1VECA

Crystal structure of the n-terminal domain of rck/p54, a human dead-box protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight of human DEAD-box protein rck/p54 into its substrate recognition with conformational changes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords ATP-dependent RNA helicase p54
total genus 66
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vecA00
3L82B 3AF2A 1YR8A 1Q1EA 4NYJQ 4LV6A 4GOJA 1KI9A 2IYZA 3MWLA 5FOSA 1FP6A 3QENA 4MRSA 2DFLA 2JDID 3X1YA 4MRVA 1MRSA 2P3SA 2O0JA 3B9PA 2IYSA 4JBYA 5JJIA 4B2LA 2BBSA 1W2GA 5HPYB 1OH7A 4LZZA 5E7IA 1TQ4A 4C0HA 2NPIA 4Q9LA 2W6JD 2QE7D 2XNDA 1OIVA 1E2PA 3WNCA 2J0SA 3AKEA 1G5TA 2GA8A 3C4JA 4URZR 4TYQA 1D2MA 4ZDIA 2R6AA 3RC8A 4JLOA 5HCNA 1RYHA 5CJ2A 2Z6VA 1E9FA 5AR1A 3EZ9A 4V0OA 3J81k 2WPDD 1G4UR 4IW3B 1TF2A 1W2HA 4JIMA 2DCUA 1Z5ZA 4WA7A 3BH7A 4O25A 1KK2A 2KB0A 5FOVA 1EX6A 2VIIA 2A5DA 2CL7X 4FMBB 5TV2A 2ODEA 3I1FA 2ORVA 4TYWA 4XD7D 2UVQA 1U90A 3W3AA 3VR1A 3O47A 4WW0A 3X1ZA 1OXXK 2WICA 3ZIAD 2ZRCA 2YHSA 1IOZA 1W44A 2CBZA 4O2RA 3QIAA 4BFYA 3THWB 1AKYA 3NIBA 1U0HC 2IUTA 1NMXA 4IVQA 3VKHA 4GZMA 2ONJA 2JATA 2NQ2C 3FE2A 1KMHB 1ZIOA 2C04A 1RJ9A 3UMSA 1I4TD 3K70C 1NL3A 3Q3JB 1GL7A 2H1LA 2EFDB 2XXAA 2ODNA 1NVWQ 2J0QA 4M9ZA 2CVFA 1R8QA 3B2EA 4ERNA 2GBLC 5FI1B 5IRCD 3BC1A 2ZJOA 3U44B 4B47A 2IF2A 1S8FA 4QHTA 2WSSD 5J4YA 2WAYA 1ZC3A 4RD6A 2EYQA 4JLJA 2GXUA 2VHQA 3QE0A 4LHVA 1KJZA 3IO5A 4HEJA 2OT3B 1Q44A 4YONB 4ACAA 2FPLA 4PHFA 2QQEA 1CTQA 3DVLA 3WP0A 1DS6A 4GL2A 1TL7C 3ZVLA 3KQLA 1NLYA 4HDCA 4TLDA 1ZM4A 2C03A 5JWRA 2FJUA 4HATA 1KYIA 4A0GA 3W6OA 4D0NA 1D8TA 3RANA 2D2FA 2R8RA 1GL9B 3GJ4A 4Y0AA 2WKQA 3OE7D 4C9BA 1ZVQA 4PO9A 1E99A 2QAJA 1VMAA 2EU8A 1XEXB 4PPNA 2B7BA 5FPYA 4K8OA 4D4KA 3UKDA 2GJ9A 2ANBA 1SHKA 5EP4A 5F98A 5AJVB 3Q7QA 1T5LA 3BFKA 1SKYB 2WWXA 1VTKA 3WNBA 1E9SA 4FMCB 5AJYA 2V54A 3GJ8A 1OB2A 4M1TA 2QN6A 1Z2AA 1YQTA 2REOA 3AB3A 2WJYA 1CR1A 2CLCX 3U7EB 2PEZA 3WMEA 4FW9A 4RKEA 2WWFA 4I1UA 4FMDB 1PUJA 3VU9A 4IJMA 1Q1BA 1XCMA 1XX6A 1KO7A 1XTJA 4PAQA 2HYDA 4ZI2A 1E2EA 1SGWA 3N5CA 1X1SA 4D4JA 4K46A 4PSKA 3W6PA 4NMMA 2RB4A 5J40A 2RGCA 1RYFA 3AKCA 1P60A 2VHJA 2WJIA 3EAQA 4YMSA 4BECA 5KHOC 3RS5A 3S1AA 1W36D 1YU9A 1BO6A 5L3QB 1XTIA 2G0TA 2YWGA 2ZJ2A 3QI2A 1YVDA 1QHIA 4OI4A 3QXJA 1EFRD 2DYKA 4DC9A 2O8EA 4LY6A 1RRGA 3LBHA 2G9NA 4Z54A 3MJHA 4AYWA 2ZUDA 2JLQA 3THOA 4UXIA 4WIAA 2GF9A 1TQ2A 5DN6A 1NN5A 3UPUA 2YOGA 4BQSA 2AD1A 2O52A 2GEUA 4ACBA 4MKIA 1QRAA 5FTNA 5JI2E 1OH8A 1KI4A 4PAMA 4B75A 3GLHE 1Z47A 4Q7JB 2J0UB 1SVWA 2WBLC 4Q21A 4AD8A 4YMUA 1GOTA 4BLTA 2R9VA 1AS0A 1P2TA 2HF8A 2FN4A 3MAAC 3K0FB 3AF1A 1KI3A 1UEIA 4Z1MD 4TLAA 2F43A 1KSFX 1S9HA 1COWA 3GEIA 4XSHA 3LAWA 3R9IA 4B6EA 1E0SA 4Z8YA 4PZZA 2O8CB 2JDIA 1OFHA 1UBGA 3I72A 2N46A 3QF4A 4TYNA 2QPTA 3OZXA 1P9RA 5F3WB 5BN4A 3LA6A 5FUWA 1KHTA 1UKZA 5E95A 3AF3A 3DKPA 5KYKA 4S2EA 5D3MB 1W0JD 1X3SA 1JR3A 5AK0A 2IS2A 3ZS9A 1XDBA 1COWD 1BYUA 1H65A 1SKQA 1DAFA 3BE4A 2CL6X 2Z83A 5CM8B 1NIPA 2WOOA 2ZRJA 4B3GA 1WF3A 1G3QA 1R0ZA 1VPLA 5AUPB 3EA0A 4M1WA 2GK6A 1Z08A 2GCNA 2H18A 5C4MA 4PHGA 1E2FA 2VF8A 4B74A 5KDLA 4A9AA 5C46F 1DOAA 1L4YA 1V5WA 2J7PA 3OFND 1E9AA 4QKQA 1F2UB 4Q00A 5AUOB 4F38A 2ZPTX 1R0WA 2V9PA 1G3IA 1ZBDA 2WWGA 4Q1AA 4JKIA 3RS3A 3SJZA 3LVQE 4UQOA 2C5LA 1US8B 2YVUA 2ZREA 3BJIC 2YWFA 1Y63A 1I2MA 2O8DA 4L15A 2HJVA 2OG2A 3CRQA 2OFOA 5JRZA 1KKMA 1GKUB 3P26A 1OFUX 3A4LA 3LWNA 2ATVA 3SN6A 4US0R 4QNRA 2WJVA 2V4ZA 3ICQB 2W6JA 2IXFA 4ZCMA 2XGJA 5H1YA 1TF7A 3NDPA 3OE7A 2ZE5A 4FMDF 5FTLA 2VP0A 3MCAA 3E5HA 1A82A 3Q72A 4KBGA 1MO4A 2AK2A 4HUQB 1ZNZA 3REGA 3PFIA 2X2FA 2KWIA 3ZVRA 2ZYVX 3OAAD 4S35A 2N1BA 2ZIAA 4LJ9A 5JMTA 4HAXA 1QHGA 1T91A 2BKEA 2HF9A 2Y8EA 2BMDA 4FCTA 4KSCA 4Q9HA 3ADDA 1N5KA 1QZXA 2C98A 4YMWA 3TSWA 3WHKA 3R20A 2DFNA 4BFXA 1CBUA 5EE5B 3KB2A 5FL7A 1IJEA 4QRHA 3BS4A 5DH9A 1Z0IA 2GWHA 4GT1A 4TQ9A 1Z3IX 3TH5A 4QJ3A 5G41A 1KI7A 1J7KA 2FSHA 3Q5DA 4FCVA 4OQLA 1NKSA 2BOVA 3FDIA 3R7WA 1KMQA 5TB5A 2ASEA 4PC3A 2WSMA 3VKWA 2W2VA 1G20E 1DARA 2BJWA 2PT5A 4LHXA 5D3MA 3GJ5A 2R65A 1XRJA 4B3CA 1U98A 2ZITA 1JAIA 1ZM7A 1WDTA 3DM9B 4NCIA 2ZJAA 4I1SA 3BH0A 1EX7A 4A0RA 5BYKA 3EARA 4ARZA 2IYUA 3RAPR 1XU4A 5LB4A 5DI3B 2OFWA 2JJ1D 4KODA 3ZGXA 3MRSA 3T06B 3C16C 1UDXA 3TR0A 3GFOA 5L3QA 4PC1A 4EJSB 4LBYA 3AV0B 1IN6A 3W8NA 1MO3A 3FVQA 1JJ7A 2CJWA 4TLCA 5BXQC 1F5NA 1N3BA 4PC7A 3EW9A 1ZC4A 4LC0A 5A0FA 1QHHA 1RW4A 4NCNA 3W8RA 2QA5A 3VNUA 1JJVA 4HLCA 4CEIA 2A5JA 5FPTA 3Q85A 1KK1A 2VA8A 2FF7A 1NMZA 4URYR 3KKMA 1P62B 3NTUA 4GI7A 2ZYUX 1NN1A 4LJ7A 2BHRA 2OBNA 2IXEA 3BORA 3I5XA 3Q7PA 2VSXA 2QE7A 3NBFA 2OCPA 2ZRNA 5KSPA 1E6CA 2R6CA 2PT7A 5EE3A 2FU5C 1SHZA 1ZU4A 3QQ5A 2ZE6A 4JZKA 3CRRA 3RLFA 2PEYA 4OJKA 4NZYA 3SEAA 1US8A 1U9IA 1D2EA 4RD1A 3RS7A 3THYB 2PZGA 4CRWB 5CIQA 2KJQA 1O87A 5KUTA 2V6IA 3PVSA 4POAA 2AXPA 2Z43A 1JB1A 4RCZA 1HYQA 3ZH9B 4DCSA 4F93B 2ZRHA 3D7MA 4OYHA 4DIEA 4JL5A 3PV0A 2XTNA 2FA9A 1HH4A 3E1SA 4O0MA 5FFMA 3C5HA 4Q4HB 4B35A 3C7KA 3LNCA 4Q4JB 3P4XA 1XD9A 1D5CA 4JJKA 3WY9A 3LD9A 2GBLA 3EC2A 4F92B 1TPZA 3LW8A 4G1UC 4LYJA 1N6IA 4N0EA 1W5SA 2XB4A 5L3SA 4N1AA 1Q21A 2GESA 3QVUA 1ONBA 4IFEA 4DSUA 2FG5A 2IYTA 4X8HA 1KTVA 5SZIA 3WP1B 4DSNA 2BMJA 1VDZA 1JR3D 4P4UA 2WTUA 5EUMA 3CX8A 4Q4AA 2P5TB 1EK0A 1WRBA 3K0FA 1AN0A 1NY5A 2YC2C 2ZRLA 4OHZA 2QPAA 3HWSA 1DTSA 5GJBA 2H8KA 2HCBA 3B5JA 4ON9A 4UNPA 4XVQA 5EP1A 3LLUA 1UF9A 3RRNA 3U61B 4TMTA 4ZO4A 2NTYC 4AYXA 1ESNA 3AVYA 3K09C 4OI2A 4D25A 4TWZA 1NG1A 5EE1A 2QP3A 4M8NE 3ICEA 4QHSA 2FEOA 4R98A 3LBNA 5EZ6B 1E0KA 3OEHA 5GVSA 1YR9A 4OKSA 5F9FA 1ZD9A 4LJAA 2QENA 5C1BA 3WMGA 3SR0A 1J2JA 2DB3A 4Q9KA 2FNAA 2GJAA 2HLDA 1SXJD 2PCJA 3FB4A 4MDFA 5B58C 4CF7A 1CJUC 4AKGA 1MR3F 3AVUA 4EQ6A 1DBSA 3UWKA 2FGJA 3A4MA 2W0SA 3K9HA 1MABB 1OE0A 3GEEA 3QKRA 1G5RA 3FKQA 5LD2C 1XZPA 2QZ4A 3CH4B 1EGAA 3U3JA 5EXXA 4PC2A 4ILEA 2OAP1 2ZJ8A 1VCOA 1Z83A 4M9QA 4MGKR 3EIEA 2XZLA 1N6LA 1QHHB 2WIAA 3WRYC 2IS6A 1BKDR 4M22A 5FOXA 1G64A 4I4LA 1AGPA 3FHCB 3B60A 1OJLA 2AFHE 2QT1A 2F1RA 3D8BA 3AVXA 5EP3A 4JT2A 3QKSA 2OXRA 4XTCS 1FZQA 2TMKA 3QOFA 4PFSA 1N5IA 2GILA 4A2PA 4W5JA 3A1UA 2I4IA 4URUR 4XTRA 3U2QA 4LBZA 4P31A 2LKDA 1GRRA 1VCNA 3L8ZA 3NEJA 3EG5A 4KCGA 4MITA 1X6VA 3GLFA 3GJ6A 3LO5A 3N2EA 2CK3D 5L3VA 3RABA 2RMKA 1R4AA 2P6NA 1YJ5A 3CPHA 4B3DA 1JBKA 2D3WA 3SBEA 521PA 1IXSB 4BFUA 5FUVA 4WZ6A 4CEIB 5E7JA 3B82A 2GTPA 2VHCA 3ZVNA 3DEFA 3QKRB 3NBYC 5FTKA 3CB4A 2ECKA 2ZRPA 4I99A 2JIZA 4HB2A 3VU9B 4QGGA 2CNWD 2X1VA 1ZUIA 4M9XA 4IOMA 2QGZA 3NBZC 3UXMA 3VX3A 3V00A 1NF3A 2H17A 4WZBE 2VSFA 1MO6A 5ANRB 5KPDA 1CRQA 1U8AA 4EPWA 4DXAA 2RCNA 2C78A 2ORWA 3B6EA 3TK1A 1RKBA 2FSIA 3NEYA 4M9SA 4WBSA 2G83A 5DI3A 3HR7A 4KV9A 2Q0HA 1U8ZA 1CU1A 2P65A 4C4PA 4TMVA 1G8YA 4DDUA 2IWRA 3EZ6A 3SQWA 1TUIA 2B8TA 2ORIA 1OIWA 3IILA 3L0IB 1B0UA 2EFEB 2E1RA 1N6KA 2PZFA 2HEIA 3CUEF 4OL0A 1G18A 3IPXA 1Z0DA 4DLYA 3Q9LA 2VHTA 4Q1BA 2QPOA 3K8YA 2G6BA 4US2R 2B6HA 4N0DA 5CB8A 3GLFE 2QGNA 1T8TA 4MGIR 4R9UC 4LJ5A 3SBDA 3CKLA 4WXPA 4RVCA 2LCFA 5F2EA 5FR2A 2SHKA 3VX4A 2WMOB 4JYCA 3MJRA 3B1YA 2OLKA 3ECCA 2XX3A 3KFXA 3HP1A 3KQHA 2QMEA 4JYBA 1T0JB 1E98A 5EQTA 2F1JA 1OXSC 2NO6A 1YZLA 2IX3A 3SJAA 1J8YF 1II8A 4US1R 2CXXA 1H8HA 1DAKA 2GRJA 1SVOA 2OM2A 1P6XA 4URVR 4TSFD 4MYHA 4Q03A 4DLRA 2DR3A 2QBYA 4JSTA 1NJFA 3QPUA 5G3YA 4JJZA 1GVNB 4DVGA 1ZUNB 4XIGS 5TMPA 3KKNA 5C4GB 5DGXA 4BFTA 1E3MA 2XSZD 1EFRA 2GJSA 3ZYCA 1CXZA 1WCV1 1XD2B 3NXSA 4FIDA 3VR5A 2BVNA 3EASA 3QKUA 4Q9JA 2W6IA 5JS8A 1KAOA 2IYWA 2RGGA 1G7TA 1NJGA 3FYHA 2CEAA 4U7DA 4PHHA 5JWHA 3HR8A 4LC1A 4A92A 2XNSA 4B2PA 3CM0A 4XH9B 1OSNA 2BJVA 2AHOA 2C2HA 4DT1B 3IUYA 2JLZA 2J0VA 4LJ4A 5KSYA 1ODFA 2XITA 1Z6YA 2PZEA 3ZVMA 5DSZA 1OYWA 5CK5A 4WAUA 3L0OA 5IHPA 4UJ3A 1P4SA 1ZM3A 2XNDD 2ZRAA 3CWQA 2GHIA 4NYJR 4M1MA 3V4FA 1KSJA 821PA 2Z4SA 1NNEA 3KX2A 4ASUD 2K5UA 3RRZA 1OLOA 4BFVA 1DE0A 4A6PA 4WXRA 2B92A 2H16A 4CT5A 3SS8A 2RGNA 1S9DA 2AKAB 2HCJB 2ZJZA 5G3ZA 2VLIA 3RDPA 3EZ2A 1JI0A 3W90A 1GRQA 1A1VA 3BFVA 1FX0B 3FMPB 1XMIA 2G0NA 4PC6A 3AVPA 1G6OA 4CT4B 1UBCA 2CLDX 3BB1A 1HA3A 2ZR7A 3EWSA 4DSOA 3R7WB 4C3ZA 4RFSB 3QBVA 2IHBA 1U0LA 1JQJC 1MO5A 4D80A 1AGRA 3QG5A 3QBTA 2AK3A 2OAQ1 3AVWA 1ZAKA 2WJJA 3A1TA 3KJGA 1H8ED 1DO0A 4MUBA 2H5EA 2QM8A 5HR5A 5JS7A 1M34E 1Z06A 2HXYA 4ASUA 1CS4C 3F3YA 1Q57A 2Q9CA 4OQFA 1VG8A 2FZLA 2ZI4A 2YJTD 3P20A 4NDZA 2FPKA 5DYGA 5BN5A 2BCGY 1NSTA 1X8LA 1XPUA 3P1JA 4TMZA 2RGAA 1NBME 3W3ZB 3RHFA 3N2IA 3ZZTA 3PUVA 1CEEA 1M8PA 5G40A 1UBEA 4C30A 5FBQB 1L8QA 4OHXA 2JCSA 2C99A 1GIAA 2J87A 2F1HA 1R0XA 3U3KA 2ZE8A 3VMFA 1S1MA 3HPRA 4LJ8A 4V0ME 5CDFA 1JQLB 4A82A 5SZKB 3R8CA 1D9ZA 1ZMXA 1Z63A 1KI6A 3DOEA 4JBXA 3UANA 4GOKA 5HE9A 3CF6R 3DMNA 2FOLA 3I5YA 5G53C 2P2LA 2OO7A 4B3XA 3VFDA 3KXKA 1YZKA 1RPZA 1IONA 2HUPA 4Q1CA 1G9XA 1RE0A 1OHHD 2I3BA 2JJ2A 2CL0X 1R5NA 4PX9A 1KZGB 4UNSA 5FPSA 3BH6A 2ZE7A 1ZD1A 4B33A 4KYUA 2GVZC 3T1QA 3WRXC 2W6ID 3QF7A 3WNDA 4JSYA 4QNMA 3I32A 4JVMA 1SXJB 4LGMA 4OK3A 1KK3A 1IXZA 4OBEA 2WJGA 2NO1A 1GTVA 2ZSDA 1RRFA 1IXRC 1IY0A 2EFGA 4JKYA 2JJ8A 1LV7A 1WMSA 1XP8A 3KZ1E 1TMKA 1FFHA 3VQTA 1CJMA 1M2OB 1I4LD 2GEDA 2ZI3A 1DO2A 1P3JA 4CEJB 2OV2A 1ZUHA 4GMDA 3TUIC 1TF5A 4JVNA 3KUCA 4RZ2A 3V9PA 4M53A 3KKQA 4LPKA 4PQRA 2F1IA 2L0XA 2GZDA 2BM1A 3ZZUA 1NN3A 1S2MA 3EZFA 5LB2A 3K70B 4B71A 3OAAA 5AJXA 5DE3A 2ZU0C 4NONA 4M1SA 5KDOA 5FTMA 3QXSA 4BZQA 3CRW1 4QXAA 3SI7A 5CK4A 1DADA 4QM7A 5FBRB 4KHZA 4XWOA 1E94E 1G4AE 1KNXA 2XTMA 1F48A 1ZM2A 3GPLA 1F6BA 1IY1A 2VTKA 4D6PA 1R0YA 4B2IA 2W0MA 3QKTA 1JR3E 4QFMA 3FOZA 3KJEA 1SXJC 4EIWA 5HE8A 3W34A 3TIFA 2QEQA 5EXSA 1G1MA 4HDOB 3H1TA 4GZLA 3ZZ0A 4LBVA 4HUTA 3IPYA 2CCGA 1KDRA 5A4JA 1CLUA 1ZU5A 3REFA 1XFAA 1G6HA 3DKVA 4EJSA 4LUCA 1E1RA 4YDHB 1KO8A 1N6RA 4L8GA 4CZ2A 1E2LA 1RJ9B 3IBYA 2VSOA 4PTLA 4XWKA 1KO5A 1JECA 4HLUC 4QGFA 2OHFA 3BB3A 4A15A 1YE8A 4NCKA 4W5WA 2REBA 3NDBB 3TKLA 1QVAA 3RS4A 1Y3AA 2QSYA 1Z8FA 4KLNA 2RHDA 2ZRIA 5FPKA 3LRPA 2UZ3A 5FBWB 1E96A 2QL6A 2QSZA 5ELXA 1HUQA 3LQRA 4ZI3A 3SC3A 2ZUCA 2JLXA 4MRRA 3GJ7A 1RC8A 1OH5A 2J46A 4ESHA 2J9RA 4V0MA 3FHOA 4NU0A 1XMVA 1KAGA 1WBBA 3U5ZB 2CK3A 1TQDA 2Q21A 2UZIR 4AKIA 3K0EA 2C9CA 1VHLA 4UXJA 3S1AB 3GP8A 1EESA 1PVOA 1W36C 2AWOA 2ZTSA 4BRUA 2YZ2A 1E9DA 1UDWA 5H8WA 4G5SA 5FOUA 5TARA 4RZXA 2NZ8A 5J47A 1NVXQ 1XZQA 1P2UA 5J4HA 2JA1A 1H8EA 3A37A 4V03A 1JXOA 3K9LA 3MFYA 3P32A 1IN5A 2AR7A 1TU3A 1JEEA 3FMOB 5AWFC 3UATA 1DVRA 3PUWA 1BIFA 2QQ0A 2X8AA 1GL6A 2BBOA 2WWHA 1ZCBA 4GNKA 3TGPA 4PANA 3SJCA 3TUZC 2IUUA 3K9GA 2WV9A 1LS6A 2HLDD 3TAUA 2QRZA 2XZOA 1QG4A 4ESVA 2J0UA 1SKYE 4W7SA 5FUYA 1EFUA 2FFQA 3BK7A 3V4RA 2ZVQX 2EWWA 1IJFA 4R2HA 3QUSA 5BN3A 5K8UA 1P5ZB 5KO2A 3CLVA 1LVGA 5JWOA 1CJTC 2NO9A 4BRWA 1P75A 1EFCA 3QXHA 1NVVQ 3B13B 2G77B 5GJVC 4BASA 2HT6A 1NG9A 3NH9A 3TVDA 3VHLB 1CULC 1NSFA 1Z07A 3ZD7A 2RGNC 1GUAA 1MT0A 3AGQA 3TE6A 5EP2A 4PR0A 4NBSA 5HCIA 4KYIB 5EJEA 1EFHA 2ODBA 1T9HA 4M0LA 2ZRBA 1UKEA 2RGDA 4HZUA 1ZNXA 3UMRA 1NI3A 2VPPA 3FKSD 1G3MA 2GAOA 4C0AC 4P0TA 3BRWD 4L4UA 1VECA 4NHOA 2JAQA 3UWOA 4BEJA 5KU1A 4URWR 2FEMA 3THXA 1VYTA 3IIKA 1F2TA 3WYFA 3ZLJA 2KSQA 2H7VA 5L8VA 4FINA 2FH5B 1W4CA 4MQBA 1XEFA 3QF4B 3CH5A 4MGZR 2ZS8A 1S3SA 2YC4C 3L0PA 4MH0R 2DBYA 1P73A 1ZP6A 3A1SA 2PMKA 2FGKA 4DLUA 4IEEA 4PQYA 3IO3A 5IDVA 2ZRMA 3CW2A 4P4TA 4IOKA 2Q3HA 1W4BA 1N5JA 4HB0A 2VH5R 4JL6A 2VEDA 4KU4A 4XJXA 1K5GA 1E2QA 1KIMA 2ZQ5A 3NHAA 3TMKA 3CWZA 1NKTA 3AGPA 4FXPA 2A5FA 3DO6A 1AZTA 4TTRA 4FI3C 1TEVA 3K0SA 2CLSA 4BFSA 1XNJA 4WVFA 3U6KA 1XCGB 1PJRA 1KSGA 4IDOA 3CBQA 3LLMA 4HAWA 1GKYA 3SQXA 4D2IA 2AX4A 2ZJBA 4BPBA 1W0KA 1E2DA 4BWYA 2VP5A 4C0LA 1J8MF 4DDTA 2O0HA 1UKVY 2WWWA 1A2KC 4JMPA 5TXGA 2BIFA 4QOSA 4WZAE 2ATXA 1DAMA 3PITA 4RFSA 4MA4A 3TSOA 3CR7A 3KXLA 1AA9A 3IHLA 1SVKA 4P4SA 2BBTA 5AJZA 4DSTA 3I8SA 2AFIE 3KTAB 3SOPA 4TL9A 2QY9A 4QHYA 3QXXA 4JLDA 3T15A 4IDPA 1W36B 3GLIA 2O8FB 1T3HA 1WQ1R 1QHXA 4W5HA 4A8JB 4BGDA 2PH1A 3WYGA 4KO8A 5CITA 1X1RA 2YOFA 5DN6D 3UG7A 3VNVA 2C96A 3O8DA 4QJ4A 4BE7B 2IBMA 3H2YA 3FMFA 3X1DA 1IN4A 1RIFA 5DI9A 1IM2A 3O8RA 3AVTA 3FPAA 5FI0B 8OHMA 1XBTA 1FQKA 4KI0A 3ZQ6A 4G5QA 1RZ3A 2VHUA 2Z4RA 5FTJA 2NMVA 2W00A 2VP4A 3AVVA 2OCBA 1G291 3SNHA 2QUZA 3PR1A 5CYOA 4ZDKA 3EC1A 5E7MA 4HZUB 3ZJYA 1E2GA 2HJGA 2OCAA 1KI2A 1AZSC 2IHYA 4E22A 1E2KA 2VP6A 2CDNA 3LXRA 4O2LA 4C0KA 4MGYR 2LKCA 1XXHA 2VP2A 2P0EA 2WOJA 3EA5A 4PZLA 1ZINA 1F60A 1QHSA 5KTYA 4KFTA 2YWHA 1XD8A 4F7WA 3U7FB 5FR1A 4QBFA 4ARZB 5FBLB 4RZ3A 1HEIA 1DELA 1EXMA 3C41J 4QG7A 2QBYB 5BW8A 4XOIA 1L4UA 3ASYA 4OHVA 2V3CC 3WYAA 3MWKA 1FL9A 2QMHA 3EPKA 1RFLA 2KI5A 1TAGA 3BGWA 3OIYA 4DWJA 2ZSAA 4F4IA 1OXVA 2ZS7A 3CONA 2O8EB 3SHWA 2P6RA 3T12A 1UFQA 3I4LA 1OKKA 1KGDA 1WA5A 3RWOA 4A0FA 5LDDC 3ZQJA 1OXUA 4DHEA 3TW8B 4AI6A 3F8TA 2CE7A 4DEXA 1IQPA 4URXR 5D3QA 5EZ5A 1KI6B 2ZJYA 3IEVA 4PO1A 2BEJA 1EG7A 3PENA 4TMXA 3AF0A 1UAAA 1Z0AA 4M1OA 4QJ5A 1NLZA 1YZUA 2QT0A 3SYLA 1SVMA 3T35A 3GLIE 3CNLA 3DMDA 4ZDWA 4R2IA 3AVOA 4BLOA 2XB2A 4LI0A 1E9BA 4CIDA 2IYVA 3AP1A 1KK0A 4Q1DA 2FDCA 2ODWA 4GFDA 4LYFA 5JSZA 1RRPA 1YZNA 2WPDA 4UNQA 1LY1A 3G5UA 4B44A 4TT3D 5JI3E 2IA5A 4AKEA 2J1LA 2IC5A 3KKOA 4AG5A 1G8GA 1N5LA 2IYRA 3E70C 4LCBA 2LWIA 1Q1ZA 4AKHA 1KZ7B 2OBLA 1SVIA 3MMPA 2EWVA 1T3SA 1KDOA 4P32A 4Q02A 2NO7A 2Z0MA 3IDQA 1U9IC 2NO0A 4HZIA 1BMFA 5DHFA 4EUNA 2WWYA 2G1KA 3IHWA 1ZM9A 3C15C 3VTKA 4G5RA 3GJ0A 2OXCA 5LPNA 2G3YA 2QNRA 3AH8A 4ZV4A 4X8OA 2XZPA 5DNYB 3NHBA 4L9WA 4QM6A 4AC9A 4Q1EA 4E03A 3KFVA 4LHWA 3PCRB 2IEYA 4LHYA 4A2WA 4CYMA 4DEYA 3M6AA 4RFVA 1MV5A 3THXB 3JVUA 1BOFA 1Q1QA 1QF9A 3PUZA 4Q48A 1FQJA 3CZPA 3OEHD 1IN7A 2QAGA 4BUJA 4DRZA 2ZRDA 5B30A 3B8HA 1LF0A 2RGBA 3JZAA 3KQNA 1XD2A 3PUXA 3DL0A 1OXTA 1YZTA 2CJWB 4M21A 2JASA 4Q4LA 1A2BA 4LOAA 1XEWX 1T8UA 3TBKA 3AM1A 4RD0A 4HAZA 2YKGA 2PL3A 3FFBA 5JEDA 3U3OA 1E1QD 2O0KA 3BBPA 1FNMA 1UBFA 1AS2A 1W46A 2VF7A 4IVPA 2DPXA 4IFBA 2R6GA 4DT1A 2BCJQ 4I1VA 4HAVA 1EFTA 1VCIA 4KXFB 5L3RA 3U4QA 5SZHB 2MMCA 1II8B 1DAEA 4JLNA 3OIWA 1J99A 1CKEA 2QTHA 2X19A 3D6TB 1XTQA 4UXHA 3PXGA 2D2EA 1QVRA 3T1TA 1VIAA 2EFCB 2F3TA 3W9YA 2OLJA 5GJCA 2FSFA 3QG1A 3QNUA 1OPXA 1Q3HA 4TQAA 4V0LA 2RHMA 5HZKA 2IW3A 3KB1A 1M6NA 1TQ6A 5DLQC 1LFDB 1MOZA 5FUXA 3NBXX 4KFUA 4G0NA 2CHGA 1R7RA 1E2IA 2N42A 2BC9A 1JNYA 5JJLA 2RAPA 2ZEJA 1G8FA 3EPHA 3LBIA 3CRMA 3OF5A 4UKDA 1KO1A 1UADA 4BFWA 4NYIR 1PLKA 1IAQA 4KLZA 5B64A 1VHTA 4C0QC 3U60B 3SU8A 1GRNA 5FOWA 5HKKA 2JLYA 3CF0A 3M0EA 3H4MA 2G1JA 2OBMA 5KNDA 1FMJA 2FPMA 4DLXA 5LBIA 3QKSB 1N0WA 3BWDD 4HUQA 1AS3A 2V8OA 4YMTA 1W0KD 3K70D 1SXJE 3IIJA 5FOTA 1KMHA 3ND8A 4LV8B 3W5JA 3W6NA 1Q0UA 1Z2CA 1FMLA 4CGZA 3SYKA 2GJKA 3SFZA 1KJYA 1U8YA 3Q5EA 1OB5A 3GJXC 2JIZD 4KSBA 1E2NA 1SQ5A 5GJWC 4F91B 4MKHA 4EFMA 4OK5A 1P72A 2ZETA 4HB3A 4HSEA 4QC2A 3DHWC 2WZQA 1T6NA 1UEJA 3I73A 1A4RA 4NYMQ 2IS4A 3CX6A 4D4MA 3U44A 3RC3A 4HAUA 4P33A 1LW7A 5JCPA 4RD4A 2ERYA 1Q20A 1KY2A 5EUQB 2NG1A 4D0LB 3C14C 4D81A 1G7SA 4A1FA 1P7CA 4Q7MB 2CVHA 4MRPA 1Z0JA 2DFKB 4TLEA 3LX8A 2GJ8A 2IYQA 2REXB 4PPGA 5E3HA 1CRPA 2ZM5A 2XJ4A 2PX3A 2AWNA 2DWOA 2WM9B 4PPQA 3VKGA 2GAAA 2VP9A 4PXAA 2GETA 5HZHA 3MGCA 2YV5A 1CR2A 5UKDA 3KJHA 1Z6TA 4XSGA 2F7SA 3BXZA 4JLMA 4ZPXA 2CHQA 2J45A 2PCLA 1G3UA 4Q7KA 3DDCA 2IUSA 3GLHA 2F9LA 3N70A 1P2VA 4Q9IA 2A3RA 4D0GA 4NKRA 3A6PC 1YHNA 3B78A 1L7VC 3TQFA 3UK6A 1E4VA 1KJWA 1N2CE 2WHXA 1VG0B 2EYUA 3L8YA 2PLRA 2DFTA 2D7CA 4Z8XA 4ZKEA 4CDGA 3EWAA 4F4JA 3CR8A 1ANKA 5TVKA 4GBMA 2EQBA 5HTKA 4J0QA 3W5IA 1VCMA 4TMWA 4AY2A 2RGXA 4IDNA 1FW6A 1R8SA 1ZNYA 5L3SB 4ITRC 2ZANA 2NZJA 2WKPA 5C2JB 2BM0A 4XWAA 1CR0A 2IF0A 2H92A 2WWIA 3E2IA 1F2UA 4TL8A 4U00A 4CW7A 2V1UA 3MLEA 4NYIQ 3TJZA 5KSOA 2A5GA 2MSEB 1FUUA 4G01B 4I1OA 5DIFA 2QM7A 2YOHA 4NPHA 2DY1A 5C18A 2GDJA 4Z1MA 2IS1A 2RH5A 4QBIA 2ZS9A 2P6UA 1OKKD 3LDAA 2CE2X 1OFTA 4ABYA 3G0HA 3M1IA 1VYUA 1ZD8A 2KBEA 1R5OA 3K1JA 4GSYA 4QGAA 5K8TA 3THYA 3BOSA 2VYFA 4DLSA 4E07A 1FTNA 5J4KA 2GCOB 3PG5A 3A4NA 3U6BA 4P3YA 2ZRFA 4GP7A 1NY6A 3ZDQA 3X2SA 4OJQA 3KL4A 1TEXA 2H57A 2YNMA 3FFAA 1CR4A 4IRUB 4DLTA 1E1RD 2ZUBA 4C7OA 1HV8A 3K09A 4DCNA 2PJZA 4FD2A 5JCZA 3AP3A 1UKYA 3SHFA 4GOXA 1SXJA 1E32A 4A0HA 4CEJA 3ZIAA 4AWXA 3MWJA 4YXWA 1KDPA 1NN0A 3WBKA 1GWNA 3EXAA 4OQNA 4BEBA 1E9CA 4C0BA 4OHYA 2OZEA 3M4YA 2CCJA 4YLGA 2J7PD 2P67A 1D9XA 1NLFA 3H86A 1LTQA 3B85A 2GZHA 2XAUA 3MG9A 2ERXA 5BQ5A 4C2TA 5EE9A 3AP2A 4LYAA 2FFAA 2V7QD 1JR6A 1GG2A 1UJ2A 5DISB 1U0JA 2XTZA 4UJ5A 5JFGA 5JSZB 4IXNA 1U81A 1HQYE 1N6NA 2G88A 3LV8A 3T1VA 2J5XA 4ZKDA 2HV8A 1N6PA 3BERA 2XSZA 3IGFA 4QGHA 1ZYUA 5KSZA 4A4DA 2ZI7A 4EKDA 1XPOA 3AQ4A 3SZRA 2QMUA 1D2NA 1PLLA 4HAYA 2HDNB 1XJQA 2NIPA 3SFVA 1TTTA 1X86B 3BIFA 1NP6A 5CLLA 1S0UA 1AKEA 2D4HA 2J7KA 4EPXA 3GLIB 2O8FA 4KJZA 3T1OA 2HT1A 4PAOA 1JEDA 3B1WA 1ETUA 4DZZA 1XJ0A 3B1VA 4DLVA 4LJYA 3FGNA 5JLJA 3L2OB 4KBFA 3MD0A 4Q66C 5TY0A 1OT3A 2GZAA 3VAAA 3I62A 5B2ZA 4QBGB 1J90A 2WIBA 1FP7A 1F2TB 2QMOA 2W2XA 4O3MA 1OH6A 1OV4A 2V7QA 3NVAA 3ZD6A 2BMFA 2R6FA 1DAIA 1G21E 3CZQA 1VG9B 4MYUA 2GF0A 1R6BX 1PV4A 3KUDA 2Q3MA 3NC1C 3OESA 3AUXA 3VR3A 2OSBA 4RKFA 1TU4A 1FPMA 4JL8A 4BLQA 4DIDA 3LFUA 1XEXA 3T5DA 2GKSA 3PIRA 3VR6A 1W7AA 4TL7A 1HE8B 3NG1A 3BB4A 4NH0A 421PA 4Q47A 4BZPA 1VIYA 1N0VC 4G5OA 3IQWA 4JLKA 2GCOA 3ONWA 2O5VA 2R2AA 3KDSE 1ESMA 2BV3A 4IHQA 2J59A 4NYMR 5CLQA 2MSCB 4PSAA 4DCVA 3L0SA 2ZRKA 1E0AA 4AYTA 4L5BA 4DUGD 1KOFA 1M7BA 1QBKC 1XTRA 1YZGA 2E87A 2ZAMA 1UM8A 2ZYWX 3GEHA 3HU2A 6Q21A 3K0AA 3GFPA 3QPWA 5JHGB 1HTWA 3TW4A 4QBHA 1XTSA 4H9GA 3WBJA 5BYJA 2KE5A 5IK2A 4V0NA 1YRBA 1E79A 2C95A 2RGEA 3MWYW 3KQKA 2J3EA 2R6DA 4EDHA 1KKLA 1NVUQ 3NC0C 2PLFA 3AF4A 1M7HA 4TTPA 5FL3A 2P5SA 3O8CA 4BLSA 1S96A 4GRAA 4A2QA 1SZPA 4TL6A 1DPFA 5EE0A 1JALA 4PSVA 4IDHA 2A7QA 3I8XA 1L2TA 1HE1C 1KO4A 3PEVA 3ZS8A 5KPJA 5GVRA 1GNRA 4FMCF 1G17A 1H8HD 1CF4A 1B23P 4HDQB 1XTKA 1E79D 4B34A 3CPEA 5E4FA 5FL7D 2BWJA 1ELOA 2GXSA 2OESA 1IN8A 4LBWA 3T5GA 1XF9A 1XJCA 1AQYA 2ZI5A 4A8JA 4LV5B 4AURA 5CYPA 4BLRA 5IT5A 1T3LA 3GJ3A 1E2HA 2Q9BA 4DUGA 4TZ0A 3IEUA 4FWTA 1DG3A 1KSHA 2XEXA 2X2EA 3D3QA 4G5GA 4LJ6A 4X8MA 1I4DD 2D7DA 2A78A 4IOJA 1XMJA 2AL7A 4H1UA 4I81A 1CIPA 5KDDA 2IL1A 3UMFA 3R8FA 3BD9A 2O8CA 4BZXA 1IY2A 2W58A 4Q01A 4BFZA 2QI9C 2AKYA 2JEOA 4B48A 4MKGA 1SVSA 1KY3A 3ASZA 3UIEA 2QROA 1HQCA 1VG1A 3Q8XB 4Q4AB 2ONKA 4ZIRA 3P4YA 3RVBA 2ZVPX 3SJBA 3A8TA 1GNQA 5CJPA 3WHLA 2MSDB 4KITB 4YQFA 5EXTA 2FSGA 4IDQA 3RRYA 2A9KA 1SULA 4E5UA 1OIXA 1T4GA 3TNFA 4W9MC 3FTQA 2OILA 1S4QA 1TUEA 1R5BA 1WXQA 3T61A 1Z29A 4XD7A 3KTAA 3FKSA 1E9EA 2GNOA 2B7CA 5LD2B 1XXHE 5KNCA 5CB6A 1N0UA 2OUKA 4YDSA 2VRWA 5AUQA 3WXMA 1LF5A 3P27A 3FMIA 3SDZA 621PA 1G8HA 1XWIA 3QEOA 4GMXA 4KVAA 2EVWX 1DG1G 3K0AB 2W2TA 3TQCA 3LH5A 2FMXA 5AJWA 4N3NA 3AEZA 1Z0KA 2O8DB 2PJRA 5GADl 3CPJB 1M1YE 2VO1A 2XJ9A 3HU3A 1PUIA 3VR4A 1OF1A 2I1QA 1C4OA 2IK8A 1JPNA 4YXWD 4L16A 3A1WA 1BMFD 1S1CA 2ZSEA 3GLGB 5HKKD 3A58B 3L43A 1MKYA 4KFRA 3TVTA 4IVRA 4M4SA 1KI8A 4RJLA 3RSOA 4G3XA 4B73A 3R9XA 3DPUA 4TMKA 4LDJA 4R71A 1G19A 1E0JA 1VYVA 3CIOA 1GDDA 1OW3B 1ZIPA 3GFTA 2XOKA 3AKYA 1G7RA 3TRFA 4DB2A 4YMVA 1Z6GA 3X1WA 2ZSFA 2VL7A 3B7GA 2A2ZA 2IWHA 4EPTA 1P9WA 2I1VB 1G3RA 5JBQA 3HJNA 1A5TA 4UNRA 1HT1E 2CHVA 1E9RA 4MYCA 1JAHA 2YINC 4NP6A 3SE0A 3K0CC 2EFHB 3IKJA 2D74A 3QVVA 2GK7A 2QP9X 2DHRA 3HDTA 4DKXA 4ZCLA 1BS1A 2B21A 3RWMB 4NCHA 2PBRA 5JRJA 4LPSA 2EW1A 3GD7A 4D4LA 1A7JA 5FPHA 2JGNA 3PQCA 3VR2A 2A5YB 2ZJ5A 1GFIA 4NCJA 4GPTA 2GCPA 2ZSBA 3RYTC 1TADA 2FV8A 4TQUS 4JVSB 4RY2A 3TUJC 3RRMA 2O8BB 1W47A 1Z6XA 3OEED 2HXSA 4H1VA 2QRNA 3QSYA 1G16A 1P2SA 1WBDA 2C9YA 4RD3A 2QORA 3DM5A 4CEHA 3NKVA 4RZUA 3CF2A 4FCWA 1JXMA 1W49A 2BBWA 1BYIA 1Z0FA 2QG6A 2CCKA 4PO8A 4D26A 1E69A 2CMKA 1X8JA 4NL4H 4DBLC 3K0CA 3KQUA 3RS2A 2ZROA 3OEEA 4U02A 1RRCA 3I92A 2QAGB 1FOEB 2X77A 2XXAB 3K53A 2PMDA 3CNNA 3EPLA 2MMGA 1AIPA 2FFHA 4HLDA 3LY5A 1FUKA 1P9NA 4DJTA 2D06A 4TT3A 5JZVA 4EFLA 1GITA 5JHHB 3IBGA 2ZXUA 2GEVA 2WSSA 3A36A 4GP6A 3PEWA 4QL3A 3ND9A 1LB1B 2YYZA 3PEYA 4MRNA 1NBMA 4F4CA 4KAXA 1G7CA 1NIJA 1XEWY 4Q18A 4A6XA 2VBCA 3I61A 3BFXA 2DWQA 3B9QA 1D6JA 3NWJA 2R44A 1TNDA 5B57C 721PA 5DHAA 2JLSA 5EXPA 4DCUA 3GLGE 3U7HB 4IKEA 4HB4A 3WMFA 2JLVA 1EWQA 3ADKA 3B1ZA 4LRWA 3ADBA 2FWRA 1QG2A 4LK2A 4B43A 2J41A 2R62A 3JZMA 1ZNWA 2QTVB 1IHUA 1WP9A 2QP4A 4AK9A 3AVQA 4R7ZA 1YZQA 3IIMA 1II0A 1QHYA 2GXAA 2Z5FA 1GILA 3RSLA 3MUFA 5CM9C 1S3GA 4OK6A 1IBRA 4U5XA 1I2DA 4FWIB 4B3BA 1QHNA 1QDEA 2NPFA 1HT2E 1XXHB 1Z28A 1DAHA 4B3FX 4C0SA 1Z6AA 1G5PA 1Z22A 4Q7LA 2Q9AA 3C8UA 2WKRA 3DZDA 3KKPA 4TSFA 2B8WA 4Q19A 3THWA 4Q4JA 2WJHA 4LYHA 1X8KA 4Z51A 3AKDA 2OEPA 4M1KA 3CNOA 1R10A 3EIQA 3GMTA 1OYYA 2CNWA 4B32A 1G41A 4OI1A 4B6FA 1EWRA 1Q22A 4B76A 1T5IA 2BEKA 3U3MA 4NTZA 4X8LA 2V6JA 3D31A 1XPRA 4JLVA 2NGRA 4TYYA 3LQQA 3CRVA 3I3SR 4JS0A 1YR7A 2F43B 2ZR0A 3QEJA 4DB4A 4MDEA 1V43A 1RVDA 4C7OB 3HPQA 1MABA 4ZIRB 1OHHA 2JJ2D 1N6OA 4HLUA 1XB2A 1F3OA 2FX3A 1ZJ6A 4Y0VA 2VQSA 1AJEA 1SVLA 4EPYA 5DYIA 1YKSA 2XOKD 3PEUA 1AK2A 4P4SB 3A1VA 1W4AA 2IT1A 2HYIC 2JJ1A 4PHTA 3AUYA 4TZ6A 5AUNB 4UNNA 1T0HB 4EJSC 2ZU6A 2KBFA 4JT4A 3O8BA 3B1XA 4MYTA 3U7GA 4MKFA 1R2QA 2ZRGA 4V0KA 4XVRA 4WOPA 2IXGA 1YR6A 2NOAA 3PUYA 3IQXA 5DO9A 1NMYA 4JLBA 2IYYA 4JVLA 4LSGA 4PPFA 1GAJA 2C77A 4LWZA 4DCTA 4II7A 1C9KA 3EIHA 1GKIA 1NRJB 2D62A 3RS0A 2UKDA 4AIIA 3LVRE 3QJYA 4OQMA 1U94A 3GLFB 1OFIA 3F0TA 4PZYA 1W4RA 2C9OA 1E4YA 2ZAOA 4EQ6B 3R9WA 1K8RA 3GLHB 2FFBA 2Q3FA 4OHWA 3ADCA 4C0JA 3OIUA 1YRAA 3MSXA 4HLQB 5KOYA 3GLGA 4Q5IA 5J5CA 1TX4B 5H70A 1KI1A 2W83A 4K81B 3SYNA 1E1QA 3DOFA 3TLXA 2V1XA 2ZI6A 2BDTA 4LX0A 1GZSA 1NVVR 1GM5A 4TN1A 1UPTA 1W0JA 2Q6TA 2YWEA 2C8VA 1O3YA 4DLWA 3OIVA 2F55A 5CIWA 4D82A 5A5GA 5J4VA 1FTSA 3CO5A 4KFSA 2QAGC 5K8IA 3RNLA 2JLUA 1LS1A 4NE2A 1HY3A 4C2UA 3FHTA 4EAQA 3PJRA 1DAGA 1GP2A 2A30A 3LW7A 4M1YA 3U3RA 1KNQA 4TTQA 2V55B 3EZ7A 4PQFA 2AN9A 1U99A 2BKUA 2DWPA 2RKOA 5F9HA 4JLAA 3QY0A 4TLBA 4A36A 2OFXA 5TDHA 2FZ4A 4JLPA 1DEKA 2OCYC 1GSIA 4AG6A 4EPVA 1Q12A 1N25A 5JECA 3EPJA 1JPJA 2F9MA 4M2LA 1E2JA 1E2MA 1NBMD 3K9NA 1MRNA 1ZRHA 2F6RA 3HYRA 1CP2A 4CVNA 4Q4HA 5J4LA 1M74A 3GCGA 1PZNA 3H0KA 3LXXA 1G8PA 4XVUA 2ZR9A 221PA 3VHXA 1XMSA 1W1WA 3TSZA 2ZI9A 3UG6A 4V02A 2WAXA 1Q3TA 121PA 2F3RA 1P61B 3BAFA 4YC7A 1PLJA 1CJKC 4EPRA 1N6HA 1LNZA 1ZW6A 4CEHB 1MH1A 2QTFA 2BMEA 1XCPA 4ZCIA 1BH2A 1W48A 4ZDJA 3HU1A 3JVVA 1WB9A 4GDFA 1K6MA 3C5CA 1FNNA 2ANCA 3LX5A 2E9SA 4OI0A 1WE2A 4KVGA 5BWMA 1CJVC 2GXQA 3OHMA 1VKJA 4HYYA 1GNPA 3HYTA 4IXMA 3TR5A 4IOLA 1AQUA 1II9A 4JBWA 5FBVB 2OE2A 2WMNB 1FX0A 1K5DA 4LHZA 4OQXA 3T34A 4DDVA 2QU8A 1W5TA 3H84A 3NH6A 5JEEA 1J70A 3QPVA 3TAHA 4A8JC 3FWYA 3U4QB 3QXCA 4RD2A 3DZ8A 2IYLD 5IF9A 5IK2D 3KXIA 5JJKA 5CDFE 3EX7C 1ZCAA 2O8BA 4FN5A 3GQBA 2GVDC 4MUAA 2AXNA 5P21A 5K8LA 2IYXA 2ZYTX 5SZJA 2FE4A 4TYPA 1AM4D 3KJIA 3CX7A 1HURA 1U2RA 4E09A 4L9SA 3ETLA 1M7GA 2PX0A 3G82C 1C1YA 5KNBA 4EFNA 2JLWA 3OFNA 2IEZA 5H68A 4RCYA 2AD5A 4IEIA 3X1XA 4BLPA 4RSGA 4DLZA 2WVJA 5M04A 2JLRA 3F5FA 4DDWA 1KDTA 4Q1FA 5FH9A 4HI0E
chains in the Genus database with same CATH superfamily
1WHTB 1ISHA 1F4VA 1FNBA 5IAAA 3COZA 4MQUA 4NYJQ 1IBKB 3SZGA 4GOJA 4OP1A 2GZ3A 3JQPA 1USVA 1X87A 4H77A 1FP6A 4MJ3A 4MRSA 5FOSA 2K7FA 4GXNA 3GY0A 4UTVA 4RQUA 4ZJZA 5JY1A 1MRSA 2FX2A 2P3SA 1Z4IA 3FNQA 4JBYA 4B2LA 1AHPA 2O7VA 1LRKA 5E7IA 2EP7A 2C00A 2VEOA 3OJLA 2Y1OA 2CGEA 1HLDA 1RC0A 5EC8A 2R60A 2QE7D 4WVLA 4MCAA 3AKEA 4K0KB 3C4JA 3D0RA 3TLMA 2YMQA 3D4NA 4MI1A 2RCYA 4QPJC 3G9UA 4JLOA 4ZDIA 2ZUEA 4EF6A 1E9FA 1P2FA 2ZIGA 5LQAA 4BNWA 2RHCA 3EZ9A 4F8YA 1YA4A 4E15A 4IW3B 3RVNA 2CXUA 4NU6A 2J9FB 1D7OA 2C9MA 4JIMA 2DCUA 1BQ4A 1N8TA 3V1NA 4RTSA 2ALJA 2NYAA 4NBVA 2KB0A 4EKIA 2VIIA 3B3QA 2A5DA 5ALEA 4JT8A 4B7UA 1UWKA 3K4QA 4BNYA 1E59A 2ODEA 2DZDA 1IAVA 3I1FA 5K2MA 4YJKA 2GYWA 1U90A 1PGPA 3DXXA 1ZJ4A 3O47A 5EIXA 4P0PB 3X1ZA 1V7CA 2WICA 3FNHA 3O8OB 1OT5A 2ZTMA 5K3DA 3ZIAD 4DMCA 2YHSA 1W44A 4KHPB 2CBZA 2O8NA 3GJRA 2VF2A 2ZJ4A 3MRTA 3UHOA 3B1JA 3PNPA 4OYLA 2WHPB 3QQPA 1YFJA 3KUXA 1N2XA 4O4JA 5DGCA 2GO1A 3HCNA 3FE2A 3HB7A 1EMDA 1KMHB 4KSYA 2F48A 4GU5A 2WD7A 3C6KA 3WIVA 5TR9A 2Q3DA 5K01A 5AI9A 3TCNA 2C97A 3HI4A 3NXKA 4FW8A 4WZAA 4ZALA 4DREA 1N2CB 4PYIA 1VLLA 3TBHA 3TGLA 4INAA 3IUJA 4IS2A 3USZA 3GHHA 4QPPA 4YPVA 4MUMA 3SAJA 2H2GA 2CXHA 2C54A 4X20B 4CMEA 1DAPA 4KR7A 2IZ5A 1FLDA 1H9CA 4RS3A 3PXBA 5DVZA 3RUIA 2JGMA 1T4MA 4QHTA 4LF9B 4YP0A 3DTVB 4OA5A 5E2AA 3RRBA 3FSEA 2DKFA 1TUBA 2IOYA 2JIMA 2G5CA 2WHYA 3S7TA 5CVTA 2KLHA 2GXUA 3QE0A 4BMCA 3IO5A 2OT3B 3KK0A 1PL8A 1PFGA 1VPTA 2X5OA 5IZ4A 5C7YA 2QQEA 4FZ3A 3URKA 3SWWA 1J0AA 3DVLA 3GYBA 4BB9A 4HQ0A 1H6DA 1GZ5A 2C29D 2XD9A 3HRKA 2ZAIA 3GDFA 2PKRA 3OQNA 4AZSA 2FJUA 2R8BA 2BHTA 4R2WA 1Z4MA 1ZOPA 3LT0A 3O26A 3RANA 2IV7A 4P35A 1JEYB 4QUEA 4YASA 4ZJPA 3K6SA 1GL9B 1LK0A 3OQ6A 1VGVA 2WKQA 3OE7D 5ALYA 4C9BA 4KPUA 4CKBB 4CMBA 3N05A 4MGHA 3J80A 2Y67A 3NIFB 4FILA 4B4VA 1J06A 1TCCA 3MMXA 3FZQA 3GCDA 4PPNA 4ZCPA 4D4KA 5KHLB 2PT6A 1RHJA 1SHKA 5F98A 1K0UA 3IL2A 2IKSA 3GDWA 2JGIA 1V3UA 1TGVA 4H59A 3RIMA 4L72A 3T0IA 3V4VB 2PUAA 3ROFA 2IYFA 1JXQA 3EC7A 4H17A 1KJ9A 1ILEA 4F9TA 3WNBA 2QE6A 2ZTVA 1E9SA 2D0PB 2I7DA 4KWTA 3N2GA 2TMGA 2V5VA 5AJYA 1OB2A 1GTRA 3GRFA 4NV0A 3TQHA 1EVLA 1PWYE 1CR1A 2CLCX 2CXTA 4RLSA 1GPWB 1Z35A 2MTBA 4RKEA 2IZZA 5E6RA 3M5DA 1EAMA 4FMDB 4R84A 3UUEA 1PUJA 3DXZA 2UUPA 2DERA 1KO7A 3EJ6A 4NESA 4BQIA 3TMAA 3PC3A 3T5TA 1XMOB 4FBGA 4DG9A 3JWEA 4RL4A 1NMSA 2O3TA 4NJOA 5AESA 4D4JA 4PSUA 1NI4B 5CA1A 4N3CA 4I3GA 3W6PA 1NT2A 3CZAA 3D3WA 3EIOA 1O6GA 2FUG1 4GOOD 4RSMA 4GBJA 4GVLA 4G26A 5E1DA 5J40A 3WSVA 3FBWA 4UDYX 3AKCA 1MB0A 2VHJA 1GY8A 2WJIA 3BKWA 3CN9A 5KHOC 1BWRA 1QIDA 2G1UA 4FR0A 3PPYA 1YU9A 1DKRA 1BO6A 1NE7A 1ZUNA 4JC8A 1KEKA 1Y1RA 2G0TA 1UZLA 1T4DA 4C7MA 1X42A 1KBQA 2P4HX 2Y27A 4WBXC 2YY7A 3NIWA 4Y7CA 2PFGA 3KHKA 5AJTA 4BO4A 1A4XA 1RZUA 3QXJA 1T3TA 5TQVA 1RLOA 2F4NA 1I01A 5FTWA 2H1WA 3W2TA 2IHJA 4DC9A 1G0NA 3IBCA 1YDFA 1JG6A 2NPOA 2NU6B 3F73A 4YJGA 4GMFA 2CYBA 5IKOA 4RTPA 1ULTA 2I3ZA 1UDCA 3MJHA 3R6DA 4JUAA 5DPMA 4KR9A 1R0LA 2NVUA 4UXIA 4CKCA 4KAFA 1ZVMA 3KQSA 5JISA 3Q9SA 2GF9A 1TQ2A 4MV8A 4OJNA 4B4OA 3AY0A 4EB0A 1UK8A 5G0UA 2XUQA 4BQSA 5EZYF 3QWBA 4ZAXA 4E30A 1E58A 1Y3HA 5JYDA 2GEUA 3GV0A 3K8ZA 4CI9A 5FTNA 3BXXA 3FOCA 3GP3A 1QM5A 4PAMA 4B75A 5IASA 3PE3A 3W7VA 4AD8A 5FP0A 1J23A 1GOTA 4FBLA 5GGXA 4C6TA 2R9VA 2ATCA 3R0VA 5TS2A 4PGGA 5HCUA 2BEUB 1JGTA 1U9JA 1UEIA 5ESXA 4D4MA 1KSFX 2F43A 1COWA 4P9NA 4M0MA 2JHPA 3RJ9A 3D6HA 3VC3A 1YDHA 4AO8A 1LWOA 2O8CB 2JDIA 1JDBC 2PQ2A 4EGAA 1AQ6A 4INPA 1ZVKA 1LH0A 2AI1A 3JTMA 1XZHA 1N9ZA 3LWDA 5F78A 4BAZA 4FEAA 2QPTA 3H5LA 4ZMSA 4AMBA 3U4MA 3LA6A 4Q6BA 3JQ6A 1U7XA 1UKZA 2W7TA 2WT8A 4S2EA 1W0JD 1JR3A 4BKMA 2UUBB 4F2DA 1YZHA 5ESDA 2GI4A 4N5DA 2IU0A 1W6RA 3TL6A 2GARA 4W99A 2VJDA 4MPTA 3IV6A 1WF3A 1CK4A 3WLNA 4B6SA 4RC9A 4KNWA 4PX2A 2B9EA 3P0EA 3E9ZA 4G25A 2X76A 4Z0PA 3WQHA 1Z08A 3C3YA 1WJGA 1JFRA 1UC5B 3IRVA 4PHGA 5PNTA 3TE7A 5EIBD 1O9HA 3COYA 5KDLA 2ZULA 5CA0B 5FWYA 2J7PA 2RGWA 5IJ0A 3E2PA 4Q00A 4F38A 2O1EA 1L9KA 2FZKA 2WSYB 1SXHA 2ZPTX 4ZQHA 2WWGA 4ZVMA 4N47A 1GD1O 4N7JA 3RS3A 1ZJJA 1NI5A 4L0DA 4EHJA 4P2BA 1GR0A 4EG0A 2JC3A 1FVFA 4FLMA 2QV0A 4CMIA 3GH3A 3GUVA 5AW9A 4QOEA 4K6MA 4L15A 2VC2B 4X1IA 4U9IS 3UFXA 4LEIA 4FS8A 1ZJYA 5EG5A 3FTNA 4W82A 2WDZA 2WTMA 1Q7GA 1S3IA 3GFQA 3H2HA 1KMIY 3P26A 5AHWA 1OVGA 1OFUX 2YHUA 3LWNA 1GA6A 5JD6A 1T9GR 2NZ2A 2RE8A 2XT9A 4E1AA 5IWAB 2W6JA 5D7BA 3KOZA 5FBHA 2XGJA 5H1YA 3VKFA 3OE7A 1BQ3A 4FMDF 3VUFA 3ROGA 3PXCX 2FLVA 4XIFA 4QELA 3L7CA 4UU8A 1MO4A 3FUVA 3FYTA 4HUQB 1ZNZA 4GR5A 3PFIA 2X2FA 1Y48E 3OAAD 1RKXA 3KQOA 2FN8A 3LCMA 3K94A 4JWTA 4LJ9A 1QHGA 3DBLB 2HF9A 4ZT3A 3RT1A 2Q6OA 1CETA 4Q9HA 1KYQA 5K8VA 3V1YA 2B4TO 4YMWA 3TSWA 4BFXA 2O57A 1C7JA 2DFNA 1R0SA 2YN4A 3EIUA 3KB2A 5IDQA 2HA5A 4GC9A 3OT1A 3OZDA 2P9BA 2P3OA 3DDZX 4HGOA 1Z0IA 4GT1A 3MGBA 2QI9F 3HUTA 1NVBA 4QJ3A 3RFTA 4K3VA 2FMIA 4K2HA 3SZ3A 1XL1A 4IZ6A 1J7KA 3Q5DA 3T3MB 3IJRA 4FCVA 4RF5A 3HN6A 3L0CA 3MXTA 2A3NA 4MQEA 4EG8A 1C8LA 2C31A 1IOVA 5DGHA 4EY6A 3ET4A 3L79A 2W2VA 4O2AB 2HQOA 2PX4A 1ADCA 1WCXA 1L4EA 5K0JA 1B2LA 2AFRA 2XTJA 1DT5A 1QF6A 1EK1A 4LHXA 3GA7A 5BUQA 1E5LA 4EO4A 3JQ9A 1KVRA 3PFHA 1JAIA 1ZM7A 3DM9B 4K9LA 5FUMA 1I6KA 1EX7A 4D79A 4D8YA 4ARZA 1E7YA 1LTKA 2VA9A 4CCYA 3KZCA 1CRLA 1GZVA 4ZGWA 1J8VA 1IBSA 4RLQA 4QU9A 1U9CA 2PD3A 1ADGA 3KT3A 4KODA 3ZGXA 1RJEA 1QMPA 2BFBA 3C16C 3W1VA 2CWDA 4W8OA 3HA3A 4FSXA 1V7QA 4ITVA 4X7BA 4IDGA 2VDQB 1FP4A 4HDNA 4WOBA 5KTNA 3CH6A 4LBYA 1YR2A 5I7OA 1ZN9A 2PFKA 2AE1A 3UJ6A 1EGVB 3CT6A 3SHTA 3PJDA 3ZXIA 3AILA 3FI9A 3I58A 4KIJA 4KN9S 2H1VA 2NO4A 4LC0A 3PDIB 1M75A 3RC9A 2QA5A 2IHVA 1WZUA 2FSPA 3FAKA 4K6GA 4LJSA 4XYBA 4O4JF 5LFAA 3F6CA 3CZMA 2NUTA 3UW3A 5K0GA 4HWSA 1HRKA 1X9GA 3V2IA 3Q7EA 3BORA 5SY4A 3K9QO 5KYGA 2OCPA 2OM6A 1V41E 2ZRNA 1E6CA 2R6CA 3DB2A 2PGLA 5KVCA 1TM3E 3ISJA 5EE3A 5JAIA 1SHZA 1YIAA 2ZE6A 3FCYA 2B83A 3I2FA 4NZYA 3UV7A 4RPKA 1B2RA 1US8A 1A9YA 3CXRA 5FQOA 2Z4TA 4RD1A 3RS7A 4U3JA 4UTPA 2V6IA 3PVSA 4POAA 2AXPA 5TSDA 3VBEA 4N03A 3W5DA 3NRBA 1E5QA 4XRRA 4JNCA 3II6X 4QWWA 3V97A 4F93B 3AHHA 4G0XA 2A0XA 2IPXA 2XTNA 4PG5A 1HH4A 2X7HA 2XKAA 4O0MA 3RHSA 5CRIA 3T5AA 3C5HA 2CBXA 3NWEA 1FU8A 3GDHA 4OHMA 1UOQA 4Q4HB 3NFYA 3Q6MA 3ND6A 1BE0A 3I04M 4RHYA 4EVSA 3FLMA 2V7WA 4EBBA 3EC2A 1SWWA 1TPZA 3LW8A 2JW5A 1LD3A 2P2YA 1TFRA 2W9XA 4FHZA 4G1UC 1MQ8B 4IJKA 4OYYA 3EQ2A 1PW5A 2O2CA 3KLBA 4G0PA 4CM5A 3TRIA 2GH1A 3WP1B 1KTVA 3AOEA 5SZIA 3N8NA 2WU3A 3NIGB 2WTUA 2E5FA 4KUHA 5A0TA 1XT6A 4WNAB 4Z7JA 4MPPA 3S99A 5CDSA 4KTVE 5I4IA 2YC2C 5JZ9A 5IVDA 4OHZA 4YREA 1E3EA 3NAGA 1CJSA 4F5WA 3K2IA 2UYGA 1Y9ZA 2AZ4A 4MUIA 4B8YA 3NGXA 5BW5A 4RZQA 1CERA 1NNLA 3ENVA 1NR1A 1J09A 2C5HA 1DCKA 1KF0A 3K7EA 2F90A 1HORA 4GUDA 4FC7A 3AVYA 2Q46A 4D25A 4EY3A 3MAGA 4X7PA 4L76A 2QP3A 4M8NE 4CHGA 3DMFA 3Q9UA 1E9VA 3LBNA 2PWAA 5AVQA 4M86A 1YACA 5GVSA 1Q0PA 2BFDA 3WRWA 5F9FA 2XEDA 1ZRNA 4LJAA 4MR7B 1JH9A 5B1SA 1CUBA 2GMWA 3IMGA 4KXNA 4PPYA 5EMJA 2OQRA 1NFFA 2AI3A 2ZB2A 5F2KA 1B6TA 3VV3A 3ZGLA 2F4VB 3CHYA 3NHWA 2FG6C 3M1YA 4P5EA 5DTQA 3AETA 1UPBA 1SXJD 2PCJA 3O8QB 1CQIB 4TKVA 3EGXA 3DQQA 1NJSA 3OLXA 3ZW9A 2AB0A 3OQMA 1CJUC 4AKGA 3HXOA 1VB5A 2XUOA 3AVUA 3ABSB 5JNRA 1H4VB 2B25A 3G13A 2AEFA 4YROA 4D5GA 4CLHA 1J39A 5CFNA 2RD2A 1DG9A 1MTZA 2FGJA 1QRUA 3IOEA 3A4MA 3K9HA 4PRYA 3UH0A 2B98A 3JQBC 1E6UA 1QH9A 2AN3A 3GEEA 3LUFA 5CHYA 1G5RA 3KB8A 1XHLA 1M54A 1XZPA 1OTHA 2NUTB 4Z53A 2QZ4A 3PQ3A 4G85A 3FZYA 4QOJA 3EYAA 2I54A 1LW6E 4EVQA 4GS5A 2OAP1 5D3KA 2C88A 1A76A 1ECLA 4AJIA 3AEQB 3EWNA 1N6LA 1MF7A 2XD4A 3SEFA 3WRYC 3ZIUA 4C5BA 3WGUA 4YPFA 3KR0A 4PNEA 1LDBA 1T9BA 5TB5A 3FHCB 4K9MA 4TV8F 5EJ2A 2Z98A 3MJEA 2F1RA 4JQCA 2HIMA 3TIVA 3CR3C 3QW4B 3QKSA 5EA2A 2AEJA 4W5JA 1ML3A 4XTRA 3G2IA 3KKKA 3U2QA 5G02A 3RSQA 4Y6RA 4YQYA 3DZFA 4TXLA 1CLEA 3OU2A 4KCGA 3B53X 4MITA 1HKHA 5AQ1A 1Y7PA 1EXNA 4EGJA 5FHQA 2CK3D 1PZFA 3BMNB 5CTAA 1CY2A 3RABA 2XQGA 2EJUA 4UW9A 3KP1A 5JFOA 2UZ1B 2D3WA 2WKSA 2B4QA 2DTEA 3BTUA 1OOEA 4O63O 5FOQA 1NXWA 2P1RA 4H6VA 1P19A 4HS4A 3ZQ4A 2GPSA 4WZ6A 2B3TA 4AQDA 4MEBA 4EG7A 2CKDA 3QKRB 1FPQA 3FGZA 4IZHA 3D0QA 2JIRA 3CWCA 3IMFA 5IMSA 5I5GA 2ZRPA 1IZ7A 2O23A 1W35A 5ES4B 1EA7A 5JALA 3TQTA 3JQ7B 1ZUIA 1A7KA 1TI7A 4G0ZA 5HIJA 1DJPA 1PQ4A 2FK7A 4YRFA 3V00A 3VX3A 3ZY4A 3F71A 2PRKA 1XZNA 2VRNA 4PLWA 4YJHA 3WGLA 4TTVA 4BUZA 5JU6A 4I9FA 2XUPA 5DBEX 2VSFA 3OIFA 3WB0A 4LS3A 5LQDA 3AC0A 1U8AA 5H4GA 2AFIB 1T5HX 3DUFA 5MGNA 2C78A 3H1GA 3TK1A 1RKBA 1K6EA 3NEYA 4MV5A 4PS0A 3IKTA 5DI3A 1YJCA 4EKYA 2Q0HA 4LXHA 4F3RA 2PGXA 4C4PA 1HE2A 1G8YA 1REQB 4EEZA 3O4VA 4TZKA 1TUIA 1E1CA 1NJ8A 2DKNA 2EFEB 1QFMA 2E1RA 2IZ1A 4F5YA 3DT9A 4QRIA 1CX9B 1J7JA 2R751 4MWTA 4HOYA 4HX2A 5KHAA 1A8HA 5ALNA 1FYWA 1PZEA 1USGA 2QPOA 4OTZA 4UFNA 3OECA 4RZIA 4US2R 2B6HA 1KDZA 4N0DA 4YP6A 3C43A 3G8DA 4R9UC 3VSEA 3CKLA 3MT8A 2B99A 4RHCA 1T9GS 1DCMA 2Q1XA 2YFYA 3OQOA 1DC4A 2H0RA 4W6ZA 1T0JB 3M9XA 2P9HA 4M54A 3HXTA 4QU8A 5EQTA 1CS0B 1OXSC 3UXYA 4BNDA 4CNBA 1NDHA 5TMDA 2NTJA 1V8ZA 1DNPA 2CXXA 3DP9A 5LA6A 2GRJA 2OXFA 4K6CA 3ZX5A 5BWOA 3KZXA 4ZICA 4CTMA 3FBGA 4MYHA 4Q03A 4QGBA 4UHEA 2HH9A 5A3VA 1R6AA 5IP5A 4IAOA 3QOYA 1V16B 2QBYA 1WZNA 5GY7A 1NJFA 5G3YA 1GVNB 5AKYA 1E6EA 1ZUNB 2C7PA 4G84A 3TBFA 4EF5A 3WGTA 1FFAA 5DGXA 3A1NA 3R76A 5FXMA 3K6RA 1EFRA 2C0PA 3GFSA 2BGNA 1PWZA 1CXZA 1L5HB 1WCV1 1PSDA 2P27A 3H9UA 1P1RA 1MT3A 3OZWA 4FIDA 3VR5A 4WN9A 2FR1A 3BRCA 4DM7A 3LQKA 5CLIA 2JCYA 4NNJA 3QVXA 4YRDA 4JP1A 3WLMA 3D8HA 5HXAA 1TYDE 4MPDA 2VTBB 2X3YA 4ZYWA 2HSDA 4A92A 3G8AA 3JZIA 3S28A 5BQFA 2OBYA 4TVBA 3CM0A 5EFOA 5HTOA 3WFZA 1WUTA 3RH0A 2J0VA 3REQB 4B8WA 1K7XB 2PZEA 2Q6VA 2V0CA 3N58A 4L4UA 4NULA 5KYXA 4B3MB 5EVJA 1CC1S 4P1ZA 1QFXA 4P2GA 4RVHA 5CK5A 1T2UA 3TLAA 3KEGA 4J07A 2I22A 1ZM3A 2ZRAA 2QN9A 1D2GA 3CWQA 4Z3DA 3BMQA 1JHRA 4M1MA 1L6RA 1SUIA 4O59O 1U0EA 821PA 1KWGA 4ASUD 1JI3A 2WU1A 2WTBA 1PT5A 4LY3A 5KSWB 1TLLA 4ITUA 5F51A 5LP6B 1UWCA 4P3XA 3MTIA 3EYWA 5EEGA 3HXQA 4A6PA 4G1VA 2PWPA 4B4KA 4WXRA 2BT4A 3RUAA 3NTXA 2RGNA 2EQAA 1FTQA 1SU7A 1HZZA 1MG5A 3WL8A 4MS1B 5TEWA 4AS2A 3M33A 3BQ9A 2IITA 4AAYA 4RZSA 3H97A 5F1YA 3A6FA 1PD1A 4QGSA 3RVMA 3EGCA 1A77A 4DOMA 4DV3B 3T9EA 1SIUA 1UBCA 3BB1A 4P7JA 3O75A 5F12A 3EWSA 2AZXA 3QXGA 4RWZA 2B8JA 4C3ZA 2VSYA 4W5TA 1U0LA 5ADWA 4EO7A 5K3BA 4YI5A 1AGRA 4CLEA 4OAPA 3CSDA 3DCJA 1N78A 4YFVA 3AVWA 1C9YA 1WW3A 1ZAKA 1X13A 2WJJA 3MUOA 3TLYA 2ZLBA 1G4HA 1JSRA 2V97A 2QM8A 4IIGA 2QK4A 5I9NA 2QRUA 1TM4E 2C3UA 2YV3A 5J2TB 1QQAA 1GQQA 1XAJA 2GVNA 4QTTB 5FBKA 1MHTA 4R31A 1Z06A 1YIDA 2GX6A 2B1JA 2HHAA 1XZGA 1LDNA 2HK7A 4EYQA 3T9DA 5JYBA 4PM4A 1CS4C 4FDMA 1Q57A 2Q9CA 3KE8A 2Z6AA 1VG8A 2FRVA 4B3SB 2OCLA 2ZI4A 1GCAA 4F3CA 1GGJA 5FWAA 2YJTD 4Y2SA 5BN5A 3HYNA 5DYGA 5JADA 1NSTA 1X8LA 1EFPB 3CCBA 3NT2A 1W2WB 4CN9A 2DSTA 2RGAA 3GVHA 3V4SA 1L5WA 2D4AA 2PJUA 4FT4A 3W3ZB 1U3WA 4CR8A 3RHFA 4EG3A 3KTDA 5EMKA 3N2IA 1CEEA 4F8EA 3LUCA 3PQFA 5CBKA 5AVXA 4U1RA 4UM9B 2OMKA 1E5VA 1X7DA 4FDVA 4OHXA 3VTZA 3FCEA 3TOZA 2JCSA 3DBIA 2F1HA 3U3KA 4UCXA 1FDUA 1INLA 5LBUA 3WJAA 4J1SA 4CQMD 3L3BA 1X38A 4K9OA 4TM8A 4A82A 2HSZA 3WYCA 5A06A 1KI6A 2ZQZA 3DOEA 4JBXA 5T4HA 4ZT2A 1XVUA 4IF4A 5HE9A 3ZWDA 2W70A 4HNQA 3H17A 3I5YA 3T0FA 1K6JA 4TV8A 1UMCA 3AR5A 5G53C 4XSVA 1AKTA 1KEEA 4YO8A 1Y5LA 2HUPA 3F49S 4Q1CA 1UXGA 4YBZA 5KTSA 4K9QA 1RE0A 1HETA 2BGUA 2JJ2A 5JQWA 4CKXA 1T6ZA 3KKZA 5IJ9A 1FYVA 2GGSA 3JTEA 1Y6RA 4ALLA 1M8JA 1C8KA 3LHIA 5JDIA 1C1XA 1Q2UA 4Q3BA 4FYHA 2HX1A 5E9QA 1ZD1A 2UUCB 1QC5B 4IUDS 2HRCA 5MDHA 1CW2B 4QXQA 2QR3A 3T1QA 2W6ID 2VDLB 3QF7A 3RARA 3IEMA 2D00A 4EI2A 3SC4A 4IKPA 4M83A 4WFKA 1JLLB 2LIVA 2A35A 1SXJB 3QFSA 3S81A 5BPHA 2P2GA 1IXZA 2C1ZA 3AEXA 2QN7A 4BJ6A 1K4MA 3AUUA 3WKAA 3GAAA 4XB2A 1NRIA 1BHJA 3C6YA 1WP4A 2NO1A 2YTZA 2ATIA 2ZSDA 1UFRA 4XUEA 4AZ3B 2DH6A 4QOIA 4OX9Y 1E4EA 2AYYA 4M38A 4CM9A 2G6TA 2YASA 3FPEA 1Y1LA 4J7XA 3MT0A 1TMKA 1FFHA 1RWOA 1XPUA 1M2OB 2ZI3A 3WLPA 2P91A 1DO2A 2OO3A 1QK3A 4K9NA 1M6HA 2OD2A 1ZUHA 4GMDA 1KKUA 2H2DA 4V3CA 3OPYI 2EJCA 4I6GA 4FQ5A 4FYPA 4N49A 4DJJA 3KUCA 4RJTA 2XT0A 4M99A 4D92A 1WETA 3NUQA 1Y9AA 2X22A 3DULA 1RU3A 1E89A 2GZDA 3L4SO 4MVJA 1VE3A 3A27A 3N8DA 3PD1A 4AMGA 4CM8B 3OZSA 3ZDCA 1O95A 3K70B 5EMLA 1EE9A 3OAAA 5EJ7A 1KYZA 5DE3A 5DM4A 1M6WA 4Y2VA 3WK8A 3FMGA 5MGBA 5FTMA 1PBNA 3FOBA 1H69A 2QLNA 4G5FA 3QXSA 2B94A 4HADA 4BZQA 3U19A 5ED4A 1CF9A 1Q0RA 2PU5A 3HSSA 1R1DA 3IP3A 1O5IA 4KHZA 4XM2A 4EVIA 4PYNA 2AC7A 1LDMA 2C2XA 1KNXA 3F4KA 1F48A 3NU1A 4C7BA 1R0YA 3U4GA 1GLVA 3OCZA 3EVGA 1AC5A 4QFMA 2IUFA 4FJ2A 4FEGA 4EIWA 1A7AA 2BRUA 4B3IA 1RPJA 2QEQA 2YIJA 4KDFA 1XA0A 3ISTA 1USKA 3GFVA 4O4HB 1ADJA 3H1TA 4B0PA 3ZZ0A 4LBVA 4MHOA 3PT5A 4HUTA 5KC9A 3IPYA 1EHIA 1QIFA 2CCGA 4IWYA 2QIPA 3H6GA 2NXCA 3AUKA 5EKSA 4MUFA 3D1LA 2B5VA 4X45A 5M2QA 1E1RA 5KNCH 4J4BA 1THTA 4L8GA 4CZ2A 1J9GA 1RJ9B 4R16A 4BX2A 4XWKA 1KARA 1KO5A 1R4ZA 4QGFA 5I9LA 1XLWA 2W5UA 3BB3A 1YE8A 3OY2A 5DGIA 3BJZA 5HK8A 3NDBB 3RS4A 4IIUA 2YR0A 1EEXB 1Y3AA 4DA8A 1K7FB 2CFCA 3DCIA 3KOOA 3PQ7A 4BIIA 2YRXA 4IFIA 2ZWIA 3CVVA 5LZ4A 1RPTA 5IX8A 1CIJA 3DFUA 4KLNA 5FLYA 3EQ7A 4ALNA 1RXCA 5ELXA 1E96A 4NBUA 1HR0B 1NZJA 3G0GA 3LQRA 4ZI3A 4KN8A 4XJVA 2ZUCA 4Z3KA 3KSAC 5CXQA 2E85A 3GJ7A 5KNDH 1FJGB 2XMZA 3OKPA 2UXDB 1QIKA 3FLAA 3SSAA 3CZ9A 3F9IA 4FGUA 3E6AA 4V0MA 5FAXA 3MZ0A 5KX5A 2J5QA 3PFFA 1GZHB 2XYVA 2FW6A 1CUXA 1T5OA 5THKA 4I6EA 5FDFA 1LKZA 3JX9A 3U5ZB 4BKQA 3T9FA 1KRWA 3PHBE 3BL8A 1K2VN 4CM1A 4KO3S 1EESA 2MT9A 1A71A 1MVNA 3KRTA 1OTYA 2M1XA 4C4SA 2NQ8A 1AMUA 3L46A 4MV3A 1PBTA 4QDOA 4BZZA 3T95A 5LKRA 4MQ5A 2VNAA 3FCOA 4UDOA 1JH8A 3R5KA 5AI0A 4G5SA 3EB9A 5G0SA 4EJ6A 1H6BA 3LQFA 3F6YA 4DR1B 4JGBA 1NVXQ 4D3SA 3ZE1B 1N3LA 1P2UA 2OZKA 1Q7TA 2EHJA 4IIHA 3U4CA 4RE6A 4E1VA 3H2IA 2J5KA 4V03A 4AP6A 3QVTA 1B1CA 3MFYA 2H48A 2KYRA 3P32A 4W5NA 3C1TA 3FMOB 1KPIA 1BIFA 2QQ0A 5FI5A 4C6RA 2HDOA 1QTNA 1OLSB 3TUZC 3ZU4A 1PHRA 1ZFNA 1WSBA 2AHRA 1B8PA 2NSLA 3CLSC 2HLDD 1LC0A 3ECSA 2QRZA 3IA2A 3K9GA 3MOIA 1KOLA 2XZOA 1QG4A 1Q1AA 4GKVA 4EM6A 1SKYE 2X23A 2BF4A 5DHUA 1QOZA 2WEKA 3LSYA 2YMPA 2PX5A 3PDJA 3WQRA 3WGOA 3BK7A 1ZIXA 3V4RA 4O4HA 2A0KA 2EWWA 1V48A 4CG2A 1IJFA 5CHEA 5ALPA 4R2HA 3S2SA 5K8UA 5LOVB 2OV1A 2OGWA 3IMCA 1U3TA 1LVGA 1QYIA 3ZI4A 4EATA 5JH7F 4FOLA 1PWEA 3DVSX 1VJ5A 3ZV3A 3GRCA 1NF9A 4HX5A 4BRWA 5M34A 2FW8A 5HM8A 3D54D 3M5PA 5JYEA 1YZVA 2O5RA 2W8BA 1NBEA 1IM8A 4JEHA 3OE4A 4PFJA 5GJVC 3JZFA 4AO6A 1QCDA 1UMBB 4O2AA 5FV4A 3VHLB 2YMMA 3K72B 4YN3A 4EMUA 1IPFA 3BA1A 3RYHA 1F7UA 3AONB 3KOUA 1MT0A 3AGQA 3ASVA 5HCIA 5IUJC 4EB8A 4YRGA 3UHPA 1ESDA 3CV3A 4F21A 5EJEA 4R7TA 1T9HA 3UAOA 3TD6A 2H29A 4Q7EA 2RGDA 1ZNXA 3UMRA 2QZ9A 3DWEX 3UT5B 1X9IA 1DQNA 1G3MA 2VUTA 4I4TB 2BY4A 4C0AC 4ZYTA 5J3JA 2GUWA 1ITZA 3GUHA 1YDMA 2R7LA 4P0TA 2IY7A 3NPAA 1PQPA 1RLJA 2ID7A 3AHGA 3B89A 2RHGB 4FYWA 4GYJA 4IF6A 1VECA 4BMVA 2DQSA 4NHOA 4OQPA 4MYSA 5CTJA 1PTJA 4I1PA 1YJ8A 4OEHA 2FF5A 5E6UA 3THXA 2DFPA 1T9CA 1AU9A 3FYSA 3DWIA 3HGTA 2QMYA 5DU2A 2JGEA 5K99A 3FOEC 3ZLJA 2HSJA 2H7VA 1QFSA 6REQA 5EJAA 3MCWA 4WLNA 3R6TA 3PUHA 4LKOA 5AJUA 1RTKA 3CH5A 3N7AA 1S3SA 2YC4C 4JOSA 1QTIA 1ZP6A 1BS2A 2PMKA 2JLCA 3GT3A 4FGSA 3A0RB 3SXUA 4DLUA 1M5RA 3HXLA 3BMXA 4P4TA 4D26A 2XRYA 4IOKA 4NBLA 3W78A 3RHTA 1C1HA 2Q3HA 4ZN6A 1W4BA 1X1AA 4QTXA 1XLTA 2CD7A 2OTCA 1H1LB 4YWHA 4CXMA 1TYAE 1K5GA 1E2QA 2QNIA 4R9RA 2CDCA 4XJXA 4GYKA 3MTEA 5J9FA 3TMKA 2HHHB 2VBGA 2A5FA 5FNZA 3R7SA 1F3LA 3DO6A 3TECE 2QL5A 4TTRA 3EF0A 4RGQA 2O3QA 4RXUA 3H2KA 2BFBB 3BREA 1CQJA 5H3LA 3E58A 3S68A 4Z7NB 3E4CA 1HDGO 1XCGB 3F74A 2WWRA 1Q91A 3CBQA 3LLMA 4KYTA 3FRIA 2ZIWB 5CJJA 3LPAA 1DXQA 4YUYA 2IPAB 4BV2A 1O6BA 4KQIA 5JLAA 4B2YA 5IC4A 2QRQA 1GSHA 3JYNA 4BPBA 1USIA 2ADOA 1W0KA 1E2DA 2Q50A 2VP5A 4JD5A 2XODA 4W7IA 4GLOA 4BWYA 5CH3A 4TV9F 2O0HA 3AFHA 3IP8A 1NOKA 1NXXA 1M83A 4QOSA 4D4IA 3LJKA 1MDFA 4WZAE 3QYJA 3PITA 1RWNA 4LZOA 4RFSA 4WY8A 3TSOA 4EK9A 2W98A 5KWVA 5LDHA 3IHLA 4CIYA 4UUBA 3MGGA 1EDZA 4P4SA 2DWCA 4DSTA 2FEPA 4R2MA 3RG2A 2AFIE 4XGIA 2RAFA 2VDWB 5DB4A 4JFAA 1UQTA 5CH8A 3H75A 3P9CA 3IP6A 4N65A 4FHGA 3FTEA 1Q83A 4QEZA 4F4FA 4IDPA 1P1FA 4WZBA 1MW9X 5CIYA 2C3MA 3WYGA 5CITA 1CDOA 3IRUA 5LMZA 1X1RA 3VSBA 1P44A 1A9PA 4RHUA 3VNVA 1MQAA 2G07A 3U4DA 3O8DA 4ZT7A 2ZBQA 1PT6A 4LHEA 1NW3A 1NMQA 5DTRA 4D9MA 3ZJVA 2PGNA 3FMFA 4NARA 1IN4A 2H3EA 3HVJA 3ILVA 3SSMA 3X1DA 5HP4A 4PF1A 2ZYSA 1VFNA 4YRQA 4D57A 3PGJA 1DXOA 3K1YA 2Q5EA 4YIHA 4XWYA 2A9FA 4O4IF 2K2QB 4RSHA 8OHMA 4BBZA 1QS0B 3ZQ6A 4QPDA 4YK7A 5FTJA 3MS4A 4GKAA 3JASB 1G8JA 4DQUA 3AVVA 2AYXA 2P4QA 2OCBA 5KNBD 2EAUA 3SNHA 4B87A 2R1TA 5CVCA 3BCUA 1OYOA 3N0WA 1XRPA 4HZUB 3F9CA 1E2GA 2HJGA 1UCFA 2QUHA 2V7PA 3M3PA 4NV3A 4DLAA 3M5CA 3TFOA 1KI2A 1Z8NA 3E3LA 3SHQA 1CDDA 4TX1A 2VUHB 3R0XA 5IFLA 4HK4A 1OZ0A 4O2LA 2P3LA 1SKUA 4MGYR 5KJEA 2LKCA 2Y0DA 1TM5E 1SCIA 2P0EA 3DEZA 1JILA 3EA5A 3HL0A 4PLCA 4PTZA 5E6SA 5HQ3A 1TIPA 1DEAA 5DTIA 4PYLA 1T2VA 4U7FA 4YJ3F 4J7UA 2HW8A 1H4TA 1PVVA 1AOXA 5T64A 3U7FB 4QBFA 1JP7A 4ARZB 4CCYB 3LFHA 2R1VB 4D46A 1QAOA 3IUPA 1DELA 2FETA 4QG7A 1C30B 3C3MA 2QJWA 3ICCA 3UAZA 5HGJA 1MNQA 1MO2A 3ASYA 4ZVUA 2HU8A 3L6RA 4QTZA 2RGRA 1FL9A 2QMHA 3EEYA 3AXTA 2NUPB 4MW7A 5I9BA 1OCEA 2J32A 4IFTA 2HJWA 3WR5A 2P6RA 3T12A 2AMFA 3ZDAA 1VKRA 1R0CA 3PQEA 2Q8NA 1N2HA 2EKZA 4QXOA 2IV2X 1OXUA 2YN2A 3ER6A 1TA9A 3NX4A 2JAPA 3TQOA 1GZUA 4DHEA 3NVMB 3F8TA 2BD0A 5TS3A 4IWNA 2WE8A 1HLPA 5AIAA 2AOTB 2W2LA 3TG8A 3AR6A 5D3QA 1XQ9A 3IEVA 1KJJA 2ZJYA 3RJTA 4PO1A 1A9OA 1CF2O 3R7BA 1LDGA 3DJYA 1ESZA 2I7CA 3AF0A 3TXYA 4DCGA 1Z0AA 3FUUA 2GD1O 2EW8A 2V5UA 1KWKA 2ZUUA 2E4UA 4Q3NA 2IXTA 4COKA 4MVYA 2PMWB 5U4XA 2PZAA 1KTIA 2IIVA 3P9NA 1DB3A 1RJFA 2WVHA 3DMDA 1BKYA 1NW7A 4UAJA 2QRJA 5E4TA 1N1DA 1J0DA 3KYDA 4LI0A 4BLOA 4ROSA 1XPJA 3H9BA 5DMHA 1GAEO 3SD7A 2ISCA 4LYFA 3R74A 2WPDA 4UBMA 2O19A 3C45A 1ZK2A 3HVUA 3D3EA 4LTDA 3QPDA 5F76A 2A88A 2IE8A 1QO9A 4DCPA 3HB9A 3LK7A 1XTVA 2IYRA 4UE3S 5LU9A 5CEEA 7MHTA 4BX0A 2XOEA 4AKHA 1DKPA 2EKDA 1SVIA 1B43A 2WT9A 3MMPA 2EWVA 5LNK1