1VECA

Crystal structure of the n-terminal domain of rck/p54, a human dead-box protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
206
structure length
206
Chain Sequence
KGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight of human DEAD-box protein rck/p54 into its substrate recognition with conformational changes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords ATP-dependent RNA helicase p54
total genus 66
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vecA00
1Z8FA 1ZUHA 3EZ9A 3VFDA 2DR3A 1JR3E 5J4VA 3FKSA 3J81k 3A1TA 1KDTA 2QP9X 2ZRNA 1VG9B 3U44B 2A2ZA 3D3QA 5EE1A 5HE9A 1E1RA 1SVOA 1CRPA 2WBLC 4LHXA 1GDDA 3L43A 1AIPA 4OHXA 4TMXA 1P9WA 4JYCA 3SZRA 4B73A 4YXWD 3B7GA 3VNUA 4D80A 4KSBA 1NLZA 3ZVNA 3UKDA 2IYVA 4B2PA 4TYYA 2BJWA 2CDNA 2F3TA 2G9NA 4PHHA 4CEIB 5SZHB 1EK0A 4PANA 4KHZA 4NONA 5EZ6B 3CX8A 4FN5A 3K9NA 2W2VA 3VR5A 1WBDA 3LVQE 2QM8A 3N70A 1VDZA 3MG9A 4C7OB 2ONJA 4UKDA 1ZC3A 1CR4A 1RRGA 1ESNA 3GLGE 4YC7A 2F9MA 1AS2A 3GP8A 1Z6XA 4LOAA 3JVVA 4OQLA 4DVGA 2ZSAA 4TMZA 3VU9B 2IYYA 2IX3A 4TWZA 3CPJB 2B7CA 2V7QA 2CLSA 2GA8A 4NCNA 3PVSA 1R6BX 2R6CA 1IN7A 4PR0A 2JJ2D 1TADA 2GCPA 1YR7A 1Q1QA 2GXUA 4C2TA 2ZROA 3DM5A 4URYR 4LJ6A 1Q1BA 3C41J 2UVQA 1OJLA 2WMOB 1OXVA 1G3UA 4AWXA 4E07A 3KJGA 4W5JA 4LYAA 4DHEA 4RKEA 3B9PA 3WNDA 4QGFA 4IW3B 3WBJA 1EFUA 1E1QA 4HZUA 1YZTA 1WA5A 3LRPA 3OIUA 1IN8A 1N6KA 4QJ5A 3SC3A 3CX6A 1O87A 3K1JA 1AQYA 1T3SA 5FPYA 3T1TA 3L0IB 4URVR 1PVOA 2F6RA 4RZ2A 3TK1A 2VHCA 1E9DA 2GRJA 2GDJA 4FMBB 4G5SA 1TQ2A 2ZS9A 3LH5A 3MRSA 3QY0A 4JVLA 2IS4A 2ODEA 1G6HA 4A8JB 1R5NA 3HR7A 3T34A 3I92A 4PO9A 3DZDA 2AL7A 4KAXA 5L3VA 2GAOA 2ZRIA 1E94E 1ZD1A 5JCZA 5L3RA 2IK8A 1Z5ZA 3B1VA 2J0QA 2JJ1D 2YZ2A 4GRAA 3I1FA 4DDVA 2B7BA 1FUKA 1Z28A 3ZJYA 1N0UA 1NVXQ 1P2SA 3PG5A 4TQ9A 5AJZA 3Q5DA 1AZTA 1OT3A 4IEEA 1A5TA 2VSXA 3VQTA 4BASA 2HLDA 2XTZA 5ANRB 4AKGA 3O8CA 4F93B 1ZU5A 1W4CA 4ZCMA 3GFOA 2WV9A 2YINC 1EESA 1G16A 3ZZ0A 2FFHA 2OM2A 2BM0A 2YWFA 5C1BA 1SHZA 1LF5A 3TR5A 4MGIR 3TBKA 4BZXA 2FFQA 1GUAA 2QRNA 3HPRA 4WZ6A 4QXAA 2FZLA 1GRRA 4LZZA 1Z6GA 2FU5C 2IUTA 4CEJA 4IOKA 5KNBA 5BN4A 2EFHB 1U94A 2VF7A 1DEKA 2OSBA 3EWSA 1G291 1NI3A 2RH5A 2YV5A 3KFXA 4DCSA 2GEUA 5AJWA 4C4PA 2GZHA 1P73A 1VTKA 3A4MA 2GAAA 3CPHA 3TRFA 5L3SB 4EKDA 2WSMA 1RKBA 3HJNA 1NP6A 4OK6A 4Y0AA 5DN6A 1LB1B 2IUSA 1NVVQ 4NHOA 2F1HA 1SXJE 1G7CA 1P5ZB 4MRVA 1KDPA 2QP3A 4Q4LA 3ICQB 3U61B 1KZGB 4JLMA 4QBGB 2C2HA 1O3YA 1J70A 1E2IA 5K8LA 2ZJYA 3WHLA 3C8UA 1H8HA 3K8YA 3OEHA 4MDEA 1EG7A 1K5DA 1D2NA 1SVIA 1J99A 1E0KA 1XMJA 4V0ME 5TMPA 1MV5A 1W47A 1WDTA 2VHTA 2WMNB 3OAAD 1CTQA 1OB5A 2XNDD 2QI9C 3IBYA 3W5JA 2P5SA 3RSOA 2UZIR 4JVNA 3NBYC 5JWHA 4LBZA 2A5GA 4ERNA 1RRCA 2JDID 3FYHA 1DO0A 5IK2A 1R5BA 5L3SA 4D81A 4BZQA 5SZKB 1YQTA 3W3ZB 1QHGA 4M9QA 3EC1A 3NC1C 4FMCB 1TF5A 1BMFA 2IXEA 3CRW1 4C0JA 1G7TA 2Q3HA 4LYJA 1P2UA 4BFYA 1OH8A 1S96A 5CM8B 3K70D 5GJCA 4PXAA 4JSYA 4JBXA 3RDPA 1EFHA 1NN5A 4HAXA 4CEJB 5BW8A 5HKKD 1E4VA 1NIJA 3BERA 1T5LA 1YKSA 2DFNA 2QTHA 4TQUS 2R8RA 3C14C 5KDDA 4DSTA 2ZJAA 1FZQA 2D62A 1R5OA 5DI9A 2YYZA 3OIVA 3FMFA 4IEIA 3PUVA 2FFBA 1F6BA 1QRAA 1T9HA 2AFIE 2H1LA 2CE2X 3CF2A 1JEDA 4MUBA 3KQKA 1IQPA 2OXCA 4NCKA 3LA6A 2G0NA 1E2KA 4LJ7A 4TZ0A 4V02A 4WXRA 4RZ3A 3IPXA 1KO7A 4QHTA 2D7CA 4JKYA 4DXAA 3N2IA 1EWQA 3SEAA 1N6RA 2ERYA 4GZMA 2IHYA 4UNNA 3OEED 1R4AA 2GK7A 5AWFC 1HA3A 3A1UA 4UXHA 2BMEA 2ZYWX 5KHOC 4A8JA 4HLCA 3L8YA 3WMFA 3JVUA 3V4FA 1XD9A 3FKSD 1CJUC 3EASA 1T5IA 2Q9AA 4TZ6A 2E9SA 3KKPA 1E69A 3ZQJA 2XSZA 3AP1A 4HZUB 3CZPA 4A92A 4RSGA 3A36A 4Q00A 2ZEJA 4JJZA 4RJLA 4Z1MD 4YMTA 3BBPA 3D7MA 4HB3A 4JLJA 1UBGA 4ACBA 2HV8A 1JJ7A 2CVHA 3AVXA 3NH6A 4HAUA 3CWZA 1QG4A 1BIFA 1XPRA 3VR3A 2FN4A 1OYWA 1TL7C 4POAA 3RS3A 5JZVA 3CX7A 1II9A 1OLOA 1P3JA 3GMTA 4Q66C 3WY9A 4TLEA 2GNOA 4I1SA 5H8WA 4YMSA 4LJ4A 5TB5A 5JWRA 1E4YA 4FCWA 3VU9A 4LC0A 1OH6A 3UMFA 3SJCA 2AN9A 1NBMA 2QEQA 4DLYA 1NJGA 4J0QA 2ZE5A 5IHPA 4C0AC 1OKKD 2G1KA 2IEYA 1LVGA 2QPTA 4C7OA 4MH0R 1KK2A 4OI4A 1KK1A 4AG6A 5JRJA 4LSGA 3PUWA 2RGEA 3QBTA 4DBLC 4JYBA 1KJYA 1LV7A 1KK3A 2ONKA 2YOHA 2NGRA 2ZYVX 4FMCF 2JCSA 2ZRCA 3VR4A 2BDTA 3SR0A 1E2NA 2QE7A 3BOSA 4CEIA 3AEZA 5FUXA 3RAPR 3OFND 4ON9A 3CO5A 4PPQA 1C1YA 3I8SA 1Q1ZA 3CH4B 1OFTA 3FPAA 1Z0JA 4MKFA 1RW4A 3AKCA 1XJCA 3CUEF 3H86A 1XB2A 2L0XA 2G1JA 4LC1A 1ZUIA 3ZD6A 4GBMA 1XCPA 2PZFA 4L5BA 2PEZA 2WPDD 4I1VA 4F4JA 1ZM9A 3U44A 3L82B 2FMXA 1EX6A 2C9YA 2C9CA 2O52A 1CIPA 2CCGA 2AFHE 5C46F 1JQLB 1P9RA 1ZNXA 5EE5B 1IJFA 2WKQA 2ZSDA 3EWAA 1ZIOA 2ZSBA 1P61B 1OXUA 1Z08A 1XXHE 3K9LA 2WM9B 2VYFA 4YXWA 4Z54A 4R71A 4PFSA 4AD8A 3U7FB 1TTTA 2ZU6A 4JL8A 2FSFA 2FV8A 2QBYA 1NVVR 3W8NA 1FNNA 3LW8A 4YONB 1E9EA 1RRFA 1ZU4A 3P32A 1E9FA 4RD2A 1SKQA 3R7WB 1IJEA 4A1FA 1TAGA 2WKRA 1V5WA 1XEWX 3WP0A 4HI0E 3A6PC 1Q3HA 4JBWA 2ZJ2A 5KO2A 2V7QD 4A8JC 1ZIPA 5H70A 3GJ8A 1VCOA 3TSOA 1HQCA 1PZNA 4D0LB 2V3CC 1CJKC 2ZXUA 2HT6A 2FF7A 1J90A 4I99A 1SVSA 1EX7A 2H7VA 1CR1A 3AVOA 3UXMA 1M7HA 5JRZA 4RD1A 1F60A 1KJZA 5HZKA 3SJAA 1G64A 1ZCAA 3IDQA 2ZRAA 3T1OA 2J41A 4ZO4A 3KDSE 4G01B 1ODFA 4F92B 1BYUA 1ONBA 4FW9A 3KB1A 4M2LA 2KE5A 4Q9JA 3OE7D 4LX0A 3TUJC 3K9GA 2ZRLA 4C0LA 3Q7QA 1E2PA 3B1WA 1W2HA 4FCTA 3TW4A 1QHHB 2HXSA 3BXZA 4B33A 2FDCA 4DCUA 1AZSC 4BFXA 3I5YA 3T1QA 1CU1A 5JFGA 5JHGB 4FWTA 1MO3A 2V6IA 2OZEA 4NYIR 2ZUDA 1NG9A 5J4LA 5A0FA 1A1VA 1XEWY 4QL3A 3U4QA 2WJHA 2PMDA 4DLZA 2ORVA 1TPZA 4DLXA 5JSZA 4RCZA 2GK6A 3SFVA 2IWRA 1N5KA 2QORA 5GVRA 2J7PD 3HR8A 4WZBE 1FP7A 4CT5A 2KSQA 3SQWA 1MO5A 4Q4HA 2QL6A 2B8WA 3EIQA 4Q5IA 4QBHA 2LKDA 2JEOA 2LWIA 2BCJQ 4HLQB 4C0QC 2NZ8A 2I1QA 1UAAA 4AURA 2YWGA 2QUZA 2O8CA 4IRUB 5FUVA 4DLVA 2C99A 1XTSA 4QOSA 4AYTA 3PXGA 4LHYA 2QG6A 1GILA 5G3ZA 1ANKA 4ASUA 3C16C 3L0PA 3LBHA 4XIGS 1Z0FA 2RGNA 4HLUA 3IGFA 3IEVA 4QGGA 5EUQB 4BLTA 2ZR9A 1IOZA 2J9RA 4LDJA 1Z0AA 2ZAMA 4US1R 3A37A 1MRSA 2RGBA 2IXGA 1GTVA 2BBWA 1D6JA 3I72A 2OXRA 3R9XA 2GHIA 2B6HA 4QGHA 3U7HB 1VIYA 1CF4A 4KO8A 3LXXA 4DKXA 4TYNA 4DEXA 4IFBA 1I2MA 3UMRA 4DJTA 6Q21A 4D82A 4HSEA 5K8TA 1DG3A 2F43B 5H68A 3AM1A 1II8A 4JSTA 4GL2A 3E2IA 4BFWA 4PQFA 2VP6A 4DT1B 4LV5B 2A30A 4UNQA 5FR2A 3VAAA 4LHZA 1KKMA 4B35A 1W44A 5AJYA 2X2EA 3LY5A 1LY1A 2YWEA 3LLUA 3OEHD 4IOJA 3I62A 1E2JA 4P33A 5HPYB 4HDQB 1QG2A 1MABB 4XD7D 3VX3A 3EIEA 1AA9A 4EIWA 1ZD9A 4AKHA 4BFSA 1S4QA 2P6UA 3IILA 4TTQA 1R10A 4BLQA 1AM4D 4EJSA 5JI2E 4KYUA 2QMOA 2IYSA 2FEMA 1N5JA 1D8TA 4V03A 3GLIE 2XXAA 3HDTA 1A7JA 4YMUA 1W0KA 4JLDA 2SHKA 3VHLB 3QPWA 2P3SA 2ODBA 1KSHA 1GFIA 1IY0A 4C0BA 1ZVQA 2AK3A 1CBUA 4DDUA 4PC3A 1OKKA 4U5XA 1KSGA 3PFIA 3SBEA 2AWOA 3U60B 2IYWA 3M1IA 2DWOA 5KDLA 3FOZA 1T3HA 3AP3A 2GCNA 3KTAB 4ZDWA 5K8UA 2ZITA 4HEJA 2BM1A 3BRWD 4A6XA 4B44A 2YNMA 2ZJBA 4HUQB 2B8TA 2AXPA 2BWJA 3UG6A 3AF1A 1F2UB 1HQYE 4JZKA 3K0AA 3U2QA 2RGAA 3K9HA 4ZIRA 4TSFD 2WWGA 2EWVA 2WPDA 3KXIA 1IONA 3CR8A 5EZ5A 3UMSA 2CLDX 3E70C 1W0JD 2JJ1A 1Z6AA 4MYHA 3UWOA 3A1WA 1I4LD 2IHBA 3EXAA 4Q9IA 4RD3A 3EPJA 1LTQA 4F4CA 821PA 1OFIA 4U00A 3ASZA 2QE7D 2XSZD 5CDFE 2IYUA 2Q3FA 4LBYA 2ZRMA 1GP2A 1VCIA 2Q6TA 2V8OA 3X2SA 4D6PA 4URUR 4XSGA 2WICA 2VLIA 4PHFA 5LB4A 1US8B 2J0SA 1E9RA 3F0TA 3SNHA 1UKVY 2A3RA 3ND9A 4ZKEA 1U99A 3FGNA 3DPUA 2O5VA 1IHUA 4Q9KA 5J4HA 3EA0A 5ELXA 1TNDA 4QGAA 3QE0A 4ACAA 5FFMA 2JLXA 2C78A 4A82A 1JXOA 2HCJB 2ZTSA 3GCGA 5CK4A 2TMKA 3KJEA 4PAMA 4TMKA 1HE1C 1H8HD 1P2TA 1L2TA 4JLAA 4Q1AA 1U90A 1Z2CA 3Q5EA 2GXAA 3AQ4A 1VIAA 1UF9A 4QM7A 3T1VA 1UFQA 2V9PA 2A5YB 2CJWB 1I2DA 3ZIAD 1NSFA 4M1KA 4EPVA 2BMFA 2NO1A 3R8CA 1CP2A 4ARZB 1CJVC 4DWJA 4MUAA 2PX3A 1G17A 1ZP6A 4FWIB 3AVYA 1DAMA 1LS6A 5EXTA 3NWJA 4JLBA 4QG7A 1VMAA 4AK9A 1XTRA 2F3RA 4Z1MA 5FL7A 1GAJA 1GNPA 1TUIA 4C0HA 1EFCA 2AXNA 3MWKA 3P26A 3FWYA 1QHNA 3OFNA 3PV0A 3S1AB 5KU1A 3TSWA 5C4GB 3Q72A 2WOOA 4FI3C 1AKYA 1R0WA 3U7GA 3G0HA 4E5UA 2E1RA 5DO9A 1IN4A 1TF7A 1UEJA 2W2XA 3GQBA 2WVJA 3QIAA 1WB9A 1Q21A 1E9BA 1RFLA 3AB3A 4NKRA 2RHDA 3KX2A 4F4IA 5FOWA 5JS7A 5KPJA 2ZE7A 1GKUB 3IEUA 3DMNA 1M7BA 3T12A 1J8MF 1S8FA 1XZPA 1YHNA 4CEHB 3QKSA 1CLUA 2GCOA 4TL6A 2OCYC 3GLHE 4F7WA 5SZJA 2ZI9A 4URZR 2N42A 3RRZA 5G53C 5IRCD 1IY2A 2YKGA 3THWA 3ICEA 1VYVA 1I4DD 1ESMA 3GJ7A 2XITA 2OE2A 3AVWA 1HV8A 1KDRA 1T6NA 1ZW6A 1W0KD 5JJKA 4HATA 2ATVA 2XAUA 1QZXA 4RD6A 4PC2A 5TARA 2C04A 5FTKA 2RHMA 1SHKA 4CIDA 3QKRB 3QUSA 5EE9A 4BEBA 5CIQA 1ZYUA 2A7QA 5JJLA 3UPUA 1S1CA 1V43A 1IXZA 3GJXC 4NH0A 4L8GA 5FUYA 4EFLA 4CGZA 3O8BA 3KKMA 4FIDA 4PX9A 5AJVB 2BBOA 4M9SA 4PPNA 4GNKA 4TL7A 3HWSA 4LJYA 4PHTA 1DAKA 3RWOA 3R9IA 1G41A 2OUKA 2AKAB 1AQUA 5E95A 5FOSA 5AJXA 5EE3A 3T35A 3TJZA 3O8RA 4KJZA 1NSTA 1KO1A 2VH5R 2EFGA 3EZ7A 1SVMA 1OSNA 2BMJA 3ND8A 4RFSA 1OFUX 3EZ6A 1T4GA 3EAQA 4BGDA 3KB2A 3QSYA 4FMDB 3AVQA 2VHJA 2V1UA 2X1VA 2JJ2A 2ZRJA 4V0MA 2NIPA 1KI1A 121PA 1ZM4A 4FCVA 5SZIA 3BH6A 5FL3A 1TQDA 2CLCX 3AF0A 4P4UA 1G8GA 1SXJA 2LCFA 3SOPA 4A0FA 2BEJA 3SFZA 5EP4A 1K8RA 3RC8A 2ATXA 3NEYA 1G8FA 3OESA 4QHSA 3PITA 3EA5A 1NY5A 4LBWA 1GIAA 1ELOA 4AC9A 3GLHB 4Q1EA 3RS2A 2ZU0C 3BFXA 3NG1A 1SVLA 2FSIA 4TYPA 3FFBA 5FBWB 3B8HA 4ZCLA 4QJ3A 5L8VA 5JECA 1TEVA 1E96A 4AKEA 5JWOA 2VEDA 1Z6YA 3GLIA 4PAOA 2ODNA 1KKLA 4ZCIA 1E9AA 1P75A 2IYRA 2PBRA 4HB0A 3BC1A 3BFVA 3K70B 4G5OA 2D3WA 2EYUA 2W0MA 4BRUA 4X8OA 2REBA 4N0EA 4E09A 2ZSEA 5F3WB 4QM6A 2O8BB 1M1YE 2IF0A 2AD1A 2V54A 1KHTA 2O0HA 4A0RA 3EC2A 1E9CA 4B74A 3FDIA 1AJEA 4KLZA 1E0SA 1UDWA 4MA4A 5KNDA 2QNRA 1X8LA 3I3SR 2X2FA 1X1RA 1GL7A 2WJJA 3W8RA 1NN3A 2FNAA 1U0JA 2XEXA 4V0OA 1YZQA 2DHRA 2ZAOA 3A4LA 1Q20A 4IVPA 1S3GA 1XEFA 2XZOA 3RNLA 4R7ZA 1PLJA 4B71A 2BKEA 5F98A 1JBKA 1E79D 4JL5A 5LD2B 4BQSA 3H4MA 3GJ0A 2ANCA 1BYIA 2RB4A 2WZQA 2MMGA 4BWYA 3SYKA 1QF9A 2XTMA 2ODWA 2C95A 1W7AA 2ZRKA 5E7JA 4TTPA 1N6OA 3F5FA 2OBMA 1AS3A 3TR0A 3EPKA 1XBTA 5CK5A 2BEKA 1XMIA 1U2RA 4DIDA 3LLMA 1U9IC 4MGZR 5D3QA 2B92A 3ZGXA 2F1JA 4ZDJA 3CBQA 1UJ2A 3LX5A 5HCNA 3SE0A 1ZAKA 1JB1A 1L4YA 1JAIA 3TVDA 1OIVA 2N46A 2Q9BA 2ZUCA 3TH5A 1WMSA 2A5JA 4MYUA 4BUJA 3CNOA 4JLVA 4KFUA 1TEXA 1DE0A 1P2VA 5DIFA 1RJ9A 4XOIA 1E32A 5B57C 5L3QA 4JT2A 4ZDKA 1WRBA 5AUOB 1X86B 3L0SA 2GVZC 3DMDA 3WRXC 1FQKA 4NCJA 2IYZA 2IS6A 3L2OB 5LPNA 2EVWX 2OCBA 4RZUA 1AN0A 2DFKB 1VHTA 5GADl 1G3MA 2IYTA 5FR1A 3KXLA 3HPQA 1COWD 5UKDA 3QF4A 2ZRPA 3PEVA 2J0UB 4G5QA 5D3MB 2WWIA 4MYTA 4O2RA 2OFOA 2BCGY 3PEUA 3RVBA 1NY6A 3H0KA 4U7DA 1TMKA 4LPSA 4BE7B 2DY1A 3GLFA 4OK3A 2EYQA 2G6BA 1N3BA 1W48A 2P0EA 3EIHA 4KODA 2DYKA 5CB8A 3C5HA 5IF9A 2ECKA 4PSKA 4IFEA 2FA9A 3OZXA 4GOKA 4M1SA 4JJKA 3SJZA 2WIBA 1TQ4A 1N25A 2CL0X 4GP7A 4MKIA 4JL6A 5EXSA 4Q7LA 2JASA 3QOFA 1R0XA 5DNYB 1G3QA 4M1WA 4Q4JB 1I4TD 5TV2A 1IXSB 4A15A 3RHFA 2MSCB 4P0TA 4MYCA 1UKYA 2D7DA 3C4JA 3ZQ6A 2ANBA 3FMOB 4FXPA 4OQFA 4RCYA 1II0A 4ILEA 2JIZA 2RGCA 4A0GA 5FBQB 1IM2A 3KQHA 2Z6VA 3PUXA 4OI2A 2O8DB 4MKGA 2XX3A 4HAZA 5J47A 1W36D 1BS1A 2PH1A 1L4UA 4B32A 5DISB 1Z29A 1EGAA 1NN1A 2BJVA 1MOZA 2BMDA 1VYTA 1EFRA 4LY6A 5LBIA 4LJAA 4L16A 1H8ED 1Z07A 4CRWB 1OH5A 4KFSA 5EXPA 2QP4A 3AKYA 1G1MA 5CJPA 1WE2A 2WTUA 1F2TB 2KBFA 1GOTA 4B47A 2ZRGA 4PSAA 1XXHA 2NO9A 3BH7A 4B48A 4TMWA 4LJ5A 1FOEB 4EPTA 3LQRA 1YR8A 1QVRA 3QEJA 3UATA 1KK0A 2VP0A 4OQNA 5J4KA 3WBKA 2F55A 3B60A 2CMKA 1M8PA 4HLDA 4LPKA 2GBLC 3KKNA 3KXKA 1QBKC 1XP8A 2C96A 4GDFA 2O8EA 4Q1DA 1YZKA 4JBYA 4LV8B 4B3XA 5EUMA 4KVGA 3D8BA 1JQJC 4PO1A 4WVFA 1GZSA 2Q0HA 2GJAA 2RKOA 2J1LA 3GD7A 4D4KA 1M2OB 1W4AA 2DB3A 3OIWA 2ZI4A 1T3LA 1XJQA 1DTSA 2W0SA 3CM0A 3VKWA 2KI5A 2CHVA 2PT7A 4D0GA 1XTJA 5F9HA 4XVQA 4A0HA 1CULC 3U3MA 4C3ZA 5KTYA 5FI1B 1ZJ6A 1Y63A 5J5CA 5JS8A 3GLFE 3TMKA 1MH1A 3ZS8A 1DAEA 4BEJA 2QAGC 2ZUBA 1KDOA 2OBLA 2X77A 2ZE6A 5BYKA 3GEEA 5JEEA 3MAAC 2CEAA 1X8JA 5KSYA 5DHFA 5FOTA 2YVUA 4JIMA 2G83A 3LW7A 3UG7A 2GXSA 3QPUA 1NMZA 2IW3A 1SGWA 1DELA 4H1VA 2HF9A 4NP6A 5FI0B 1W0JA 1AGRA 1U8ZA 2WWFA 4DSNA 3QJYA 4DCNA 1OXXK 2O8FA 4ASUD 2XNDA 2J7PA 2R6DA 4JT4A 1XD2A 2C98A 4AIIA 2ORWA 4HAVA 4V0NA 4MDFA 1QHIA 2D2EA 3GFPA 2PZGA 5DYGA 2DFTA 4OL0A 1KAGA 4PQRA 1FFHA 4M1MA 1KMHB 3SHFA 4Q4AA 1G8HA 1OHHD 3DDCA 4PPFA 3GJ3A 4X8LA 2CVFA 1E1RD 4BFZA 3GJ4A 4B3CA 1XF9A 2PZEA 1XTQA 4P3YA 4P4SB 1GL9B 4QHYA 3QNUA 4TN1A 2ZS8A 3RSLA 2HXYA 4HZIA 2Z4SA 5DSZA 1KGDA 4TL9A 4PTLA 5FTLA 5B64A 3SQXA 4IDHA 3KKOA 3T5DA 2OG2A 3PR1A 2QMEA 1E6CA 3CB4A 1P62B 1YZUA 2HEIA 4CVNA 3SU8A 2QRZA 4XD7A 3K0FB 2OO7A 3W6OA 2QT1A 3H1TA 2DWPA 1CS4C 3QEOA 3ZH9B 1XEXB 1W46A 1JXMA 2VA8A 4BRWA 2WWXA 4E22A 3W6NA 2J46A 1FX0A 4NMMA 3P4YA 3TE6A 5DI3A 2ZANA 4Q1FA 3AF2A 3AVTA 3CNNA 2ZR0A 1N6NA 1NVUQ 2ZJOA 3K09C 3SYLA 1U98A 2WWHA 5KUTA 4GFDA 1WF3A 1FMJA 4WXPA 3G5UA 5C4MA 3B82A 2CBZA 3VR6A 4KITB 4HDOB 4A6PA 4IDPA 1HT2E 4KI0A 1RRPA 1DADA 2H17A 4Q02A 3K0SA 1JPNA 2JLZA 1Q44A 2XJ4A 1RC8A 3IHLA 1IXRC 1VHLA 2DPXA 4IDOA 2ZI6A 2IC5A 4US2R 1SKYE 4G3XA 4KFRA 4S2EA 4WOPA 3TLXA 4EQ6A 1TUEA 2XNSA 2P6NA 4NL4H 5CM9C 3E1SA 2P2LA 2CHGA 3HYTA 5CYOA 1E99A 2QAJA 3W34A 4B76A 3CRRA 4Q7JB 4AI6A 2BHRA 2NMVA 3BWDD 4D4JA 2KJQA 1U9IA 3NHAA 1OIXA 4WIAA 1Z2AA 1JEEA 1S0UA 4GOXA 2Q9CA 2R2AA 4S35A 4JLPA 2CE7A 4DCTA 4DZZA 3IIJA 5JEDA 2J59A 5EP2A 3PEYA 1NVWQ 1M6NA 4A36A 4V0LA 2EWWA 2BIFA 3DVLA 4O2LA 1FUUA 2VIIA 4KBFA 2HYIC 5FTMA 1EWRA 3AVVA 5JI3E 5EJEA 4G1UC 5CLLA 1FP6A 1KI6B 5AK0A 4LRWA 2VF8A 3QG1A 1TU3A 1KMQA 3DEFA 4X8MA 2GKSA 4NYMQ 2D4HA 4C30A 3LFUA 1VCNA 2OEPA 2R6FA 3THXB 1CXZA 2BVNA 4OI0A 3MWLA 521PA 2OFXA 4MRSA 4NBSA 3PUZA 5DHAA 1BMFD 2NZJA 3FHTA 3QXHA 1FQJA 2QENA 4YMWA 1ZCBA 3NH9A 3CZQA 2CL6X 4DIEA 5F9FA 2QAGA 3WMGA 721PA 2PL3A 3L8ZA 2VP4A 5EP3A 4LI0A 4Z8YA 3GLGB 4HDCA 1LF0A 1G3RA 1KI7A 3N2EA 3THYA 3U7EB 5GJBA 1NBME 4KVAA 4UJ5A 3NHBA 3MJRA 4GZLA 4OK5A 4XVUA 2G3YA 3MSXA 2ZJ8A 3AVPA 4R2IA 3A4NA 2QA5A 4FD2A 4DLRA 1KNXA 3DOEA 3O8DA 3ADDA 2ASEA 4RD4A 4YMVA 4OHYA 2I4IA 3LNCA 2XJ9A 3EARA 5IT5A 2IS1A 4WAUA 1XJ0A 1M7GA 4E03A 3AP2A 3CW2A 1DG1G 4B2IA 3PUYA 4W9MC 2MSDB 4I1UA 1F48A 2BOVA 2E87A 2G77B 2FPKA 4CDGA 5FOVA 4CT4B 1P60A 1B0UA 1QVAA 3IQWA 2H92A 3O47A 4BLSA 2PT5A 1XCMA 3D31A 2KWIA 1JNYA 4RD0A 2IA5A 4W5HA 2QSYA 2ZYTX 3GJ6A 3SDZA 4MRRA 3LVRE 5CJ2A 2IUUA 1KOFA 4B3DA 2FJUA 4TLCA 1COWA 4NYJQ 2JDIA 1S9DA 4YLGA 1E2EA 3NBZC 5CB6A 2GILA 2JLUA 1VKJA 2NO7A 4FMDF 3IUYA 1MT0A 2ZVQX 3CIOA 3VMFA 5AR1A 4KCGA 5EQTA 5KOYA 1AGPA 4WZAE 3OF5A 3SJBA 1Z6TA 3T61A 3P27A 2EFEB 1U0LA 1Z0IA 3LWNA 1C9KA 3REFA 5DLQC 2W6ID 1GWNA 3QXCA 2DWQA 1UADA 3EZFA 4FINA 4C0SA 3QPVA 1Z83A 3THYB 3GLGA 2AHOA 3W5IA 1HUQA 4LHVA 2P5TB 2QAGB 4R98A 2YWHA 5KPDA 2CK3A 5CITA 2WWYA 4M21A 4OBEA 1J8YF 2WOJA 1HYQA 5CYPA 2VRWA 1D9XA 1T91A 4KYIB 4ZI3A 5E7IA 5BYJA 1DAFA 4B6FA 1SQ5A 3THXA 1JPJA 3LD9A 2HF8A 1JJVA 4G5GA 5FPHA 1GM5A 1UKEA 3T06B 1XDBA 1N6PA 2PLFA 1ZC4A 4TMTA 1WP9A 5FBVB 4UXJA 2OHFA 4L15A 5F2EA 5FOXA 1KI6A 4KV9A 4LHWA 1UM8A 3AKDA 2F9LA 3MCAA 1R7RA 4IVRA 4M9ZA 1BKDR 2NO0A 1CKEA 5IDVA 2PJRA 2H57A 1Z06A 2GXQA 1E2DA 1NLFA 2H8KA 2Z5FA 5B58C 4GMDA 4EPWA 1S3SA 2BKUA 4DSUA 1QHSA 4YDSA 4D25A 2QMHA 2ZVPX 5E4FA 1N6IA 221PA 4ZKDA 1ETUA 2GJKA 3HYRA 5GJWC 4NYJR 2GVDC 4IXNA 1KI9A 3ZLJA 1E2QA 1SVWA 3SBDA 4XJXA 4LV6A 1XTIA 2XOKD 3PIRA 2YC2C 2CNWA 2QZ4A 4TYWA 4ZPXA 2HJVA 1BO6A 5DN6D 1Q12A 2GZDA 4N0DA 4GI7A 2QQEA 3A8TA 1YVDA 5DE3A 3I5XA 2IXFA 2W00A 4EQ6B 4EPXA 3QVVA 2B21A 2K5UA 4A2QA 1YE8A 4B3GA 3W90A 2N1BA 1ZD8A 1Z0KA 1F5NA 3NKVA 2AK2A 2MSEB 1KYIA 2R9VA 2VPPA 2Z43A 5BXQC 3F8TA 4L9WA 3CLVA 4EAQA 4OHWA 2JA1A 3B13B 1Z22A 3D6TB 3BIFA 1SULA 2IEZA 2GF9A 2XB4A 4TL8A 3IBGA 2GBLA 2YOFA 4TMVA 2G88A 3BGWA 3QF7A 4CW7A 5DI3B 1CJMA 1FX0B 1GVNB 2F1IA 4PC1A 4Q1BA 2X19A 4D4LA 1N6HA 3NBFA 1DO2A 1XEXA 1VG1A 4TLBA 2NTYC 1GKYA 2ZREA 4Q01A 3K0FA 4O0MA 4AYXA 2ZRBA 1DAHA 3CPEA 4WBSA 3V00A 4DB2A 3I32A 1G5TA 5HR5A 3K09A 3BJIC 3P1JA 1ZNYA 3T5GA 1PV4A 5KDOA 2FWRA 1WCV1 4WW0A 4K8OA 5TVKA 3A1VA 1G21E 2NQ2C 4HUTA 3AF3A 3QXXA 2W58A 3SN6A 3B1YA 3C5CA 2FH5B 4US0R 1XPUA 4P4SA 5GJVC 5A5GA 4NDZA 2W6JD 3QXSA 2PEYA 1KTVA 3I61A 2JGNA 1X8KA 3AGPA 4Q4AB 1JECA 3THOA 4DLTA 1KMHA 3M6AA 2A78A 1JAHA 3LBIA 1OE0A 1OF1A 1ZBDA 2JLRA 3WHKA 4DCVA 1KI4A 1PLLA 2UZ3A 4G0NA 2BV3A 1N0VC 1CR0A 2A5FA 4X8HA 1HTWA 3RRMA 1FNMA 3E5HA 5AUPB 4C2UA 3FMIA 1XD2B 3BFKA 2JLQA 4AYWA 4EDHA 2IS2A 1FL9A 3PENA 4A2PA 2O8FB 1OFHA 4LK2A 3C15C 1G5RA 3B85A 3GEIA 2IYQA 1D5CA 1NF3A 4OHZA 2EW1A 4NCIA 1VG0B 1OHHA 3KL4A 3HU1A 2OILA 3BH0A 5G41A 4AG5A 5J40A 2HJGA 4M22A 3EPHA 1WBBA 2A9KA 2WAXA 2EQBA 2V4ZA 2QPOA 4GPTA 2HDNB 5FPTA 2REOA 2IL1A 3VHXA 2EU8A 3ZZTA 5GVSA 1M34E 1HT1E 2FZ4A 4ESHA 1E2FA 2ZSFA 2GEDA 1IAQA 1YU9A 3LAWA 3QKTA 3T15A 2FX3A 2J45A 3BS4A 3QKUA 5K8IA 4JMPA 4JS0A 4IVQA 2GJSA 5FTJA 1G19A 2CNWD 4OJQA 1AKEA 5CIWA 5JLJA 4JKIA 3K70C 4AKIA 4JLNA 3K0CA 3NC0C 3LX8A 2WHXA 4UNPA 3RC3A 2XTNA 2OCPA 4V0KA 2O8EB 2OV2A 3IKJA 1S9HA 1X6VA 3A58B 3BD9A 4LGMA 4DUGA 2WIAA 2C77A 1NG1A 3V4RA 1M74A 3RS4A 1MKYA 1XMVA 4KXFB 3KJIA 3CRMA 5LD2C 2OBNA 1XXHB 3ECCA 4EJSC 4OHVA 1CRQA 5LB2A 3W9YA 1KO8A 1F2TA 1T0JB 1X1SA 4UJ3A 2Q3MA 1Q57A 4W5WA 4QBIA 3SHWA 3CWQA 2V6JA 2ZR7A 3Q7PA 3RANA 3TNFA 4NTZA 3Q85A 3NXSA 4XTCS 3RS5A 2GETA 3BB1A 2QPAA 2Y8EA 4EPRA 4DDTA 1PUJA 4M1OA 4QC2A 3U3RA 2ZJ5A 2CK3D 4Q7KA 4QJ4A 3P20A 2O8DA 3DOFA 1G4UR 2H16A 2VP9A 3DKVA 3DO6A 1FMLA 1ZNWA 5E7MA 4UQOA 1G9XA 2IYLD 2VP2A 2P67A 2AWNA 2ZS7A 3RRYA 2O0JA 1XFAA 1R2QA 4M1TA 3OE7A 4Q4JA 4XWAA 4IDQA 2D74A 1E2GA 2ZI5A 2PJZA 3ADKA 2GJ9A 5H1YA 2FOLA 4M9XA 1A2BA 2CL7X 5E3HA 1KAOA 3GJ5A 4MGYR 1R8QA 4TT3D 1GNRA 4CYMA 4LWZA 3OAAA 4BLRA 3B1XA 4D4MA 3K0CC 4EPYA 2HUPA 3GLFB 3EX7C 1E79A 4EFMA 2JLSA 3B5JA 3IIKA 5BQ5A 3Q8XB 3C7KA 2XGJA 5TXGA 4JLKA 3JZMA 4PZZA 3WP1B 5D3MA 1ZM3A 1TF2A 2J0UA 1P6XA 4Q1CA 1E2MA 4M0LA 3QF4B 2QROA 2P65A 5B30A 1UPTA 3TGPA 2QGNA 2OAQ1 2WJYA 2IYXA 1XPOA 3MJHA 4O3MA 1ZM7A 2C9OA 4RKFA 4XSHA 3EW9A 2XOKA 1KNQA 2DCUA 4G5RA 4I4LA 5C18A 3U6KA 1DVRA 3HU3A 4JVSB 3VX4A 5L3QB 1UBEA 4M4SA 1RJ9B 2HT1A 3RLFA 4CZ2A 4XWOA 1SVKA 5KSOA 4K46A 2JIZD 4AY2A 4HAWA 2GESA 2OCAA 5CLQA 5KYKA 1SKYB 1EFRD 4DB4A 1ZNZA 5LDDC 3SI7A 4Q21A 4YQFA 4LJ9A 2I1VB 3LV8A 1GITA 4F91B 2VSOA 3AH8A 2I3BA 1VYUA 3OIYA 3BE4A 5EXXA 2WJIA 1Y3AA 4UNSA 2HYDA 1UBCA 2Z4RA 2NOAA 4NCHA 1XD8A 3IO5A 2HCBA 1E0JA 2VHUA 4D2IA 4URXR 4UNRA 2FGKA 4DLUA 4MRNA 5FL7D 4I1OA 1JR3D 2FPMA 3FMPB 3VNVA 2VQSA 2CXXA 2H18A 3OHMA 1OIWA 3KUDA 4GSYA 4H1UA 3RRNA 5EP1A 5HTKA 1N2CE 3U5ZB 3CR7A 3CNLA 4Q19A 1TU4A 1YZNA 3AUXA 2NO6A 5JCPA 3H84A 3UK6A 3CONA 1KY3A 1BH2A 1KI3A 5IK2D 2RGNC 2WAYA 5FOUA 3ZDQA 1HURA 1NRJB 5AUNB 2Z0MA 2V55B 4B43A 3G82C 2O8BA 3AUYA 3DL0A 4O25A 4YDHB 1GNQA 1S2MA 2FSHA 1X3SA 4CF7A 1KJWA 1N6LA 3NVAA 2VO1A 3GLIB 1AS0A 4NU0A 3BB4A 2J3EA 4GT1A 1U0HC 3ASYA 1ZRHA 2WSSD 1SXJC 1TX4B 2REXB 4A4DA 1IN5A 2D2FA 4HB2A 3ADBA 1KZ7B 2JATA 2GEVA 2V1XA 1GG2A 2QTFA 2C5LA 1FW6A 3PJRA 2NG1A 1GSIA 3A1SA 4DLSA 2ZIAA 1NIPA 1D2EA 1UBFA 3GLHA 2JJ8A 2BBTA 2QSZA 2YHSA 5BWMA 3KZ1E 4DLWA 3RABA 3Q3JB 3HU2A 1DAGA 1H8EA 1NMYA 2OAP1 1DS6A 4LYHA 3QVUA 4TSFA 3LQQA 3B9QA 2AX4A 3NDPA 2LKCA 1SXJB 2RCNA 2QN6A 2NPFA 1VCMA 1DBSA 2QMUA 1XRJA 3NTUA 2BC9A 4C0KA 4PC7A 3WMEA 2R6AA 2HLDD 1U81A 4IOLA 2WJGA 4NE2A 3JZAA 4Z8XA 4OI1A 3IPYA 3VR2A 4ZI2A 1J2JA 5JBQA 4I81A 1IN6A 4R9UC 1G5PA 4BLOA 1FTSA 4RFSB 5FUWA 3FE2A 2CHQA 4HB4A 2FGJA 1SXJD 4KFTA 4MITA 3FVQA 2ZI7A 2VP5A 4QRHA 5J4YA 3B6EA 1L7VC 2ZRDA 1H65A 1XZQA 4PO8A 3WYAA 1OPXA 2NPIA 3BORA 5FTNA 3ZIAA 1D9ZA 1T8TA 4Y0VA 5FBLB 4QBFA 1W5TA 3MUFA 3FFAA 3VTKA 3VKGA 2RMKA 5HKKA 1XCGB 1YZLA 2VL7A 3CF0A 3NDBB 3DZ8A 2IF2A 2ZJZA 4K81B 2ZPTX 1QDEA 1XNJA 4RY2A 4Q48A 3OEEA 4HYYA 1LNZA 3QKRA 3MFYA 3QXJA 3ZVRA 2RGXA 2VSFA 1UEIA 3IHWA 1E2HA 5KSZA 2W83A 2ZQ5A 4NPHA 4LUCA 2QT0A 1N5LA 2OLKA 4Q47A 4B6EA 3RWMB 2XB2A 1CJTC 3THWB 2MMCA 3N5CA 3SS8A 3R8FA 4UXIA 1VECA 2IBMA 2KBEA 3AV0B 2GCOB 3FHCB 3QKSB 3X1ZA 1RYHA 3TIFA 4CEHA 5BN3A 4TYQA 1XWIA 4GMXA 5HE8A 1B23P 1OYYA 3H2YA 2DBYA 5DH9A 2VBCA 4B3FX 2A5DA 1E0AA 5JJIA 1W2GA 2W6IA 1G8PA 4H9GA 1E2LA 3X1WA 4ZV4A 1WQ1R 1QHYA 3UWKA 1QHXA 3GFTA 2AKYA 5BN5A 3AVUA 4QKQA 3TAHA 4PZLA 2J0VA 4NYIQ 2WKPA 3VKHA 1OXTA 1LS1A 2R6GA 3MWJA 2BBSA 4OQXA 3S1AA 2F1RA 1IBRA 3CRQA 3Q9LA 3ZVLA 3RS0A 1KY2A 3KQNA 1NBMD 1FTNA 1WXQA 3QI2A 4Q7MB 3KQLA 4JLOA 1L8QA 2WWWA 1GKIA 2R44A 3M4YA 4P4TA 1OV4A 1S1MA 4LJ8A 3ZYCA 2D06A 2ZI3A 4ARZA 1R0YA 2PCJA 1Q22A 1ZM2A 2PX0A 4TLAA 1MO4A 4IXMA 2XZLA 1EFTA 2CJWA 2C03A 2R62A 2ZRFA 2YJTD 3UANA 621PA 1RIFA 2FSGA 3ZZUA 1YRAA 3WYFA 3KKQA 1N5IA 1OW3B 4EFNA 2AD5A 3EPLA 2GWHA 3TAUA 3ZVMA 4C9BA 2FE4A 1W4RA 3EG5A 4PZYA 4Q18A 421PA 2PMKA 3QENA 3NEJA 1MO6A 4ZDIA 3U3OA 3TQFA 3MD0A 3FTQA 5DGXA 4KBGA 2DFLA 1G18A 1U8YA 4HLUC 1G20E 2CCJA 1Q1EA 1BOFA 1CR2A 3F3YA 4IJMA 5B2ZA 2P6RA 1US8A 3LBNA 3KUCA 1R8SA 2QM7A 3B1ZA 5AUQA 4A9AA 2C8VA 3PEWA 1VG8A 4Q03A 1KIMA 3MMPA 4II7A 2H5EA 2ORIA 4M1YA 3W6PA 1GRQA 1PUIA 1NN0A 3B2EA 4OJKA 1F3OA 1XU4A 5P21A 4QNMA 1ZINA 4XTRA 3NBXX 4B75A 3I4LA 1DPFA 1C4OA 5FBRB 4IHQA 1Q3TA 2OESA 3P4XA 1W36C 4ZIRB 1IY1A 1JR6A 1G4AE 4IOMA 3K0AB 1NKSA 1R0ZA 2FPLA 1F2UA 2J7KA 3U3JA 2PLRA 1NLYA 4ITRC 4BLPA 4QFMA 4HUQA 2GF0A 4MRPA 3DM9B 3HP1A 3BAFA 5G3YA 3ZS9A 4BPBA 2ZM5A 3KTAA 3V9PA 4OKSA 1U8AA 5JHHB 4MGKR 2R65A 4RZXA 3U3KA 3B78A 4ABYA 3SYNA 1FPMA 3ZD7A 2GTPA 2GZAA 3K0EA 4LYFA 5HZHA 4URWR 3WNBA 3IQXA 2QY9A 4TTRA 2RGGA 1LFDB 1VPLA 3R20A 2WSSA 4DSOA 3CH5A 1YR9A 3PQCA 4M53A 3WNCA 4PHGA 4A2WA 1E9SA 2W2TA 3NIBA 3RYTC 3TVTA 4D0NA 1W49A 3ADCA 3TW8B 2XXAB 1P9NA 3KQUA 1T8UA 1SZPA 1NL3A 2FFAA 5DYIA 4EJSB 3K53A 1E1QD 2UKDA 1RYFA 2VTKA 4IKEA 1A2KC 4KSCA 1MABA 4B3BA 1P72A 5EE0A 2Q21A 1A4RA 1G7SA 1HE8B 1OXSC 3CRVA 3W3AA 2JLYA 4RVCA 3GEHA 1KI2A 3EZ2A 3UIEA 3PCRB 1G7RA 5JMTA 2OLJA 1XMSA 3KFVA 4DT1A 1JALA 1HH4A 3MWYW 3R9WA 1Z3IX 1II8B 3DHWC 1W36B 3I73A 1HEIA 2F43A 4EUNA 5CDFA 3TQCA 4NYMR 2AR7A 4Q9LA 1MRNA 4B34A 2JLWA 4BFUA 4D26A 1A82A 3CKLA 2J5XA 3BK7A 1NKTA 1JR3A 2QQ0A 2J87A 3X1DA 1Z47A 4U02A 3AGQA 1RPZA 2F7SA 3DKPA 2RGDA 2GJ8A 3TKLA 5KNCA 3LO5A 3WXMA 1K6MA 4L4UA 4TT3A 1GL6A 3WRYC 3I8XA 2OFWA 2Z83A 5FPKA 4TLDA 3VR1A 4BFVA 3L0OA 5M04A 5TDHA 1W4BA 4R2HA 2O8CB 1JI0A 1Z63A 2ZYUX 2IT1A 3WYGA 4XH9B 1N0WA 1RVDA 3FKQA 4W7SA 5G40A 3TUIC 2ZE8A 4OQMA 3ONWA 4KU4A 1YR6A 5A4JA 2ZETA 4Q4HB 1ZUNB 4GOJA 5FH9A 1Z0DA 1YJ5A 3CF6R 1GRNA 2FG5A 2QTVB 4PSVA 2PCLA 1RE0A 5JSZB 1RZ3A 1DARA 1XX6A 4N3NA 4BFTA 1J7KA 3U6BA 4MKHA 3U4QB 2YC4C 4JVMA 2X8AA 4KLNA 3X1XA 2FEOA 4PPGA 5FPSA 3RS7A 3QG5A 4PQYA 2O0KA 2XZPA 4QNRA 5KSPA 3TSZA 3GPLA 1QHHA 1KO4A 2G0TA 1PJRA 1T0HB 1W1WA 1OH7A 4TQAA 1EXMA 2W6JA 3AF4A 4MQBA 4Z51A 5TY0A 1YRBA 4L9SA 1TQ6A 3FB4A 4N1AA 1PLKA 4DRZA 5C2JB 3IIMA 1E98A 1YZGA 4PC6A 4DUGD 3BB3A 3M0EA 4DDWA 1NNEA 2YOGA 4XVRA 2IWHA 4HAYA 1P7CA 4NZYA 2VHQA 2KB0A 2EFCB 4F38A 1KSJA 4B2LA 2QGZA 3QQ5A 1OB2A 1NMXA 4GP6A 2OT3B 4DEYA 4WA7A 4PAQA 2ERXA 1KI8A 4BZPA 1KO5A 4DC9A 4XWKA 1MR3F 5HCIA 1UDXA 4P31A 1Q0UA 2JAQA 1W5SA 3FHOA 3AKEA 1D2MA 3MLEA 1KSFX 1G3IA 1XTKA 2QU8A 3R7WA 1NJFA 3LXRA 2JLVA 3KJHA 1G8YA 1G6OA 3QBVA 4Q9HA 3MGCA 1K5GA 2ZRHA 3TUZC 3X1YA 2QBYB 1AK2A 1HY3A 1P4SA 2WJVA 4OYHA 4ESVA 4IDNA 4M8NE 2EFDB 4P32A 2CCKA 8OHMA 1DOAA 3LDAA 4LBVA 4RFVA 1UKZA 4BECA 1LW7A 1E3MA 3IO3A 1CEEA 3REGA 1ZMXA 3ETLA 1DAIA 4LCBA 2RAPA
chains in the Genus database with same CATH superfamily
4FYIA 4JJIA 1Y6GA 4RJ2A 4RQBA 2DR3A 4EW2A 4OGLA 5FAKA 1S7GA 4DIBA 5EIWA 2IYFA 4LF6B 4QYTA 1NXWA 3GPBA 1PKEA 3AL3A 3T3MB 2JIRA 3EF1A 4EJ6A 3ZJTA 3M6FA 2YWJA 3FZQA 4KDEA 3D3QA 4MUMA 1E1RA 3ETEA 3PXEA 1CRPA 3DG9A 2WBLC 5LZ7A 2H2GA 1YONA 1I10A 3OU7A 1U28A 4B73A 4YXWD 3VNUA 3ZGVA 4JY7A 4WBNA 1QP7A 3WWOA 4B2PA 1V25A 5A5FA 3SDBA 1WS6A 1ORRA 1ZX1A 2F3TA 4KACA 2ZSIA 5DIZA 1WXGA 4PANA 1JU3A 5CEFA 1ZBQA 3V7YA 4ND8A 2JIBA 3LOUA 4B4OA 4DJFC 1VA4A 1AQIA 3R7AA 5KKNB 5C8XA 4Q4DA 3EGEA 4EF6A 1D4ZA 4UKDA 4IIBA 3WHPA 4ZAGA 5ESRA 5EJ9A 3GLGE 2L19A 3HB5X 1ADGA 1EM8A 2X5JO 3FSJX 1RXEA 4N5IX 3JVVA 5K20A 1E3SA 2GPYA 4TWZA 2NVUA 2B7CA 1JH8A 2CLSA 1R6BX 4XZ3A 3QFSA 4W1RA 3JQAD 4JUDX 4JYAB 2GCPA 3T99A 3W79A 1Q1QA 2GXUA 5IZCA 1CG6A 1Q7BA 1XDUA 2ZROA 1U7ZA 4XR9A 2XNKA 3HADA 3UAOA 1Q1BA 3C41J 1KH3A 4Y9TA 4RADA 2WF7A 2HNKA 2WMOB 1G3UA 3CX3A 5CDGA 2PSJA 1T8SA 2AZ4A 2GPNA 1YJAA 3SKYA 5DULA 2R6R1 4R8KA 4TPKA 5ALFA 4TV8B 4AZ3B 1FLNA 5IANA 1JX6A 3R3HA 1YZTA 1BHO1 5ESWA 1IN8A 1N6KA 1PL8A 2A59A 2HQOA 1AQYA 4IF6A 4O2BB 3DULA 4OSPA 1JHMA 5BOSA 1S2GA 1UXGA 4JSRA 3HJFA 1E9DA 2GDJA 3D6VA 4NOMA 5B1DA 1RC1A 3HKCA 1B8PA 2BTQA 5B37A 2A1UA 3TJMA 2P7HA 1KQ3A 5ALHA 2PD6A 4JVLA 1GUDA 2IS4A 4RTMA 4EDFA 2WINI 1NLUA 3R6GA 1AURA 2WG2A 3HXPA 4XUDA 1L1RA 1XF1A 3WGTA 2AL7A 5F7XA 3IP1A 5AKXA 3DL4A 5L3VA 4WZAB 1I9CA 1R66A 5EERA 3WL4A 4C06A 5JCZA 1JLRA 4YQZA 1SUIA 3PNVA 2VUSA 3I0NA 4MV6A 2YZ2A 4YRJA 2WWVD 3VPSA 4IV0A 1FUKA 1U2QA 3S2EA 1Z28A 4NOJA 1N0UA 1NVXQ 5H81A 1FA9A 1P2SA 1U2DA 3MJDA 3TEFA 1HNZB 1CB0A 1TK9A 1AZTA 1OT3A 1VJ1A 2DECA 1M2GA 2PUTA 3EZLA 4BASA 4AKGA 4BFLA 3O8CA 3H2HA 2BZ0A 3I30X 5BUZA 2ZUEA 2H5JA 1IY8A 2PR2A 3T7JA 2IZZA 2X9VA 2FFHA 2OM2A 2XUQA 1MRZA 2YWBA 3AW8A 3IQHX 1DEAA 1ODKA 2YWFA 4QASA 2OO5A 4WY8A 4DCMA 5I7EA 3K15A 1GUAA 2DPYA 1TK3A 2W37A 3SHTA 1FDOA 3T9AA 1ACJA 1QOPB 3U4CA 1V9LA 4MI1A 1G38A 5JZOA 4GU5A 1CDZA 3U3ZA 3A25A 1X80B 1DEKA 4L8YA 4QDTA 4DCSA 5B7PA 1KERA 5J59A 3M7IA 4XKJA 4AECA 5AJWA 5IAEA 1X13A 5J23A 2ZWVA 1C7RA 1JA1A 3A31A 3CPHA 4PSCA 4EA8A 5L3SB 4H35A 3SX2A 1RKBA 1NP6A 1E1KA 1RCFA 2P78A 4S1WA 4QDKA 4Y0AA 5DN6A 4NHOA 1J39A 4UHHA 4DR2B 3ND5A 1PT5A 1Z12A 2B8NA 1U3UA 3G2JA 3L93A 3OPYB 2QP3A 4MRVA 4Q4LA 4B8ZA 3ICQB 3H4VA 4M3NA 3NYQA 3JR7A 5K8LA 5BR8B 4DV2B 4NS4A 2GPWA 3FWZA 1H8HA 5DZSA 3HA3A 3OEHA 1B2LA 4IO0A 4EMUA 1XMJA 4MDEA 3R74A 1M10A 3WLMA 5ES3A 2AOWA 2IPNA 4QPCA 4HNUA 2GN9A 3BX1A 5IWCA 1OB5A 1L5SA 2IYOA 1N1EA 4IQ4A 2XNHA 3IBYA 2WQ7A 3VNBA 3HSKA 4DQKA 4LBZA 5L7TA 2GZ1A 2JDID 1EYZA 4R1MA 2GPAA 2QNIA 4MB6A 2X5XA 4YLEA 5EKUA 3C97A 3ASVA 2Z5GA 3MF4A 4U3JA 3P19A 5BW6B 2Q5CA 4JUAA 1H6DA 1DSSG 1BMFA 1FRVA 1J1ZA 2Q3HA 1D3AA 3DGEC 3NIGB 2IHNA 3MUOA 1RI5A 1EFHA 1MBZA 3EN0A 4DYDA 2GM4A 3OQNA 2N9UA 1TVEA 1VRWA 1C14A 3IXLA 5BW8A 2RKWA 3HS3A 1DWUA 3DV9A 3ESQA 3LZCA 3EVAA 1FLDA 4JP2A 2ZJAA 5IJ0B 5KDDA 1FE8A 2D62A 4GO1A 2IBSA 1RBYA 3FMFA 3IELA 1M2EA 1FS4A 5CFNA 1F6BA 2OA0A 3O73A 3GZNA 2PN1A 2D6FA 4QPJC 1I1HA 1WXXA 2H1LA 2HBYA 3HJGA 3HMQA 4MUBA 4MHSA 1IQPA 4U7GA 4XQ9A 4NCKA 2G0NA 5HRAA 2OMKA 2OBFA 4UBJA 3RUFA 1XFDA 3IPXA 4H1WA 4DXAA 1XMQB 1FDTA 4O8CA 2QYSA 3LT4A 3DB2A 3TTYA 5H3HA 5GIOE 1J9ZA 2PIAA 2XMSA 4WZAA 1YBAA 4GZ3A 5ICCA 3D0RA 3QWIA 1ZGZA 5AWFC 1L8AA 3NANA 5B7NA 4UXHA 4LE0A 2BMEA 3U4IA 3FY4A 4A8JA 3CRNA 4RANA 2G1PA 1PJCA 1J33A 2XF2A 1VE1A 2XQKA 1A5ZA 3JWJA 4FFMA 1CJUC 3AX6A 4FQ8A 5BRNA 2QL7A 4Q3DA 1T5IA 1QDUA 2I6XA 4CCAA 4CTNA 3M6UA 3LHKA 5GAJA 2WF5A 3FSEA 3IP3A 3QVOA 3AP1A 3ZQJA 4EYGA 5JCXA 1H2HA 4JJFA 2RKBA 3WRWA 2I8AA 2IFTA 4RSGA 4TV8A 2BY4A 1WCIA 1BG6A 1GU1A 4YMTA 2VQ3A 4O3FA 3D7MA 1OYVA 2AX3A 2GRAA 4HB3A 4ZI5A 3I2FA 2CVHA 3ZWBA 4J0EA 3BK1A 4Z86A 1L5YA 1L4NA 1VLQA 2W8BB 3CWZA 3MNFA 4C5BA 4YUWA 2CT8A 4F3TA 3W78A 1L1FA 1XPRA 2VHXA 4ZCRA 2FN4A 3B6IA 1TL7C 4PG6A 2DF8A 4RVSA 3PFKA 2YJ5A 2GHTA 2XT9A 1II9A 4GGPA 1UZAA 3UENA 1Y4DE 1KORA 2WUDA 4Q66C 5A3JA 3MT7A 5H8WA 1GYRA 2WP0A 2J85A 2AEEA 3MJFA 5LQNA 1LSJA 1VJTA 1V71A 1C7JA 3PPIA 1NXVA 3PT9A 1QGUA 1NONA 3E5MA 4EB6B 3H99A 5EJ2A 2EDAA 1EM8B 4NESA 2AN9A 3DMHA 1NBMA 3NNNA 3PFNA 2QEQA 4P7BA 3BCHA 3Q1KA 1NJGA 2O6LA 2VT7A 2WIDA 3HXKA 2GJ4A 4C0AC 4OQDA 2G1KA 4K9KA 4XM2A 4BNXA 2G72A 4R2JA 1M66A 1LVGA 1NURA 2QPTA 3AUTA 4D57A 2VXYA 1CV2A 1IH8A 3IPAA 4MH0R 1GRVA 1KK2A 3DW1X 3THYB 2Q45A 4MAAA 2Z2XA 4W1QA 2RGEA 3OWOA 1NW7A 2YOHA 2ZYVX 1Q0ZA 4FMCF 4O0LA 3GLUA 3MXOA 2ZRCA 2FLKA 3N1UA 4BO6A 5KVSA 2H0AA 1F4PA 2JIOA 2OOKA 3KUXA 1OA1A 2QE7A 4RIHA 5AH0A 3A9VA 4GPIB 1NBOA 1U8FO 4TXNA 3CO5A 2R6ZA 1C1YA 3LRTA 3NHJA 4F11A 3FPAA 1Z0JA 2FUG1 2NZYA 3H1BA 1NMSA 1YS6A 1RW4A 1XJCA 2FWJA 2HM7A 4H0FA 4HN4B 1M9NA 3QVTA 1VYHA 3ZDXB 2BGJA 4MKZA 3V7WA 3LZ6A 3K1YA 1QK4A 3JQCA 1UC5B 2EJCA 2FMXA 2GLUA 4A3SA 1UODA 5FHRA 1K8YB 1OILA 2NZVG 2OSVA 3AUFA 1CIPA 5L40A 4EUEA 3DZGA 1IJFA 5DXFA 4U7DA 1W9MA 5LZ5A 3EWAA 3EVDA 3OX1A 1DXYA 1E7QA 3LP8A 1I1NA 2G7MC 1AKNA 3K9LA 1O95D 3ES9A 3O92A 4RF3A 3W77A 3SF8B 2HHJA 4Z7JA 1EQAA 1H0RA 3E3LA 4W63A 1T1JA 2PQ2A 3PI7A 4OL9A 3HKDA 3R0JA 5FLEX 3D0KA 3Q5GA 3V97A 4D6XA 1S8OA 3OJXA 1HI9A 3QUTA 2J6BA 5DNEA 3P9ZA 3HGQA 4X7PA 1RRFA 1TO1E 3EQZA 2FDRA 1E9FA 4UHJA 4RD2A 1F4VA 1K4MA 1SKQA 2QDKA 1IJEA 4HGQA 4HLNA 1O94C 2WKRA 4J0DA 1XEWX 5BSRA 4RKRA 3I45A 2EG9A 4TWRA 4QO8A 3HFSA 3PPYA 4IZ6A 4K6HA 4ZOCA 5KO2A 3U3DA 2JGMA 1LI5A 4CU2A 1J5EB 1NPTO 1BQEA 3GJ8A 4LXQA 2P4HX 3L7IA 5B4TA 2CFSA 1HQCA 1B8NA 2IP4A 4HCJA 4CMAA 3Q0EA 4BQNA 1MZPA 4C6SA 2HT6A 2E49A 2FF7A 3LCVB 5EPEA 1P4AA 5DHQA 4EHKA 1FMTA 3Q8WA 3AEUA 4R84A 1EX7A 1U9CA 2H7VA 3GRAA 3LS2A 5JAIA 1OWNA 3K0KA 3VSDA 4AICA 2BSAA 2AW3A 2ZYGA 4R8VA 3V8VA 1D7OA 1E1CB 1M7HA 2I65A 3A6ZA 2DMRA 3K5IA 1ZN9A 4DS3A 1LI7A 5KQMA 4HO1X 4JC5A 3E5NA 4BN5A 2CVPA 5T57A 1KJZA 2AR0A 5HZKA 1PZGA 2ST1A 4ZOAA 2Z58A 1VOTA 3QQPA 4MCHA 1TIPA 5EJ7A 3BG5A 1U9YA 4DV3B 1E18A 2P30A 3C39A 1QCCA 2E48A 2VCYA 3KB1A 4YJ3A 5CB4A 1PK9A 1SIUA 3PGKA 3O6VA 4HP8A 3K9GA 4IG9A 4OU5A 5HMMA 3U39A 2M6LA 3HSYA 4PLGA 1NDHA 2EXXA 3GUZA 1YR3A 1DLJA 1UDBA 2WNSA 5LMUB 5AT1A 5JXWA 5IHXA 1UIRA 2OQIA 2Q3JA 1CU1A 1LPBB 1ABEA 3L6UA 4AYXA 4CKEB 5LQCA 2OZEA 4NYIR 4ZT5A 3ETNA 1PFKA 1X77A 1FB5A 5AVVA 1C30B 2PMDA 4BWVA 4DLZA 2ORVA 4QOFA 4LY0A 5CGQB 2XZDA 3QX8A 5JSZA 4MUEA 2QRUA 3G0GA 1OTHA 1P45A 1XZEA 2BRUA 1N5KA 2IWRA 2EHDA 2C8LA 3SC2B 1OZHA 4GR4A 4WZBE 5BSEA 3RUHA 4RVUA 3WQHA 1KWKA 2QTNA 4QBHA 1UFVA 5H4HA 4ZZ2A 1XVIA 1JSCA 4KW7A 1NQXA 2BCJQ 4HLQB 4C0QC 5BNZA 4MX8A 2I1QA 1UAAA 1W88A 1NZDA 4YPOA 2QUZA 2QYHA 1MX3A 3B1KA 2CW5A 5FUVA 3WGOA 5JJBA 5T4HA 3E82A 2PGNA 5HWSA 3N6VA 2OGTA 5G3ZA 1ANKA 4PNZA 2PFKA 4ASUA 4D41A 1Z0FA 4P53A 4RKYA 1BHJA 2C0PA 2NUTB 4PNEA 2H0RA 2M1ZA 4QGGA 4YJ2B 1JG7A 2ZR9A 1EP2B 3DLCA 2B8JA 3KD3A 5HZMA 1PU2A 3N87A 2O3TA 1RWOA 2IE8A 4LDJA 3L9WA 4Y1FA 3HNOA 4IWNA 1D6JA 3AR2A 5C5CA 3LC1O 4IXTA 1H2AS 4AN0A 1CJSA 4QGHA 5BNTA 3U7HB 4KO8A 1M2HA 2QRLA 4DKXA 5BQOA 1LWOA 4BKQA 3DV0A 2CN1A 1I2MA 2YH2A 3IAS1 3VA7A 6Q21A 3EYAA 4HXFB 3QY9A 1WPXA 4HSEA 5AHKA 4YAWA 3AFNA 1NFQA 1DG3A 1G21A 2Z2KA 3EG9A 3GG9A 1A9TA 3MYYA 4A16A 3T5AA 2DQYA 1OX5A 1PGNA 2BI7A 4HPXB 1ZLYA 4DT1B 1MB3A 3VAAA 1KEKA 2Q3DA 3R6TA 5JISA 1I7LA 1Z5UA 2C5EA 3HUFA 4NZNA 1XCBA 2X2EA 3TLGB 1SZCA 1EAYA 4K9PA 4MVJH 2FZEA 4IOJA 3IMKA 5A9TA 1ECLA 1ICEA 5DT9A 5HW0A 1QDLB 5HPYB 4HDQB 3TQOA 4E4RA 2W2PA 4RVDA 1JG1A 3MS7A 1Y8QA 2IV7A 2GVNA 2IYSA 3NT4A 2Y1OA 1N5JA 4G56A 1MPXA 1RSZA 3FPGA 3HDTA 1A7JA 4YMUA 2SHKA 1RWMA 1OWOA 1WD7A 2P2SA 3LM8A 4J0CA 5TQ0A 3QPWA 3EXFA 4WZBB 2JH3A 4QLOA 2O7QA 3GFQA 3LHDA 5DWDA 3OI7A 1V7CA 2B3TA 2Z9DA 4WFQA 4F3KA 4UVGA 1ZVQA 3N53A 4H6PA 4XB6B 3UJCA 4B82A 4OMFG 2E0IA 3CC8A 2HN9A 2W2LA 3FIUA 4DDUA 1DG9A 1UWCA 3PFIA 3TW0A 1CC1S 5DBGA 3OUTA 1JL3A 1UEXC 2R7MA 2HW8A 3AP3A 2VJOA 3LX6A 1U8EA 5BT8A 3KTAB 4QT0A 3UK2A 4Z5XA 2ZITA 3D0QA 4M6WA 2W42A 3HBFA 1N8TA 2BM1A 1C29B 4EFKA 5E6RA 2YNMA 4HH0A 1C8KA 4FGUA 2B8TA 1P9OA 3KSRA 2GMWA 2BWJA 4HEQA 4JI1B 3TX2A 3AF1A 3D3WB 1L8OA 2WY2D 5FO1A 3UG6A 1HQYE 3U2QA 4NBLA 1R0BA 1YCDA 2GN6A 2RGAA 1Q7GA 4Y1EA 5L7WA 2PWZA 3CR8A 3F97A 3Q11A 4GMFA 5KKCA 1RLMA 4MQEA 1I14A 3FM9A 4XXHA 4H2DA 2JJ1A 1LNQA 4LYEA 3E3OA 3A1WA 1I4LD 4MYHA 1DDOA 1X7XA 4OM8A 2J32A 2JANA 1IEQA 4URHA 1YDMA 2VNSA 1ZJ5A 2V4UA 3KM0A 1XI2A 4F4CA 4U00A 3G23A 5K6AC 2CNDA 1XE3A 1YI1A 3UJNA 5LN1A 4AULA 2XSZD 2AB0A 3DKKA 4JJAA 4JQSA 2HJWA 2ZRMA 2DKOA 1GP2A 1P9LA 1UJCA 1DBPA 3NM6B 3X2SA 3KYIB 1ZLXA 1H9BA 3BGSA 5LB4A 2HK6A 4A8HA 1LUAA 3SNHA 1UKVY 1A1SA 2A3RA 4ZKEA 2W22A 4ZJYA 2O5VA 2AN3A 5A6SA 1Z9BA 2RHLA 2CUTA 3EA0A 1R50A 3WK9A 2Z56A 3R24A 3MA0A 4QGAA 1TUBB 2FRDC 1DKMA 2NT3A 3QE0A 4R2KA 5FFMA 5LZ8A 1WHTB 3O03A 1JZTA 1Z8DA 1JXOA 3BHMA 1OZ0A 3GCGA 5CK4A 4PAMA 1C1DA 1P7YA 2X0RA 2Q1XA 1T3GA 1H8HD 1TIBA 1H2WA 4JLAA 2Z04A 1QQ6A 1U90A 4Q1AA 4GPZA 5E8RA 1Z2CA 3RR2A 3Q5EA 3UJ8A 4KX5A 4D99A 5BVGA 1X1QA 1HDOA 1UFQA 4QRDA 2CJWB 3UVEA 1I2DA 1N2OA 3LO8A 2F3SA 1PO7A 3R8CA 1K66A 4DRYA 1CP2A 4WHMA 4CL8A 2ID7A 5G4KA 2PX3A 3NGLA 3EVTA 4QUKA 3TTWA 2DHDA 4RIFA 2HAEA 5EXTA 3TTVA 3BEDA 3NWJA 4QG7A 4AF6A 4AK9A 2BEVB 4Z1MA 5FBVB 3PJDA 1K92A 1GAJA 4ISBA 1U3WA 1EFCA 3PS9A 1JIJA 3HGMA 1SUAA 3QZUA 1A9XB 2WHEA 4GVXA 1PFVA 1VKHA 3AXSA 5KU1A 3NDJA 1PR9A 2WYUA 2P9JA 3H5IA 3KQSA 3RJ5A 4K9OA 1Y9JA 1DIAA 2BE7A 4KB5A 4L72A 3G0HA 2H9IA 2B0JA 3IUNA 5C8YA 1A9ZA 5LU9A 4PG7A 3K4HA 5DO9A 1QH8A 1QR2A 1UEJA 1N7IA 3DT6A 5CFOA 3W0LB 1BJKA 3AIIA 2H4HA 3HDYA 2C58A 5CT6A 1RFLA 5JPDA 3OZ7A 1QUEA 1Q7RA 5GINE 4Y7CA 2AXEA 2D5IA 2II6A 3AI3A 4KO4S 1NUAA 4MS3B 5DBEX 3HLTA 2ZP1A 2I0FA 2ZE7A 2AG6A 3V8BA 3QW2A 3DMNA 1M7BA 2ZB2A 4Q15A 1YHNA 4ZYXA 5BN3B 1VDMA 3QKSA 1AXEA 2VS1A 3CZ5A 2OCYC 4F7WA 5DTJA 5SZJA 4DY6A 5JYEA 5KYYA 4URZR 2DHCA 3RRZA 4W5RA 1QWSA 1IY2A 4YA6A 4TKUB 3THWA 3UT6A 1I4DD 5A9SA 2YRFA 1WWKA 2OE2A 3MOSA 3RUPA 1KDRA 3P9IA 3KWMA 5EMKA 1W0KD 4U63A 4R9SA 3A10A 4PBTA 2WJ4A 3SWWA 1DU4A 4DAOA 1LPAB 3MCUA 2R87A 2C04A 4DIKA 2RHMA 1UQUA 1M3SA 2POCA 3V2UA 4AZTA 1P1BA 3GL9A 3KT6A 5M5BA 3PCTA 4G63A 4GAEA 5EE9A 5JOQA 1CUEA 2A7QA 3OLXA 3OQJA 4ALLA 1GLGA 2HU2A 2OP1A 1V43A 3DQPA 2O4CA 1EJ0A 4K6MA 3HO6A 5ALYA 4EFLA 2OL4A 4D81A 3P9PA 3N8NA 1DJQA 3KKMA 5AJVB 3TTTA 1YFLA 1N0IA 1C1XA 3ZJ4A 4OX9B 1ZA1A 3FLEA 1PEAA 2E4WA 3G02A 5BV2P 3LUAA 5IJ0A 3PGJA 3HWSA 6CHYA 4ARCA 3GLVA 4FSHA 3R9IA 5CA1A 1G41A 1ZNQO 4C4TA 3TJZA 5E95A 5FOSA 5EHZA 2R4TA 3LZDA 1YGYA 4H3SA 1U2EA 2JGRA 2VH5R 3R3ZA 4IHJF 5HK8A 2AXQA 2EF1A 3EZ6A 1T4GA 3ENZA 4G4GA 4B4DA 3KB2A 2ZYAA 2EZTA 5AKZA 1ZK2A 1N3LA 1VCHA 4XDZA 1H93A 1YJQA 2VHJA 3LYUA 4XX0B 3GNTA 2X1VA 1W93A 4WINA 4WWHA 3NRBA 3U7JA 1QKJA 1SD1A 2ZRJA 5EZYA 5IAGA 3RFCA 3RHSA 3NAQA 2YYYA 2NIPA 4LZJA 1D1QA 3JQEA 121PA 4WGGA 4PYRA 3CQ9A 1G8AA 3E9EA 3SMVA 5SZIA 4NMXB 2HO5A 4C29A 4G5YA 4ODIA 3SOPA 1I0IA 2BEJA 2PT9A 3R7FA 3SFZA 1QQAA 1K8RA 4A8PA 3RC8A 1XAIA 3U3XA 1UBSB 3KLOA 4CIBA 1IQUA 3NEYA 3OESA 2YRXA 1YVUA 3EJWA 1D07A 1ULSA 3DMPA 1GIAA 3KKKA 4UBOA 2OBXA 2FOIA 3RS2A 3BVPA 3BFXA 3JSAA 3NG1A 5F1KA 1FTGA 4I8DA 4X45A 3DE5X 5IDWA 2WD8A 3ANMA 2VKQA 3DL7A 4TYPA 1FXUA 1H2BA 1HNXB 4ZCLA 3ML1A 3FTDA 2VDQB 4HDMB 1RXUA 5GTDA 1L5MA 3IAM6 4JI3B 1DNPA 3OU2A 5C31A 1FFSA 5JWOA 2JAUA 2JLAA 3RE1A 3TXXA 4ZJUA 1EBFA 1M8JA 1KKLA 1P6UA 3EBPA 9ABPA 1E9AA 1P75A 1DHTA 4HB0A 1BRTA 2J4CA 1CS0A 2HLPA 1PDOA 3KUKA 2SCUA 3RT7A 1VHQA 4ATNA 1EA5A 4I55B 1BVYF 3K70B 3S0JA 3NOXA 4N0EA 5DOZA 1SBTA 4E09A 4FFBA 3FMVA 1NE2A 4L5JA 2IF0A 5C53B 4A0RA 2C42A 4B74A 5AHWA 4DR3B 4BQFA 3FDIA 4NENA 4YP9A 4KLZA 1QIFA 3ESCA 3OZBA 5LBTA 4EWLA 1X8LA 2O3QA 3I3SR 4J1SA 2X2FA 3RYFB 2AOXA 1J1IA 3BSWA 4KIJA 4DA0A 3RTDA 1NN3A 5GGXA 4V0OA 1YZQA 2HSWA 2IELA 1E6UA 2Q0XA 2VPZA 4UAVA 4CM7A 1P7WA 1TC1A 3IAEA 4R7ZA 2XBUA 3OZAA 3U13A 4B71A 3WL3A 5IDQA 4UU7A 3IR6A 3GJ0A 2PNJA 1AKTA 3SPXA 3COZA 3VGJA 4RQAA 1F8XA 1L4HA 2MMGA 1NNI1 4MWGA 3WRVA 2XTMA 2ODWA 2Q8NA 4LZLA 3ZV3A 3CGWA 1AUOA 3NIFB 1GGFA 1O6BA 3BIWA 2OCDA 5TSDA 5ICEA 2QRJA 4QPZA 1MNAA 1GA1A 2PVCA 3INTA 1B0AA 5ITVA 4L6IA 4Q9NA 2P4EA 1XBTA 2BEKA 1QYDA 4KE9A 5EUCA 3SC4A 4ZDJA 5D3QA 4EB0A 3HHEA 2F1JA 1NUPA 4ZQGA 4IMRA 2QN3A 4DMHA 3R0QA 4U0JA 4B4WA 1YKFA 2WHRA 3A6EA 4A03A 1X92A 4YCMA 2GBCA 1AUPA 2AYZA 3MT9A 4FONA 2Q9BA 3DC7A 3DVSX 4OHBA 2ZUCA 3TH5A 2J48A 4NXMB 1Z7EA 4TSKA 5EWLB 3CNOA 4JLVA 4OUDB 1TEXA 2FSSA 3GBVA 1S7CA 5CH5A 2BM8A 3BHJA 2CLLB 2EW2A 5B57C 4OLBA 5E2BA 4MJ7A 1KDYA 5L3QA 2W5UA 1CUJA 5AUOB 3J81A 2XCRB 1T36A 1X86B 4CN8A 3L0SA 5KHLB 1FW8A 4XGKA 3EDYA 1J9GA 3I23A 4P3OA 5I7AA 4KQ2A 2QNBA 4YR7A 2JIMA 1V95A 4KNYA 1IJBA 2ABWA 3A4YA 1AN0A 3HLKA 2DFKB 1VHTA 3MUEA 2B1JA 1X2BA 4ZCQA 3I3OA 3HPQA 3H8SA 3I2IA 3EUWA 3MZ0A 1KAMA 2G9RA 5UKDA 1KJ8A 4ANFA 1KZ9A 1TZJA 2J0UB 4G5QA 3WLKX 3MQFA 2WWIA 4P7FA 5A7HA 5FA5A 2AIRA 5DNVA 4J4HA 5KX5A 3L46A 4Z49A 3KKLA 4W6ZA 1FIUA 3UMMA 1NY6A 2A86A 3ROPA 1DJOA 4LPSA 4BE7B 1I7NA 1N9ZA 4XGRA 1W29A 2H63A 3G7SA 1W48A 2P0EA 3CEAA 5CB8A 4J1NA 5CVTA 5IF9A 4PSKA 4II2A 2RHJA 1M8GA 3OZXA 1QONA 1PTJA 3HMKA 3CLKA 2PZLA 4UEWA 1CF9A 4J0KA 2WIBA 3IMFA 5EIBD 3SJZA 4C6TB 1T5HX 1TQ4A 2QN8A 1UMDB 2W2MA 1UXOA 3O7WA 1XEAA 3IQZA 2JASA 3EDCA 3FSGD 3QOFA 4WFJA 4WK4B 3HABA 1G3QA 2Z9BA 2V3VA 4X20B 2M9MA 5HZGA 4MYCA 3QEMA 5FWXB 2QR3A 1JQ3A 5CNKA 2EFJA 5DEIA 5KVCA 4P7GA 1MP0A 4IMJB 5ESXA 1BEEA 2M2IA 3N6RA 4N3GA 3LF1A 3I01M 3TX6A 4C4OA 2J3DA 5P8WA 3U48A 1I7QB 2B2CA 2FWMX 3R5SA 5JAMA 2QRVA 1KP3A 2XX3A 4PYJA 4S1NA 1BS1A 4B32A 1U4SA 1RJGA 4GEKA 4MIKA 2PSFA 1EGAA 2AC2A 4TLLB 3SEFA 5AW4A 1ISHA 3M8KA 5DB4A 2BMDA 5EG5A 3TAXA 3PR2B 3ICPA 3BXFA 3RBAA 4CTMA 5FNVF 1XN1A 3REQB 4ZK2A 5JZMA 1ZK1A 2C7QA 5WRFA 1T2AA 4L16A 4O63O 4ESEA 3WL8A 1HO3A 1H8ED 4PN3A 2AOUB 1WQ3A 3IA7A 2ZDQA 4HX5A 4KDRA 3MINA 1WUJS 1WKBA 4NNJA 2QX6A 4MR7B 4RHTA 4YP5A 4BQEA 3T3NA 4QLAA 3AILA 1N0HA 1L4MA 2H3HA 2NO9A 4IRXA 4TMWA 2BT4A 1O0BA 4JOCA 1J5PA 1N5DA 1KS9A 3VNAA 3GGJA 3UATA 2VP0A 2JS7A 3PC7A 4OQNA 1Z38A 1Y6ZA 3GLSA 3M83A 1SELA 4LPKA 1D03A 1ZCJA 4BNUA 3KKNA 4U2DA 3KXKA 2F90A 4IFTA 1XP8A 1PE0A 2B94A 3UZUA 3ZHQA 4K9LA 4GDFA 3P2YA 4KPFC 3UTCA 2JKZA 1YZKA 3O4GA 4JBYA 5A5DA 1AVTA 2ZT7A 5LIPA 3T5CA 1JQJC 3ZW7A 1GZSA 4C2AA 4CR6A 1SVNA 2JBHA 2DB3A 3FUVA 3OIWA 1XJQA 1RYEA 5E6UB 5AW0A 2J3LA 2PT7A 3FDJA 1IAVA 3UTDA 1GQQA 1XTJA 1IB6A 1SCJA 3PNKA 4IKOA 3W4KA 5FI1B 5K8JB 1ZJ6A 1Y63A 3EHEA 3GGOA 3GLFE 3CLUC 3WIEA 2C4KA 3C6QA 1Q3KA 4CMCA 3TMKA 3D5QA 2XODA 3PQ8A 3SR4A 2QAGC 2HWXA 1TVCA 2OBLA 2YN0A 2ZUBA 3IDOA 4KMMA 1N3IA 3GVHA 4OAQA 4X97A 3AETA 2PRZA 2E82A 2QD2A 1ZH6A 3JQGB 3L5OA 1YRLA 3RT1A 1K63A 1YK1A 4HEA6 4B81A 1ML3A 1O08A 4R01A 2KQUA 2CHFA 3L79A 4NE9A 5BMVF 3ZJUA 3K9CA 2DERA 1MV8A 5IM4A 5ADHA 1DX9A 5J2TF 2IW3A 4Z0TA 1V6CA 5LIRA 1QB8A 5BUCA 4H1VA 2DUMA 2VPWA 4IXDA 2FMTA 1QIGA 3Q40A 1AGRA 2POQX 3WGKA 2WWFA 5FDFA 1KR5A 4HKTA 3AF6A 2AZDA 3RKRA 3RAEC 4DA9A 5FF9A 4BCCA 3DC2A 3I28A 1R6VA 2R8ZA 3KHKA 1XD2A 3O5AA 4JT4A 2BZGA 2PPVA 4AIIA 3HV2A 4KR2A 3VVLA 4PQEA 2BYTA 1DXOA 1QHIA 4MDFA 4MS4A 2D2EA 3IVMA 4NE7A 3GFPA 1T0PA 4JDPA 2DFTA 3UXYA 5C32A 5KMGB 3E7PA 1KAGA 3DW3X 4PQRA 1CFJA 3G6KA 2QW8A 1KMHB 4ZVSA 1MT3A 3SHFA 1UJNA 3I53A 5M34A 4X24A 3N59A 3C5VA 1WOMA 1Z4NA 1RYYA 3TCNA 5KJFA 1GUYA 3GJ3A 3RV3A 3CJRA 1QH9A 1V3QE 2CNNA 1LDMA 1E1RD 2GRUA 3T7RA 3GJ4A 3G0IA 5B1IA 2ATIA 4CUZA 2YWXA 2IIVA 4L75A 4KPUA 4P3YA 2JZOA 1BNCA 2KW5A 2EJUA 2D5AA 1OFGA 1VPEA 4QHYA 2ZS8A 2NU8A 2CJPA 3BSFA 4O2AA 1QLWA 5CPFA 3TOSA 1ZRNA 3VZQA 4C5AA 1IOLA 3UMBA 1X1CA 5B64A 4TTAA 5JBIA 1FYDA 1PJAA 2Q4TA 2N75A 3BK2A 4H16A 1CK4A 1T1RA 2CLMB 1E6CA 2BF4A 3CB4A 1FFBA 4NJMA 1P62B 1YZUA 3H9JA 2AHRA 3JRXA 3SU8A 4D9IA 4HQFA 2QRZA 3D4PA 4XD7A 2OO7A 3W6OA 1WTCA 2ZWPA 3BGIA 3OZRA 4LCJA 3ZCPA 2FCRA 3P52A 2PSDA 1ISPA 4J8PA 4LOIA 4NJEA 2I67A 2Y0DA 3RC9A 2VA8A 2A14A 4BRWA 4GKKB 1ZH0A 1H1LA 2R8BA 2VA9A 2J46A 5DXJA 3TE6A 3P4YA 2WF6A 5DI3A 4ZYYA 4RK7A 3DS8A 5C9ZA 3ITNA 1ZIDA 1RHQA 2QLFA 4RMGA 5LNK6 2V0CA 3JTMA 5BRAA 4JV5B 3DV2A 1TM2A 4MEAA 3LC2O 5KUTA 1EHIA 2P8JA 1NBIA 5K3SA 1UBNA 5EJIA 4IUDS 3N7UA 3VR6A 4C4ZA 4C7XA 3T3OA 4KITB 4IDPA 2H17A 1JJBA 2F48A 3LYAA 1Y8AA 4AJEA 1EAMA 1Q44A 5AVUA 3IHLA 1IXRC 4OCZA 2B0CA 4QUDA 2DPXA 1N36B 1TJ3A 1XP5A 1GNLA 2ZI6A 3WLLA 4US2R 4JYMA 4WOPA 1Q5PA 1TUEA 5EKTA 2HFJA 1IUKA 5CM9C 3E1SA 3TLXA 4DA7A 3BMQB 4EAAA 4MWCA 4N47A 3QRWA 1TTPB 3SK0A 5CFQA 2CHGA 4H7FA 3ZCVA 4DC1A 4C04A 3KSBC 1SQ6A 3W34A 2ES4A 3CRRA 5ALEA 2W4MA 1LK0A 5EKSA 3TG8A 2BHRA 2VNIA 2ENUA 3NHAA 3HCFA 4WIAA 4R6XA 1CUIA 3RODA 2Q9CA 3KZCA 4BVGA 4ZA2A 1QBGA 1PJ4A 5EYPA 5HM8A 2CE7A 1PJ3A 4JUBA 3KBBA 2QUHA 5JEDA 3WFZA 2J59A 3CUSA 1RAHA 4WKNA 4Q1VA 5G1OA 4V0LA 1PK7A 3OZUA 3FZEA 3RIGA 1Z6ZA 2BIFA 1NOKA 2VUIB 3L5KA 1MVOA 3RVNA 4CDMA 2VIIA 4PZ0A 3BRQA 4PIMA 1H2RS 4HS4A 4L4ZA 1QO7A 1PW7A 2JFWA 2BEUA 2B98A 5TLSA 2JAHA 4BMOB 5AK0A 1MQ9A 2RBEA 1TU3A 4ZOLA 2V98A 3LPLA 2VRCA 3K94A 4Y9DA 4E5YA 1W8DA 1JEYA 1ZXBA 4I5IA 4L4SA 3K2QA 1LJUA 4B7ZA 1AKMA 1AO0A 2SKCA 2BVNA 2W8ZA 3DEJA 2E5WA 1QPZA 1YRYE 3MWLA 2OFXA 3DP7A 5B4UA 5LP1A 1S6YA 3H9UA 3LCJA 4UQPA 1BMFD 2LR0A 2DTEA 5BURA 1CR6A 3G9ZA 3QJ5A 4O5OA 2QENA 1JU4A 3ZLJA 4KWIA 4HFRA 4DTCA 1ZOPA 2CL6X 5JU6A 4WN3A 2IDZA 5K05A 3H8VA 1RBMA 4B7UA 4F97A 2NP7A 1JHAA 1G3RA 3DDWA 1UWVA 2EGUA 2J3IA 3IALA 3TLYA 3VR3D 2JJQA 1NBME 3WLNA 4AJ9A 4UJ5A 4EFDA 4FOLA 3K9QO 1VM6A 4OK5A 4F21A 3IOBA 1TKAA 3AT1A 4NFYA 3VH4A 1VBKA 4E11A 1OGYA 1WO8A 5FP0A 4GL4A 1YFJA 4XGIA 4DLRA 4ENWA 3ADDA 4DN6A 1JJIA 2ASEA 1CETA 2FXVA 4RD4A 2I4IA 1TECE 2IU4A 3BF8A 3EARA 4G0PA 2QI9F 2IS1A 1I5RA 1BDBA 1XJ0A 4YJFA 2H1FA 5EOVA 1NGSA 5LQKA 2WJAA 5FEUA 2WRZA 1DG1G 3NBMA 5LQMA 4I1UA 1F48A 4RVFA 4QYMA 2VXCA 1SR8A 4KLCA 1P60A 5FOVA 5H3CA 4CT4B 1Z0SA 2YJZA 2ZIZA 4EL5A 4AZWA 3IQWA 4BEWA 1R9MA 2NUBA 1EKXA 2HA4A 4Y7DA 3R0IA 4D0SA 3FCYA 4Q16A 4I2VA 2W43A 2E21A 3FN4A 2ZJFA 5CIYA 1EE1A 3PRHA 4RABA 2WFLB 1QKKA 4MRRA 3CEJA 2IUUA 3VZDA 1U8XX 1KOFA 3ER8A 2X6TA 3T9DA 4W9NC 2CC2A 4TLCA 5A7GA 1B3RA 1COWA 2JDIA 4N7RA 4OHCA 1T25A 1E2EA 1UPUA 2A94A 4I4CA 4MVJM 3OIDA 3KR9A 4YJFB 4UVEA 5DBHX 2SNIE 4MUJA 3RYIB 3Q87B