Y1V A;  2JXA A;  3I59 B;  5GJ6 A;  5FYT A;  5GLT A;  5FYM A;  5DAW A;  1C8M 3;  3OUH A;  2GMM A;  4AGV A;  5CFC B;  4XBL A;  1OOP B;  4DS0 A;  3I3Q A;  4K1Z A;  3O0V A;  1DFQ A;  4ZY9 A;  4DRR A;  5DAB A;  1ONA A;  1TME 1;  2P3Y A;  3A0K A;  5G04 L;  3I3M A;  4YZ2 A;  5KHI A;  2VR4 A;  3UJO A;  3KS7 A;  5F2S A;  2EAL A;  5JVV A;  4LA3 A;  1UKG A;  3LE0 A;  2NMN A;  4H3W A;  3WW3 A;  5JSP A;  1QJX 1;  2HWE 1;  1W03 A;  2WA4 A;  1PMJ X;  1GLH A;  1NG0 A;  1ZZC A;  5FKC A;  1S0D A;  2GP5 A;  4ATF A;  4PQ9 A;  1J3R A;  3AYC A;  3ES4 A;  1GKB A;  4P9I A;  1OF3 A;  5C33 A;  3VDC A;  5F9T A;  1NA1 B;  1VAM A;  2A6V A;  2WZ8 A;  3QAC A;  4NO4 A;  3WX5 A;  3OPT A;  2VMF A;  1YHF A;  2VY0 A;  2VZS A;  4XDQ A;  4LBQ A;  1W6Q B;  5FUP A;  5CNA A;  3VZK A;  2VOT A;  4BQY A;  2DVA A;  1AR7 2;  1SDW A;  2JDK A;  2VD7 A;  4XBN A;  4RR3 C;  4Q4Y 2;  5ERL A;  1OLR A;  1POV 0;  2ZX0 A;  4QPW A;  1HB3 A;  1LEC A;  4IE5 A;  3WXP A;  2JD9 A;  1ZZ9 A;  1UU6 A;  1CAU B;  3WR0 A;  4A3Z A;  1HV1 A;  2VMD A;  1CPM A;  3H8X A;  3E97 A;  4XXA A;  5FXX A;  1LEM A;  1RJ8 A;  4JVA A;  1RUJ 1;  4XHB A;  5DPN A;  5IVF A;  5F6K A;  4NRP A;  1MPX A;  2IVJ A;  5IW0 A;  4JDO A;  2V5D A;  3VBH C;  1HRV 2;  4CU8 A;  4IUG A;  4QX1 A;  1NA1 A;  5F3G A;  3MIF A;  3WG1 A;  3WSO A;  3ITQ A;  4Q0P A;  5L73 A;  3WIN E;  3W59 A;  1DBN A;  1WBL A;  5FCC A;  3OGS A;  5HV4 A;  4JKL A;  1ZZ7 A;  5FAX A;  5IWF A;  1LOF A;  3GJB A;  5DG1 A;  1V6I A;  4XJ9 A;  1AR9 3;  2W3J A;  4QKD A;  3U78 A;  2GZW A;  4Q4V 1;  2PAK A;  1MR5 A;  2BWA A;  2KXL A;  1RUC 1;  3K46 A;  1AYN 3;  4LOS A;  2J1A A;  2A3Y A;  1PVC 1;  3VD5 A;  1ND3 B;  4YNI A;  2IXJ A;  2VJX A;  3P3N A;  4XFB A;  1PK6 C;  3O1M A;  4AK3 A;  3V0A B;  4EWD A;  3SCH A;  1TG7 A;  2MHF A;  1ENS A;  5FO7 B;  2OII A;  1EPW A;  2FDG A;  2BNN A;  5A1A A;  2A6X A;  3CDZ B;  3CBN A;  2QQU A;  3ZN6 B;  5CZK A;  5IK7 A;  3AKR A;  1WD3 A;  4TWT A;  5CU1 A;  4LQR A;  1A8M A;  1AXK A;  1LRH A;  2P34 A;  3KCC A;  4BM8 A;  2Y6H A;  1XNT A;  1KJL A;  3VZJ A;  4AVV A;  1BXH A;  2WSV A;  4B1L A;  3MIB A;  1FI2 A;  2D40 A;  3ELN A;  3A22 A;  4SLI A;  2Q8E A;  3TOJ A;  4DXS A;  4EZ4 A;  4COU A;  3OBA A;  1NOV A;  1W99 A;  2FCT A;  4XAE A;  1SBD A;  4O9E A;  5GM0 A;  1WLC A;  1GWM A;  4HAN A;  5A3M A;  1W6M A;  4YVW C;  4EV0 A;  1ZVF A;  4FPF A;  3GNE A;  3FBY A;  2E63 A;  2G9G A;  3N9N A;  4NPR A;  4YW2 A;  3I2I A;  4YW4 A;  4WV8 A;  1L7L A;  5FZA A;  4AQS A;  5A33 B;  3U4X A;  4FP2 A;  2D44 A;  1VRH 1;  2FDK A;  3WQ7 A;  2Z69 A;  3H3U A;  3IBM A;  5BNO A;  5CEH A;  1Q8P A;  1DYK A;  3FUO A;  2JIC A;  4KG0 A;  4QX8 A;  1BYH A;  4CP2 A;  2EXI A;  4LO4 B;  2OQ6 A;  2CDP A;  1Y9Q A;  2WUH A;  1JZ8 A;  2DCY A;  2RDN A;  1JU3 A;  2R07 2;  2R04 3;  4A2U A;  3DUI A;  5LRR A;  1L7Q A;  4IGQ A;  3OY8 A;  3CQO A;  3RZK A;  1BJQ A;  2OT7 A;  1BQP A;  4K9S A;  4YLZ A;  3NJY A;  5GLZ A;  4RS5 C;  4PLM A;  5D21 A;  2JG8 A;  4Q1P A;  4QM9 A;  2P6H A;  2X8K A;  5ACA 1;  5GLV A;  1DGW X;  1S55 A;  1MEC 1;  1XE0 A;  3AYA A;  2BW8 A;  3RZJ A;  1M06 G;  4M3C E;  3FL7 A;  4YM2 A;  4DPN A;  2WL1 A;  4TTG A;  2FZ2 A;  4KWK A;  2X05 A;  2E9Q A;  5JOW A;  1SLB A;  2WO3 A;  2YBK A;  3H9A A;  1UAI A;  1JS9 A;  1C5I A;  1D4M 2;  1QJZ A;  2HWD 1;  4IGP A;  3H1M A;  1VRH 2;  5ABJ A;  1S1A A;  2BBA A;  2VOW A;  4JGY A;  4PDW A;  1K5M A;  2ZBJ A;  4IEX A;  5CBL A;  4MGS A;  1UX6 A;  2VNG A;  4JDM A;  1WZX A;  4BOW A;  4I3G A;  1K5J A;  5K0U C;  1UU5 A;  2IFW A;  4Q4V 2;  1GIC A;  1BK1 A;  2WA3 A;  1ZRI A;  4Y4R A;  4XFC A;  2FDJ A;  5FFO C;  3ZR5 A;  1KXG A;  2ARE A;  2EIE A;  2JEM A;  2GP3 A;  3DV8 A;  5EIY B;  2WNE A;  4NRM A;  4BK4 A;  2IZW A;  3AMH A;  5JSR A;  1MEC 2;  1WCU A;  2CAV A;  5LBF A;  3V0B A;  1MS0 A;  1YUD A;  1YYN A;  1ULP A;  4DIN B;  4Y4Y A;  5FPU A;  3L9J T;  3WDV A;  5IUQ A;  1QJE A;  4Q5O A;  4QX3 A;  1LHO A;  1AL2 1;  4XET A;  1GQG A;  1RJ7 A;  4XAA A;  2HWF 1;  2ES3 A;  4PDW B;  1H4H A;  1TNR A;  5C3P A;  1F31 A;  2ET7 A;  1F2N A;  3O5S A;  2NLR A;  3ZKY A;  4CDW B;  1GZW B;  4AVB A;  2JDZ A;  4N8M A;  4GKY A;  1CPN A;  3GHM A;  2HYK A;  1IG3 A;  1PM4 A;  1UN1 A;  1R08 1;  1Z7S 2;  4FPK A;  4IE6 A;  4NJ4 A;  1ZRD A;  4E2Q A;  3B9I A;  2WZP P;  2W0X A;  1H1I A;  3CF6 E;  1QXR A;  3WP4 A;  2ZGQ A;  2Q4S A;  1UY0 A;  4LOR A;  4YW6 A;  4N7U A;  4Y22 B;  4MHU A;  2CY6 A;  1QJY 3;  2W95 A;  1V6K A;  1LOC A;  4FPH A;  4IE7 A;  3AVR A;  4Q4W 1;  5DUU A;  5FMO S;  3VV1 A;  5ANN A;  3ZN6 A;  5I8Y A;  2BOI A;  4RHV 2;  2PAM A;  4FOQ A;  5LWB A;  1SBE A;  2VCC A;  3POY A;  4QX7 A;  5E89 A;  5FWJ A;  4HK9 A;  3ZXA C;  5JXJ A;  4S2D A;  2YC4 A;  1VB4 A;  1Y7B A;  1AHS A;  2DVD A;  2EIG A;  4XFG A;  5LW9 A;  3WDU A;  1BKZ A;  2VTF A;  1JHN A;  1PO2 3;  1GZW A;  3V65 A;  3AKQ A;  1Q56 A;  2RDQ A;  3I2K A;  5T55 A;  2XQX A;  2D6P A;  4A7K A;  1DZR A;  3ZDV A;  4YVW A;  4HL0 A;  1EYB A;  1JYC A;  3IDE A;  3U07 A;  4QX2 A;  4LKS A;  1H2N A;  5J3U A;  4GJZ A;  4BQ4 A;  2JJ6 A;  1W8U A;  2YFU A;  1ZRC A;  5FYC A;  1US2 A;  3KLS A;  3SKJ E;  1RUF 3;  1GP6 A;  1OT5 A;  4CA9 A;  5IVB A;  2C9A A;  1VBC 3;  1XSR A;  5KC5 A;  3PL0 A;  3IM0 A;  3MIC A;  1UD1 A;  4CDX A;  5F5Q A;  1SBF A;  1W3V A;  3JBG 1;  1SLT A;  1GQH A;  2VBP A;  1WCS A;  2R06 1;  2HWB 1;  4AI9 A;  1F4H A;  4D7S A;  2ZAH A;  3C8X A;  2I07 B;  3BU0 A;  3D6E A;  2VME A;  3VBF B;  4Q26 A;  5H9P A;  1PVC 3;  3ZOI A;  1MVQ A;  3EMR A;  4NAO A;  5DZE A;  2RJ2 A;  3I2H A;  2VEC A;  5T5P A;  2EXK A;  4FOY A;  4M0H A;  2MNG A;  3A23 A;  2D6O X;  3C7H A;  3WG3 A;  2R07 1;  2CHH A;  3SQO A;  3WZ1 A;  4D69 A;  1COV 1;  1VBB 1;  5F1R A;  5IYY A;  5LA1 A;  4ZON A;  4GH4 A;  3WUD A;  1X8E A;  1G9B A;  3HEI A;  3J7M A;  2BP6 A;  3OG2 A;  1SFP A;  2TBV A;  3A4U A;  4K20 A;  4UOJ A;  1W2O A;  2XGX A;  2ZHK A;  3ZX7 A;  1UW8 A;  1WW4 A;  2GN3 A;  2XVG A;  1I5P A;  3FLP A;  3K2O A;  4IE4 A;  2WYF A;  3W9A A;  4CEY B;  1A78 A;  1LAJ A;  1IKP A;  1VAK A;  3ACG A;  1JYI A;  1LOD A;  2JKX A;  3SH4 A;  3VBS B;  3SXW A;  3WY6 A;  2Y6F A;  4CU7 A;  4AGR A;  3VD3 A;  4AF9 A;  2HEY F;  3N9O A;  1S0E A;  1REF A;  1RL3 A;  5J7M A;  4LIU A; 
#chains in the Genus database with same CATH homology
 1VMJ A;  1VE0 A;  2P6H A;  1VMH A;  1VPH A;  2P6C A;  1XBF A;  2CU5 A;  1VMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...