1VEUA

Crystal structure of the p14/mp1 complex at 2.15 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title Crystal structure of the p14/MP1 scaffolding complex: How a twin couple attaches mitogen- activated protein kinase signaling to late endosomes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1veuA00
4FTXA 1K0KA 1VEUB 2V8FA 2ACGA 3MSHA 1A0KA 2JKFA 3NULA 3DAVA 5EV0A 3D9YA 5FDSA 1PRQA 3CPTB 4ESPA 1Y4OA 1J3WA 1CQAA 1VEUA 3KYEA 1PFLA 1SKOB 3T1RA 4QWOA 4X25A 1VETB 5FEFA 1HLUP 2ZL1B 5FEGA 3T1SA 2PBDP 2B95A 1G5UA 1SZVA 2HZ5A 3CPTA 2PAVP 2JKGA 1FIKA 3CHWP 1ACFA 5EM0A 4D60A 1SKOA 3L7HA 1CJFA 3L9KA 5EVEA 4X1LA 1D1JA 1PNEA 3NECA 1YPRA 3T1QB 2PRFA 1FILA 1VETA 3LEQA 2ZL1A 3T1XA 2E8JA 1F2KA 3U4LP 2VK3A 1CF0A 1AWIA 3MS6A 3LGOA 1Z09A 4FUWA 3T12B 4X1MA 5EM1A 3UB5P 2BTFP 2V8CA
chains in the Genus database with same CATH superfamily
3QP2A 1XA1A 4R4RA 2HJ9C 5EVIB 3OLOA 2XGNA 1L0GA 3H9WA 4S2IA 3T4QA 1I5QA 3V3SA 5IU1A 4DJ3A 5FAPA 1HD8A 1ZC2A 2A49A 3WRZA 2I9VA 1NJ4A 4BLMA 5FSRA 1NZOA 1H0MA 1W7FA 3DBAA 4MBKA 5L10A 3VP4A 3BFCA 2O9BA 1P9RA 2V1ZA 5F1GA 3S7QA 1P0ZA 4OP8A 4WLAA 3RTYA 5HAPA 4UEYA 3E98A 4QD4A 4XT2B 4KG2A 3F1OB 3D72A 3FC7A 1LL9A 1LSWA 3H7WB 4ARZB 1XJ2A 4EU0A 2CC1A 1SZVA 3VP3A 5CHJA 3W4PA 1ES4A 4ETXA 4ZRRA 1SKOA 2Y8HA 5A8BA 4DE3A 4K0XA 4G3WA 3G34A 3WS1A 4CLCA 4X56A 1VETA 3UB9A 3LEQA 2NUTC 4S2MA 2RCXA 3FZCA 5HDSA 1MWSA 2A3UA 3MKFA 3AGEA 1I2SA 1OMEA 3G30A 1EWZA 5TJJA 2Y2OA 2Y2HA 4B9OA 4E3JA 2J3WA 1W63M 3IF6C 3RXXA 1SHVA 1LSXA 5HZHA 1S6RA 4Y2FA 3IT9A 3LIDA 2W3EA 3WS0A 2XFTA 5EVID 3N8LA 3BQAA 3BFEA 5TBMA 3LEZA 3QP8A 3JVUA 4ID4A 5F5YA 1DJAA 3E4QA 2E8IA 4MN6A 2W3FA 4GJ4A 2CMNA 3R7WB 2FH5A 1ESUA 1GSVA 1OJGA 2OLVA 5AQ9A 4EBPA 4ESPA 5M18A 5M19A 1K6SA 4BBUA 4YWZA 4NXFA 1VEUA 2L0WA 2XA7S 2KLIA 1T1CA 2PYRA 2MJ6A 1GA9A 4H6JA 3IWOA 5F1FA 2XEPA 1C3BA 4N1HA 3HJIA 3Q7ZA 1BLPA 4UA6A 5FL3A 2O0YA 1K4EA 1DP6A 3A3DA 4JKTA 4X55A 3HUMA 4RVAA 4KZ4A 3B3XA 4X1LA 5CRFA 3BFGA 4GZBA 4PM8A 4JGRA 1FILA 1F98A 1ODVA 2HDQA 3OPHA 1MWRA 2VZWA 1WYBA 1NY0A 3V5MA 1KDWA 2XD5A 1UWPX 4HP4A 3RH8B 4WMCD 2M7UA 4L9FA 2PD7A 5EE8A 3G4PA 3IH8A 5FATA 3S7PA 4MCWA 2DRWA 5CTMA 1DP8A 1NYYA 3EEAA 3TOIA 4MMNA 5FI2A 2YKHA 1IEMA 3O87A 2HP9A 3BW6A 3BQ8A 1S4RA 1G6OA 2Y91A 5CGSA 3VOLA 1TEMA 3G6OA 3PBNA 3I7JA 2V1AA 3LFVA 2W1RA 3S1YA 3G2YA 1IYQA 2J8YA 1SKOB 1PWCA 3T1RA 3MJQA 3NOPC 5KIZA 1CEGA 4NKPA 2Z6DA 4DE0A 4CLCB 1VETB 3SH9A 4KUOA 5FEFA 2WAFA 1L0DA 5FEGA 2H5SA 2M1CA 2W27A 1STZA 4IEDA 2Z2MB 5HSQA 5IS1A 2Y59A 4HBUA 3WS5A 1UWNX 3O86A 3LYXA 2WGWB 1K54A 4OQHA 5DTKA 3BFDA 3NY4A 4QU3A 2C6WB 3MXSA 3B33A 4KZAA 3HLCA 3OBFA 3UY6A 3E0YA 1XFQA 4RQ9A 1YSQA 2VEAA 2JKRI 5TBMB 4R1GA 1JTGA 5A93A 2R78A 1TS6A 1NXYA 2QZ6A 3UDFA 4L9EA 4BMWA 1YLJA 2BTFP 5KSHA 3QP6A 5FI7A 3IXGA 4LPZA 3UE6A 4ZJ1A 3PAGA 4GLQA 1VEUB 5HWWA 1NRJA 3IF6A 4H6JB 3N6IA 3MSHA 3DTMA 2A24A 4OLGA 4WF0A 5EV0A 2WKPA 1E25A 2C5WB 3FWLA 4GD6A 1N9OA 3UE0A 2WYXA 1BLCA 1D06A 1XX2A 1M6KA 1J9MA 1HVBA 3VFFA 5GLAA 3MFDA 2BASA 4K08A 5G4ZA 4EQ1A 1ERQA 1KGFA 2KOIA 2VKSA 4BWIA 3G2ZA 1YT4A 4CLCD 3HBRA 3G32A 4DKIA 2Q0OA 1XGIA 4HY8A 4JLFA 5GLCA 3OCLA 3CPTA 3E2KA 1PI4A 5DTTA 4ME4A 4MLLA 3UB7A 2WGIA 1MZUA 3HREA 3F1PA 3VOZA 4HH3A 4S2OA 4E3OA 3MZDA 4O8GA 3KSGA 4KZ6A 1XXMA 4GD8A 4JXSA 2PDRA 3U2AA 3WS4A 1FR6A 4F3LA 3CJMA 3GV9A 1WYCA 3ISGA 4FUWA 4KENB 2WKHA 3TG9A 3PXPA 3B47A 3KYZA 3CMZA 3NJAA 1S1YA 4YNRA 1K0KA 1S1ZA 1K38A 3BY9A 3TSGA 3ZNYA 4MBHA 1T18A 4GCZA 3GECA 5E2GA 3UPNA 3FYZA 1W8QA 3ZQ5A 4JGQA 4Z9QA 3VSKA 5FDSA 3WWXA 1Y4OA 4BQMA 4HJ6A 2XF3A 3QNCA 5GHYA 2ZOHA 3UPOA 4OPRA 4H8RA 2KDKA 2ZQ9A 1O07A 2PU2A 2VX8A 2PBDP 4BJPA 2PR6A 2WUQA 5AVFA 1ACFA 2IWBA 5DF8A 1GHIA 4OQGA 5BOHA 3L7HA 4HHDA 1IFQA 2ZQAA 3DWZA 4E04A 4HQAA 1YPRA 1YM1A 3BM6A 4JF5A 5IT5A 3C30A 4EBLA 1ES2A 1F2KA 3NBLA 5CHUA 1ZKJA 3MS6A 3ZCZA 1JNUA 3BRMA 1JWVA 1SDNA 4UA7A 1VM1A 4QHCA 3QNBA 1MY8A 3UDXA 5FQIA 2A24B 4YINA 4O01A 1W63Q 2P74A 1L3LA 3ZG5A 5CTNA 2JKTM 3WRTA 1CEFA 2ACGA 2HPBA 5MC7A 3BWLA 4U0TA 5A92A 4N9LA 4JF4A 3A0VA 5CHMA 4ZAMA 5KZHA 3M2JA 4O7DA 5CXWA 1N9NA 1NYMA 3PTEA 4GS9A 2W1TA 5LBRA 3TE8A 2WGVA 3ITBA 3CPTB 3LR3A 2V20A 3ZG8B 4OPZA 3NC8A 5J8XA 1PFLA 1G6AA 4MEZA 5HPIA 1V9YA 3QP4A 1FCOA 3F1PB 2Y2PA 4NETA 2PHYA 2EFUA 3G31A 3O5YA 3H82A 3K2NA 4HJ3A 2A2LA 2XR0A 5HPFA 4M3KA 1IELA 1XP4A 2EXAA 2GNXA 1BTLA 3JYIA 2R9WA 3ZG0A 3OOVA 4R0QA 4Y5FA 2P9VA 3EEHA 3FPWA 4R23A 1RP5A 2VV8A 3S4XA 3N8SA 1AWIA 1EROA 4K91A 3AGFA 2X02A 3IXHA 4CLCE 1OTIA 2X71A 4EETB 1SKFA 4OOMA 1BLHA 1YQSA 1ESIA 4WELA 3A3IA 3ZG7B 2JN7A 1BT5A 4LV3A 1OTAA 4UAAA 2PR5A 3F1NB 5FQKA 1S66L 3PAEA 4O0PA 2J7VA 4L9GA 4G3KA 1BLSA 1FCMA 1MBLA 3ULFA 4P85A 5EVLA 4DRTA 4B93A 3G35A 2K2NA 3LI9A 4X69A 3SS4A 2IA2A 1IOUA 1LL8A 3MQQA 3Q7VB 3A0SA 2ZJ9A 1CK3A 2H28A 4S2LA 3C7UA 3KSHA 1LI0A 2OOLA 3OPRA 2HP5A 2WZZA 2OWHA 1JWPA 1K56A 1HZOA 3CG5A 4EXOA 3BY8A 1FQGA 2UV0E 2KX6A 4E3MA 3P7NA 4IBRA 2Y2NA 2ZQCA 2Y2IA 4PM6A 4MNRA 2JKGA 4IBXA 1IYPA 3VP2A 3CITA 4OQ0A 5DTSA 2UWXA 2I72A 3P98A 3Q81A 3W4QA 4DXCA 2ZC4B 2ZM2A 1LLBA 3ZHHA 1FCNA 4C75A 2JE5A 1UGUA 4OH0A 1Q2QA 1OTBA 2DMWA 4IVKA 4HESA 1FSWA 2E8JA 3NI9A 1OJ5A 5FAQA 2VJWA 3VP0A 3O88A 3NOTC 4UQIM 3KSIA 1IYSA 2EFXA 3MZFA 3P01A 1Z09A 5EVIC 3TJZC 4ZJ2A 4OONA 1CI9A 3UPPA 3ZNTA 4P0MA 4P6BA 3UE3A 1OT6A 2V8CA 4GS9B 3AGDA 3B42A 3Q82A 4NXBA 1JVJA 2Q9NA 3LR0A 3HVFA 3M2KA 5FQJA 3S22A 4WUJA 1YAXA 4R3AA 3ZGAB 4IHQA 1GA0A 4P6ZM 3VE3A 3E2LA 4Q0JA 1H8MA 2OSUA 2FFFB 3H82B 1K55A 2ZOIA 1QMEA 1N4OA 5KMWA 4LFUA 2GX5A 1LT0A 5CX7A 4XUZA 2EA9A 5CEDA 3PBTA 4FH4A 1FOFA 2P7JA 5G4YA 3UB8A 2QHKA 5HX9A 1TF1A 4Y15A 1VHMA 4BL2A 3ZDJA 2Y2QA 4BD0A 3VE4A 3T50A 1F5MA 3GMWA 3CZDA 3CLOA 5E2FA 5E2EA 1TDGA 1RGYA 1CI8A 2OWJA 1MWUA 4FCFA 2M7VA 3UE1A 4KZ9A 1DJCA 4U3TA 3BFFA 2QMIA 3MQ0A 2ZM0A 1K25A 1M40A 1D7EA 5EM1A 1ONHA 3DTIA 5EOOA 3V3RA 4MDZA 2J3TD 4IUHA 4E6WA 2L1MA 4PM9A 5J7EA 5HWTA 1JWZA 1LI9A 3LIBA 2QWSA 1S4SA 2HP6A 4ZBEA 3KX0X 2EWWA 4QY6A 4WYYA 2ZMFA 3FG8A 5FI6A 4GW9A 3N4IA 3D9YA 1X0OA 3EWKA 1K57C 2PU4A 4OQIA 2VV6A 1PW8A 4RA7A 5GLBA 2G2UA 2ZQ7A 3KYEA 4R38A 3FPVA 2DCFA 3ZFZA 3VV4A 1I2WA 4IVIA 5GL9A 4BL3A 1GSWA 3LY4A 5HWVA 4S2NC 2FZ0A 5D3OA 1WE4A 2QJ7A 5C5KA 4XXRA 1SCWA 3IH9A 3GTCA 4GB7A 3QP5A 3DWKA 4P6ZS 1MWTA 4I3IA 4D2OA 3LIAA 2D01A 3C2WA 2FFYA 4HNBA 2ZC5B 4C6YA 2V9AA 1XJ4A 2AVXA 5CEBA 1H8ZA 4WN5A 2O99A 4QPRA 4X1MA 1TS8A 4LGWA 3IS2A 4JGPA 4E3IA 3NHQA 4N92A 5HW3A 4WM9A 1GHPA 1KE4A 5DKLA 5TR7A 3R4KA 4HP9A 2HDRA 4Y13A 3GRJA 2WKEA 4WZ5C 4GHIA 1Q2PA 1YSPA 2HF6A 5GHXA 2JKFA 1DRMA 5F68A 5FDHA 2VA0A 3A0RA 2BLSA 1K56D 1VB6A 4U0XA 3RJUA 1MPLA 5DFXA 3VMAA 3OPLA 4XUXA 1J3WA 1XGJA 4Y0UA 4X53A 2OV5A 3T4OA 4QWOA 4PMAA 4X25A 3W4OA 3N8RA 4E3LA 4OKPA 5EOEA 4LRZE 2P04A 3LY3A 1YLZA 2B95A 5EFWA 2X01A 5DF9A 5EUAA 1IYOA 1ZTUA 1WA9A 1TDLA 5DF7A 3OZHA 5JYOA 4S2PA 4EBNA 3IWQA 3UNWA 5EVEA 1D1JA 3Q07A 3ZVTA 2ZQDA 1YLTA 5FAOA 2H0TA 2PBYA 5K5BA 4K0WA 2DNSA 1XPBA 4QB8A 1RGZA 4OVDA 2WKIA 1MXOA 4WMCA 4JXGA 3SS3A 4PKYA 3LR5A 2B5RA 3IQAA 1KE0A 2ZQ8A 3MXQA 2LB5A 4PM7A 5I94A 4FH2A 2O9CA 3K3CA 1NRFA 4FTXA 4LV1A 5AQBA 3CAXA 2V1BA 5GLDA 1T1BA 4WEJA 3UMDA 5GHZA 2V2FF 3IF6B 4NK3A 2V0WA 3GSGA 5HL6A 2JC7A 4HEFA 3ICYA 2ZD8A 2XQZA 3SZTA 3UN7A 3T4SA 2P08A 3GR2A 1ONGA 4S2JA 5HL1A 4HI4A 4LCMA 2WZXA 2HV1A 4GDBA 1OT9A 1Y54A 5F82A 2ZBBA 5F83A 1HLUP 1XKZA 1KVMA 4FOFA 3IF5A 1DP9A 3CUEC 3WS2A 3VP1A 3O3VA 2QPNA 4DMZA 2ZC6B 2K31A 2HDUA 2BG1A 3L9KA 3MBZA 3IX8A 4RYEA 4DE1A 4GKUA 3IS2B 4EEUA 3HL9A 2HJEA 3EQUA 2K7SA 3C8CA 4S2NA 2GJ3A 3V67A 3U4LP 1W5DA 5TFQA 4Y0TA 1EW0A 4HH2A 4KQRA 4QJGA 5KSCA 4F3LB 3IHAA 5AJGA 1FSYA 1N9LA 2J9PA 3T12B 2O9AA 4GHIB 4EUVA 5L2FA 1L2SA 4DDSA 3MMHA 3UB5P 2Y2LA 4R70A 4YOFA 3EQVA 2Z2LB 4EW7A 4GNUA 4R4SA 1LSVA 3NDGA 2HGVA 4JPMA 1P97A 5F6AA 1S0WA 4F94A 3MZEA 5J3WA 5CERA 1ZG4A 2V8FA 1KDSA 4KZBA 1E3UA 3MXRA 5F69A 1ZHHB 4LLOB 1E4DA 1PZPA 3NULA 3OC2A 2G7UA 5E43A 3KYQA 4EUZA 5A90A 3LR4A 1K54C 4EEPA 1LL5A 4Q0HA 4WZ5A 1S67L 2ZMAA 3NCKA 2Y2JA 3SH8A 4MBFA 4P87A 2EWVA 4Z1WA 2R9XA 4AFIA 4KZ8A 5HARA 3BJNA 1OTDA 1NLYA 1OPXA 3JPUA 4CPKA 2OAP1 2QKPA 2EX6A 3V39A 2OAQ1 4NG2A 3PYPA 4CQHA 5HAIA 4UA9A 5FQQA 4G3VA 2XRNA 4KQOA 5I5LA 4B4XA 1FIKA 3LI8A 5A91A 2WGWA 3T4KA 3ZYTA 4DF6A 4OP5A 3NECA 2Y2KA 2JHEA 3T1QB 1YMXA 3LCEA 4GN2A 1ERMA 2ZL1A 3KSFA 4B88A 2VK3A 1N9BA 2Q9MA 3DTKA 5HD3A 2WKQA 3HLFA 1V9ZA 3CWFA 1LHYA 3IX3A 1PYYA 3SW1A 3M6BA 1PZOA 1NWZA 3ZG9B 1ALQA 3SH7A 3HLDA 2L4RA 5IHVA 3IHBA 1BYWA 5L8MA 3DW0A 1DY6A 1A0KA 2LB9A 4BBTA 1XA7A 5HFOA 4Y3IA 3S7NA 2IWDA 3C7VA 3UO9A 5FQMA 2W1TB 3TRCA 5HAQA 1KGEA 1YMSA 1PRQA 3PBRA 2G2WA 3UB6A 3SS5A 2YKFA 3JVVA 1U60A 4NXGA 4OOYA 4PHTA 2XH9A 3IBRA 1GHMA 4EQIA 2XK1A 3PR6A 2Y2GA 4C3QA 3IX4A 3DTEA 4BD1A 4E3NA 1PI5A 3T4LA 2ZC3B 4OPQA 4RX2A 3T1SA 1G5UA 4LRXC 3T4TA 1KOUA 1PIOA 4CJNA 3EOIA 4LV0A 2INWA 2Y55A 3BYDA 4ZDXA 2PAVP 3LUQA 4PPRA 3LIEA 1ZG6A 3D3OA 5AVEA 2WADA 2P9VB 3GDIA 4FD8A 2PRFA 4UHUA 2PD8A 3CUEA 4R3BA 3VSLA 2EXBA 4HJ4A 4YFMA 2W3GA 2D02A 3D4FA 3N7WA 2EX2A 1XFNA 1YLYA 3HLEA 3BEBA 1PW1A 3QHYA 3HJKA 3ZVWA 4EESA 1L0FA 1VQQA 4KG6A 3UMEA 2IWCA 4DN0A 4KUKA 2WAEA 4I39A 2VGKA 1L0EA 3MFXA 3IXBA 4WBGA 3FKWA 3NOUC 5FA7A 2XROA 3UDIA 1TD5A 2ZC7A 4A5RA 3HLBA 4IJGA 3CI6A 1OTEA 3C4PA 2XDMA 5FASA 1QMFA 1CQAA 4RX3A 4Y17A 2H10A 3ITAA 3EGXC 3BLMA 3FKVA 2EX8A 2QYBA 3GVBA 5CECA 2ZL1B 4E3KA 5HDDA 1YLPA 4KZ5A 2OLUA 2WKRA 3CHWP 4DXBA 5EM0A 4LRYC 5DJTA 4HOIA 3IXDA 1PNEA 4S2KA 1MKIA 1XJ3A 2PYPA 5CGXA 3TW8A 4UQIS 2RL3A 4MN7A 1CF0A 1P9WA 3HLGA 1KVLA 1IKGA 1MC0A 3LGOA 4X68A 3NDEA 2J3TC 3K3DA 4KQDA 5U47A 4DE2A 4Q8IA 3FV7A 2W0NA 1PWDA 1BUEA 1E3UD 3LO7A 2VGLM 2VGJA 1W8YA 2ZM8A 5DJUA 3RFBA 4N1XA 4X6TA 1EI5A 4Q0IA 5DFYA 3VOYA 4FSFA 5TGFA 3BLSA 3W2ZA 3PBOA 3LIFA 3SOIA 5EPHA 2GDNA 3PBSA 4KG5A 4OOLA 3PHYA 5HDCA 2JKTI 3MR0A 2Z6CA 3DAVA 3E4PA 1RCJA 3EGDC 1BULA 1NLZA 1T1AA 5AQAA 1TS7A 5EECA 4HBTA 4KQQA 4L0LA 1TVFA 5EVIA 2JCHA 4PM5A 3OPPA 4I5SA 1O7EA 4MN5A 3V50A 4Y7PA 5G18A 1XJ6A 4GDNA 1BSGA 4IUKA 4R6LA 2EX9A 3W8KA 2ZMVA 4WEKA 3OCNA 1Z6FA 3C38A 1G68A 2W3HA 4CLCC 2HDSA 4EERA 5CGWA 1H3QA 2XFSA 5FQ9A 2J80A 4D60A 5L07A 3T4JA 4I3AA 3M6HA 1CJFA 3VFHA 1YKDA 4DDYA 2Y2MA 4XT2A 1GCEA 3F1OA 3MQOA 3T1XA 3H7WA 1IKIA 3HUOA 3HUNA 4ARZA 2GZAA 4ETZA 5DVAA 3HLWA 4Y0OA 4M4XA 1K4FA 3GQZA 4II7A 1H8YA 4LV2A 5DKKA 4NXEA 1MKMA 1Y28A 4LENA 4QY5A 3LICA 5AQ7A 4E6XA 2XLNA 4OPYA 3MKEA 3P09A 1G28A 3RXWA 1SDEA 1T19A 1F9IA 2VV7A 3F1NA 3C5AA 2JKRM 2B18A 1KGGA 1HTZA 2Y79A 4PAUA 2QJ5A 1GSXA 4R3JA 1BZAA 1AXBA 3PBQA 4ZTKA 2J9OA 3S7OA 4B4ZA 1H5XA 4PKYG 1ES5A 1TS0A 4ZJ3A 3Q7VA 3IBJA 1W79A 1ES3A 4EWFA 5E2HA 1FR1A 4HIAA 3BECA 1JTDA 2VLGA 4JBFA 5JYPA 4DJ2A 4OLDA 1NZUA 3E4OA 5HD5A 3R7WA 2VGLS 2HZ5A 4N9KA 2H0YA 1K6RA 2B02A 1DJBA 4LCLA 4KZ3A 2WK0A 4NEED 2NUPC 4GOGA 1K57A 3C4OA 4WL9A 2Y4AA 1KE3A 4JF6A 2XA7M 2V0UA 4JXVA 3A3JA 2W3DA 3HCYA 5L09A 3IWIA 1K55C 2XSSA 2JBFA 4I3JA 1PWGA 3QP1A 4I38A 4EV4A 4BBVA 1YLWA 3NIAA 3KO6A 3A3EA 2ZLYA 2PT7A 3A3FA 4KZ7A 5M1AA 4JGOA 4BENA 2XD1A 3Q1FA 4JXWA 4WZ4A 5J4EA 3MF0A
chains in the Genus database with same CATH topology
4FTXA 1K0KA 1VEUB 2V8FA 2ACGA 3MSHA 1A0KA 2JKFA 3NULA 3DAVA 5EV0A 3D9YA 5FDSA 1PRQA 3CPTB 4ESPA 1Y4OA 1J3WA 1CQAA 1VEUA 3KYEA 1PFLA 1SKOB 3T1RA 4QWOA 4X25A 1VETB 5FEFA 1HLUP 2ZL1B 5FEGA 3T1SA 2PBDP 2B95A 1G5UA 1SZVA 2HZ5A 3CPTA 2PAVP 2JKGA 1FIKA 3CHWP 1ACFA 5EM0A 4D60A 1SKOA 3L7HA 1CJFA 3L9KA 5EVEA 4X1LA 1D1JA 1PNEA 3NECA 1YPRA 3T1QB 2PRFA 1FILA 1VETA 3LEQA 2ZL1A 3T1XA 2E8JA 1F2KA 3U4LP 2VK3A 1CF0A 1AWIA 3MS6A 3LGOA 1Z09A 4FUWA 3T12B 4X1MA 5EM1A 3UB5P 2BTFP 2V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTX A;  1K0K A;  1VEU B;  2V8F A;  2ACG A;  3MSH A;  1A0K A;  2JKF A;  3NUL A;  3DAV A;  5EV0 A;  3D9Y A;  5FDS A;  1PRQ A;  3CPT B;  4ESP A;  1Y4O A;  1J3W A;  1CQA A;  1VEU A;  3KYE A;  1PFL A;  1SKO B;  3T1R A;  4QWO A;  4X25 A;  1VET B;  5FEF A;  1HLU P;  2ZL1 B;  5FEG A;  3T1S A;  2PBD P;  2B95 A;  1G5U A;  1SZV A;  2HZ5 A;  3CPT A;  2PAV P;  2JKG A;  1FIK A;  3CHW P;  1ACF A;  5EM0 A;  4D60 A;  1SKO A;  3L7H A;  1CJF A;  3L9K A;  5EVE A;  4X1L A;  1D1J A;  1PNE A;  3NEC A;  1YPR A;  3T1Q B;  2PRF A;  1FIL A;  1VET A;  3LEQ A;  2ZL1 A;  3T1X A;  2E8J A;  1F2K A;  3U4L P;  2VK3 A;  1CF0 A;  1AWI A;  3MS6 A;  3LGO A;  1Z09 A;  4FUW A;  3T12 B;  4X1M A;  5EM1 A;  3UB5 P;  2BTF P;  2V8C A; 
#chains in the Genus database with same CATH topology
 3QP2 A;  1XA1 A;  4R4R A;  2HJ9 C;  5EVI B;  3OLO A;  2XGN A;  1L0G A;  3H9W A;  4S2I A;  3T4Q A;  1I5Q A;  3V3S A;  5IU1 A;  4DJ3 A;  5FAP A;  1HD8 A;  1ZC2 A;  2A49 A;  3WRZ A;  2I9V A;  1NJ4 A;  4BLM A;  5FSR A;  1NZO A;  1H0M A;  1W7F A;  3DBA A;  4MBK A;  5L10 A;  3VP4 A;  3BFC A;  2O9B A;  1P9R A;  2V1Z A;  5F1G A;  3S7Q A;  1P0Z A;  4OP8 A;  4WLA A;  3RTY A;  5HAP A;  4UEY A;  3E98 A;  4QD4 A;  4XT2 B;  4KG2 A;  3F1O B;  3D72 A;  3FC7 A;  1LL9 A;  1LSW A;  3H7W B;  4ARZ B;  1XJ2 A;  4EU0 A;  2CC1 A;  1SZV A;  3VP3 A;  5CHJ A;  3W4P A;  1ES4 A;  4ETX A;  4ZRR A;  1SKO A;  2Y8H A;  5A8B A;  4DE3 A;  4K0X A;  4G3W A;  3G34 A;  3WS1 A;  4CLC A;  4X56 A;  1VET A;  3UB9 A;  3LEQ A;  2NUT C;  4S2M A;  2RCX A;  3FZC A;  5HDS A;  1MWS A;  2A3U A;  3MKF A;  3AGE A;  1I2S A;  1OME A;  3G30 A;  1EWZ A;  5TJJ A;  2Y2O A;  2Y2H A;  4B9O A;  4E3J A;  2J3W A;  1W63 M;  3IF6 C;  3RXX A;  1SHV A;  1LSX A;  5HZH A;  1S6R A;  4Y2F A;  3IT9 A;  3LID A;  2W3E A;  3WS0 A;  2XFT A;  5EVI D;  3N8L A;  3BQA A;  3BFE A;  5TBM A;  3LEZ A;  3QP8 A;  3JVU A;  4ID4 A;  5F5Y A;  1DJA A;  3E4Q A;  2E8I A;  4MN6 A;  2W3F A;  4GJ4 A;  2CMN A;  3R7W B;  2FH5 A;  1ESU A;  1GSV A;  1OJG A;  2OLV A;  5AQ9 A;  4EBP A;  4ESP A;  5M18 A;  5M19 A;  1K6S A;  4BBU A;  4YWZ A;  4NXF A;  1VEU A;  2L0W A;  2XA7 S;  2KLI A;  1T1C A;  2PYR A;  2MJ6 A;  1GA9 A;  4H6J A;  3IWO A;  5F1F A;  2XEP A;  1C3B A;  4N1H A;  3HJI A;  3Q7Z A;  1BLP A;  4UA6 A;  5FL3 A;  2O0Y A;  1K4E A;  1DP6 A;  3A3D A;  4JKT A;  4X55 A;  3HUM A;  4RVA A;  4KZ4 A;  3B3X A;  4X1L A;  5CRF A;  3BFG A;  4GZB A;  4PM8 A;  4JGR A;  1FIL A;  1F98 A;  1ODV A;  2HDQ A;  3OPH A;  1MWR A;  2VZW A;  1WYB A;  1NY0 A;  3V5M A;  1KDW A;  2XD5 A;  1UWP X;  4HP4 A;  3RH8 B;  4WMC D;  2M7U A;  4L9F A;  2PD7 A;  5EE8 A;  3G4P A;  3IH8 A;  5FAT A;  3S7P A;  4MCW A;  2DRW A;  5CTM A;  1DP8 A;  1NYY A;  3EEA A;  3TOI A;  4MMN A;  5FI2 A;  2YKH A;  1IEM A;  3O87 A;  2HP9 A;  3BW6 A;  3BQ8 A;  1S4R A;  1G6O A;  2Y91 A;  5CGS A;  3VOL A;  1TEM A;  3G6O A;  3PBN A;  3I7J A;  2V1A A;  3LFV A;  2W1R A;  3S1Y A;  3G2Y A;  1IYQ A;  2J8Y A;  1SKO B;  1PWC A;  3T1R A;  3MJQ A;  3NOP C;  5KIZ A;  1CEG A;  4NKP A;  2Z6D A;  4DE0 A;  4CLC B;  1VET B;  3SH9 A;  4KUO A;  5FEF A;  2WAF A;  1L0D A;  5FEG A;  2H5S A;  2M1C A;  2W27 A;  1STZ A;  4IED A;  2Z2M B;  5HSQ A;  5IS1 A;  2Y59 A;  4HBU A;  3WS5 A;  1UWN X;  3O86 A;  3LYX A;  2WGW B;  1K54 A;  4OQH A;  5DTK A;  3BFD A;  3NY4 A;  4QU3 A;  2C6W B;  3MXS A;  3B33 A;  4KZA A;  3HLC A;  3OBF A;  3UY6 A;  3E0Y A;  1XFQ A;  4RQ9 A;  1YSQ A;  2VEA A;  2JKR I;  5TBM B;  4R1G A;  1JTG A;  5A93 A;  2R78 A;  1TS6 A;  1NXY A;  2QZ6 A;  3UDF A;  4L9E A;  4BMW A;  1YLJ A;  2BTF P;  5KSH A;  3QP6 A;  5FI7 A;  3IXG A;  4LPZ A;  3UE6 A;  4ZJ1 A;  3PAG A;  4GLQ A;  1VEU B;  5HWW A;  1NRJ A;  3IF6 A;  4H6J B;  3N6I A;  3MSH A;  3DTM A;  2A24 A;  4OLG A;  4WF0 A;  5EV0 A;  2WKP A;  1E25 A;  2C5W B;  3FWL A;  4GD6 A;  1N9O A;  3UE0 A;  2WYX A;  1BLC A;  1D06 A;  1XX2 A;  1M6K A;  1J9M A;  1HVB A;  3VFF A;  5GLA A;  3MFD A;  2BAS A;  4K08 A;  5G4Z A;  4EQ1 A;  1ERQ A;  1KGF A;  2KOI A;  2VKS A;  4BWI A;  3G2Z A;  1YT4 A;  4CLC D;  3HBR A;  3G32 A;  4DKI A;  2Q0O A;  1XGI A;  4HY8 A;  4JLF A;  5GLC A;  3OCL A;  3CPT A;  3E2K A;  1PI4 A;  5DTT A;  4ME4 A;  4MLL A;  3UB7 A;  2WGI A;  1MZU A;  3HRE A;  3F1P A;  3VOZ A;  4HH3 A;  4S2O A;  4E3O A;  3MZD A;  4O8G A;  3KSG A;  4KZ6 A;  1XXM A;  4GD8 A;  4JXS A;  2PDR A;  3U2A A;  3WS4 A;  1FR6 A;  4F3L A;  3CJM A;  3GV9 A;  1WYC A;  3ISG A;  4FUW A;  4KEN B;  2WKH A;  3TG9 A;  3PXP A;  3B47 A;  3KYZ A;  3CMZ A;  3NJA A;  1S1Y A;  4YNR A;  1K0K A;  1S1Z A;  1K38 A;  3BY9 A;  3TSG A;  3ZNY A;  4MBH A;  1T18 A;  4GCZ A;  3GEC A;  5E2G A;  3UPN A;  3FYZ A;  1W8Q A;  3ZQ5 A;  4JGQ A;  4Z9Q A;  3VSK A;  5FDS A;  3WWX A;  1Y4O A;  4BQM A;  4HJ6 A;  2XF3 A;  3QNC A;  5GHY A;  2ZOH A;  3UPO A;  4OPR A;  4H8R A;  2KDK A;  2ZQ9 A;  1O07 A;  2PU2 A;  2VX8 A;  2PBD P;  4BJP A;  2PR6 A;  2WUQ A;  5AVF A;  1ACF A;  2IWB A;  5DF8 A;  1GHI A;  4OQG A;  5BOH A;  3L7H A;  4HHD A;  1IFQ A;  2ZQA A;  3DWZ A;  4E04 A;  4HQA A;  1YPR A;  1YM1 A;  3BM6 A;  4JF5 A;  5IT5 A;  3C30 A;  4EBL A;  1ES2 A;  1F2K A;  3NBL A;  5CHU A;  1ZKJ A;  3MS6 A;  3ZCZ A;  1JNU A;  3BRM A;  1JWV A;  1SDN A;  4UA7 A;  1VM1 A;  4QHC A;  3QNB A;  1MY8 A;  3UDX A;  5FQI A;  2A24 B;  4YIN A;  4O01 A;  1W63 Q;  2P74 A;  1L3L A;  3ZG5 A;  5CTN A;  2JKT M;  3WRT A;  1CEF A;  2ACG A;  2HPB A;  5MC7 A;  3BWL A;  4U0T A;  5A92 A;  4N9L A;  4JF4 A;  3A0V A;  5CHM A;  4ZAM A;  5KZH A;  3M2J A;  4O7D A;  5CXW A;  1N9N A;  1NYM A;  3PTE A;  4GS9 A;  2W1T A;  5LBR A;  3TE8 A;  2WGV A;  3ITB A;  3CPT B;  3LR3 A;  2V20 A;  3ZG8 B;  4OPZ A;  3NC8 A;  5J8X A;  1PFL A;  1G6A A;  4MEZ A;  5HPI A;  1V9Y A;  3QP4 A;  1FCO A;  3F1P B;  2Y2P A;  4NET A;  2PHY A;  2EFU A;  3G31 A;  3O5Y A;  3H82 A;  3K2N A;  4HJ3 A;  2A2L A;  2XR0 A;  5HPF A;  4M3K A;  1IEL A;  1XP4 A;  2EXA A;  2GNX A;  1BTL A;  3JYI A;  2R9W A;  3ZG0 A;  3OOV A;  4R0Q A;  4Y5F A;  2P9V A;  3EEH A;  3FPW A;  4R23 A;  1RP5 A;  2VV8 A;  3S4X A;  3N8S A;  1AWI A;  1ERO A;  4K91 A;  3AGF A;  2X02 A;  3IXH A;  4CLC E;  1OTI A;  2X71 A;  4EET B;  1SKF A;  4OOM A;  1BLH A;  1YQS A;  1ESI A;  4WEL A;  3A3I A;  3ZG7 B;  2JN7 A;  1BT5 A;  4LV3 A;  1OTA A;  4UAA A;  2PR5 A;  3F1N B;  5FQK A;  1S66 L;  3PAE A;  4O0P A;  2J7V A;  4L9G A;  4G3K A;  1BLS A;  1FCM A;  1MBL A;  3ULF A;  4P85 A;  5EVL A;  4DRT A;  4B93 A;  3G35 A;  2K2N A;  3LI9 A;  4X69 A;  3SS4 A;  2IA2 A;  1IOU A;  1LL8 A;  3MQQ A;  3Q7V B;  3A0S A;  2ZJ9 A;  1CK3 A;  2H28 A;  4S2L A;  3C7U A;  3KSH A;  1LI0 A;  2OOL A;  3OPR A;  2HP5 A;  2WZZ A;  2OWH A;  1JWP A;  1K56 A;  1HZO A;  3CG5 A;  4EXO A;  3BY8 A;  1FQG A;  2UV0 E;  2KX6 A;  4E3M A;  3P7N A;  4IBR A;  2Y2N A;  2ZQC A;  2Y2I A;  4PM6 A;  4MNR A;  2JKG A;  4IBX A;  1IYP A;  3VP2 A;  3CIT A;  4OQ0 A;  5DTS A;  2UWX A;  2I72 A;  3P98 A;  3Q81 A;  3W4Q A;  4DXC A;  2ZC4 B;  2ZM2 A;  1LLB A;  3ZHH A;  1FCN A;  4C75 A;  2JE5 A;  1UGU A;  4OH0 A;  1Q2Q A;  1OTB A;  2DMW A;  4IVK A;  4HES A;  1FSW A;  2E8J A;  3NI9 A;  1OJ5 A;  5FAQ A;  2VJW A;  3VP0 A;  3O88 A;  3NOT C;  4UQI M;  3KSI A;  1IYS A;  2EFX A;  3MZF A;  3P01 A;  1Z09 A;  5EVI C;  3TJZ C;  4ZJ2 A;  4OON A;  1CI9 A;  3UPP A;  3ZNT A;  4P0M A;  4P6B A;  3UE3 A;  1OT6 A;  2V8C A;  4GS9 B;  3AGD A;  3B42 A;  3Q82 A;  4NXB A;  1JVJ A;  2Q9N A;  3LR0 A;  3HVF A;  3M2K A;  5FQJ A;  3S22 A;  4WUJ A;  1YAX A;  4R3A A;  3ZGA B;  4IHQ A;  1GA0 A;  4P6Z M;  3VE3 A;  3E2L A;  4Q0J A;  1H8M A;  2OSU A;  2FFF B;  3H82 B;  1K55 A;  2ZOI A;  1QME A;  1N4O A;  5KMW A;  4LFU A;  2GX5 A;  1LT0 A;  5CX7 A;  4XUZ A;  2EA9 A;  5CED A;  3PBT A;  4FH4 A;  1FOF A;  2P7J A;  5G4Y A;  3UB8 A;  2QHK A;  5HX9 A;  1TF1 A;  4Y15 A;  1VHM A;  4BL2 A;  3ZDJ A;  2Y2Q A;  4BD0 A;  3VE4 A;  3T50 A;  1F5M A;  3GMW A;  3CZD A;  3CLO A;  5E2F A;  5E2E A;  1TDG A;  1RGY A;  1CI8 A;  2OWJ A;  1MWU A;  4FCF A;  2M7V A;  3UE1 A;  4KZ9 A;  1DJC A;  4U3T A;  3BFF A;  2QMI A;  3MQ0 A;  2ZM0 A;  1K25 A;  1M40 A;  1D7E A;  5EM1 A;  1ONH A;  3DTI A;  5EOO A;  3V3R A;  4MDZ A;  2J3T D;  4IUH A;  4E6W A;  2L1M A;  4PM9 A;  5J7E A;  5HWT A;  1JWZ A;  1LI9 A;  3LIB A;  2QWS A;  1S4S A;  2HP6 A;  4ZBE A;  3KX0 X;  2EWW A;  4QY6 A;  4WYY A;  2ZMF A;  3FG8 A;  5FI6 A;  4GW9 A;  3N4I A;  3D9Y A;  1X0O A;  3EWK A;  1K57 C;  2PU4 A;  4OQI A;  2VV6 A;  1PW8 A;  4RA7 A;  5GLB A;  2G2U A;  2ZQ7 A;  3KYE A;  4R38 A;  3FPV A;  2DCF A;  3ZFZ A;  3VV4 A;  1I2W A;  4IVI A;  5GL9 A;  4BL3 A;  1GSW A;  3LY4 A;  5HWV A;  4S2N C;  2FZ0 A;  5D3O A;  1WE4 A;  2QJ7 A;  5C5K A;  4XXR A;  1SCW A;  3IH9 A;  3GTC A;  4GB7 A;  3QP5 A;  3DWK A;  4P6Z S;  1MWT A;  4I3I A;  4D2O A;  3LIA A;  2D01 A;  3C2W A;  2FFY A;  4HNB A;  2ZC5 B;  4C6Y A;  2V9A A;  1XJ4 A;  2AVX A;  5CEB A;  1H8Z A;  4WN5 A;  2O99 A;  4QPR A;  4X1M A;  1TS8 A;  4LGW A;  3IS2 A;  4JGP A;  4E3I A;  3NHQ A;  4N92 A;  5HW3 A;  4WM9 A;  1GHP A;  1KE4 A;  5DKL A;  5TR7 A;  3R4K A;  4HP9 A;  2HDR A;  4Y13 A;  3GRJ A;  2WKE A;  4WZ5 C;  4GHI A;  1Q2P A;  1YSP A;  2HF6 A;  5GHX A;  2JKF A;  1DRM A;  5F68 A;  5FDH A;  2VA0 A;  3A0R A;  2BLS A;  1K56 D;  1VB6 A;  4U0X A;  3RJU A;  1MPL A;  5DFX A;  3VMA A;  3OPL A;  4XUX A;  1J3W A;  1XGJ A;  4Y0U A;  4X53 A;  2OV5 A;  3T4O A;  4QWO A;  4PMA A;  4X25 A;  3W4O A;  3N8R A;  4E3L A;  4OKP A;  5EOE A;  4LRZ E;  2P04 A;  3LY3 A;  1YLZ A;  2B95 A;  5EFW A;  2X01 A;  5DF9 A;  5EUA A;  1IYO A;  1ZTU A;  1WA9 A;  1TDL A;  5DF7 A;  3OZH A;  5JYO A;  4S2P A;  4EBN A;  3IWQ A;  3UNW A;  5EVE A;  1D1J A;  3Q07 A;  3ZVT A;  2ZQD A;  1YLT A;  5FAO A;  2H0T A;  2PBY A;  5K5B A;  4K0W A;  2DNS A;  1XPB A;  4QB8 A;  1RGZ A;  4OVD A;  2WKI A;  1MXO A;  4WMC A;  4JXG A;  3SS3 A;  4PKY A;  3LR5 A;  2B5R A;  3IQA A;  1KE0 A;  2ZQ8 A;  3MXQ A;  2LB5 A;  4PM7 A;  5I94 A;  4FH2 A;  2O9C A;  3K3C A;  1NRF A;  4FTX A;  4LV1 A;  5AQB A;  3CAX A;  2V1B A;  5GLD A;  1T1B A;  4WEJ A;  3UMD A;  5GHZ A;  2V2F F;  3IF6 B;  4NK3 A;  2V0W A;  3GSG A;  5HL6 A;  2JC7 A;  4HEF A;  3ICY A;  2ZD8 A;  2XQZ A;  3SZT A;  3UN7 A;  3T4S A;  2P08 A;  3GR2 A;  1ONG A;  4S2J A;  5HL1 A;  4HI4 A;  4LCM A;  2WZX A;  2HV1 A;  4GDB A;  1OT9 A;  1Y54 A;  5F82 A;  2ZBB A;  5F83 A;  1HLU P;  1XKZ A;  1KVM A;  4FOF A;  3IF5 A;  1DP9 A;  3CUE C;  3WS2 A;  3VP1 A;  3O3V A;  2QPN A;  4DMZ A;  2ZC6 B;  2K31 A;  2HDU A;  2BG1 A;  3L9K A;  3MBZ A;  3IX8 A;  4RYE A;  4DE1 A;  4GKU A;  3IS2 B;  4EEU A;  3HL9 A;  2HJE A;  3EQU A;  2K7S A;  3C8C A;  4S2N A;  2GJ3 A;  3V67 A;  3U4L P;  1W5D A;  5TFQ A;  4Y0T A;  1EW0 A;  4HH2 A;  4KQR A;  4QJG A;  5KSC A;  4F3L B;  3IHA A;  5AJG A;  1FSY A;  1N9L A;  2J9P A;  3T12 B;  2O9A A;  4GHI B;  4EUV A;  5L2F A;  1L2S A;  4DDS A;  3MMH A;  3UB5 P;  2Y2L A;  4R70 A;  4YOF A;  3EQV A;  2Z2L B;  4EW7 A;  4GNU A;  4R4S A;  1LSV A;  3NDG A;  2HGV A;  4JPM A;  1P97 A;  5F6A A;  1S0W A;  4F94 A;  3MZE A;  5J3W A;  5CER A;  1ZG4 A;  2V8F A;  1KDS A;  4KZB A;  1E3U A;  3MXR A;  5F69 A;  1ZHH B;  4LLO B;  1E4D A;  1PZP A;  3NUL A;  3OC2 A;  2G7U A;  5E43 A;  3KYQ A;  4EUZ A;  5A90 A;  3LR4 A;  1K54 C;  4EEP A;  1LL5 A;  4Q0H A;  4WZ5 A;  1S67 L;  2ZMA A;  3NCK A;  2Y2J A;  3SH8 A;  4MBF A;  4P87 A;  2EWV A;  4Z1W A;  2R9X A;  4AFI A;  4KZ8 A;  5HAR A;  3BJN A;  1OTD A;  1NLY A;  1OPX A;  3JPU A;  4CPK A;  2OAP 1;  2QKP A;  2EX6 A;  3V39 A;  2OAQ 1;  4NG2 A;  3PYP A;  4CQH A;  5HAI A;  4UA9 A;  5FQQ A;  4G3V A;  2XRN A;  4KQO A;  5I5L A;  4B4X A;  1FIK A;  3LI8 A;  5A91 A;  2WGW A;  3T4K A;  3ZYT A;  4DF6 A;  4OP5 A;  3NEC A;  2Y2K A;  2JHE A;  3T1Q B;  1YMX A;  3LCE A;  4GN2 A;  1ERM A;  2ZL1 A;  3KSF A;  4B88 A;  2VK3 A;  1N9B A;  2Q9M A;  3DTK A;  5HD3 A;  2WKQ A;  3HLF A;  1V9Z A;  3CWF A;  1LHY A;  3IX3 A;  1PYY A;  3SW1 A;  3M6B A;  1PZO A;  1NWZ A;  3ZG9 B;  1ALQ A;  3SH7 A;  3HLD A;  2L4R A;  5IHV A;  3IHB A;  1BYW A;  5L8M A;  3DW0 A;  1DY6 A;  1A0K A;  2LB9 A;  4BBT A;  1XA7 A;  5HFO A;  4Y3I A;  3S7N A;  2IWD A;  3C7V A;  3UO9 A;  5FQM A;  2W1T B;  3TRC A;  5HAQ A;  1KGE A;  1YMS A;  1PRQ A;  3PBR A;  2G2W A;  3UB6 A;  3SS5 A;  2YKF A;  3JVV A;  1U60 A;  4NXG A;  4OOY A;  4PHT A;  2XH9 A;  3IBR A;  1GHM A;  4EQI A;  2XK1 A;  3PR6 A;  2Y2G A;  4C3Q A;  3IX4 A;  3DTE A;  4BD1 A;  4E3N A;  1PI5 A;  3T4L A;  2ZC3 B;  4OPQ A;  4RX2 A;  3T1S A;  1G5U A;  4LRX C;  3T4T A;  1KOU A;  1PIO A;  4CJN A;  3EOI A;  4LV0 A;  2INW A;  2Y55 A;  3BYD A;  4ZDX A;  2PAV P;  3LUQ A;  4PPR A;  3LIE A;  1ZG6 A;  3D3O A;  5AVE A;  2WAD A;  2P9V B;  3GDI A;  4FD8 A;  2PRF A;  4UHU A;  2PD8 A;  3CUE A;  4R3B A;  3VSL A;  2EXB A;  4HJ4 A;  4YFM A;  2W3G A;  2D02 A;  3D4F A;  3N7W A;  2EX2 A;  1XFN A;  1YLY A;  3HLE A;  3BEB A;  1PW1 A;  3QHY A;  3HJK A;  3ZVW A;  4EES A;  1L0F A;  1VQQ A;  4KG6 A;  3UME A;  2IWC A;  4DN0 A;  4KUK A;  2WAE A;  4I39 A;  2VGK A;  1L0E A;  3MFX A;  3IXB A;  4WBG A;  3FKW A;  3NOU C;  5FA7 A;  2XRO A;  3UDI A;  1TD5 A;  2ZC7 A;  4A5R A;  3HLB A;  4IJG A;  3CI6 A;  1OTE A;  3C4P A;  2XDM A;  5FAS A;  1QMF A;  1CQA A;  4RX3 A;  4Y17 A;  2H10 A;  3ITA A;  3EGX C;  3BLM A;  3FKV A;  2EX8 A;  2QYB A;  3GVB A;  5CEC A;  2ZL1 B;  4E3K A;  5HDD A;  1YLP A;  4KZ5 A;  2OLU A;  2WKR A;  3CHW P;  4DXB A;  5EM0 A;  4LRY C;  5DJT A;  4HOI A;  3IXD A;  1PNE A;  4S2K A;  1MKI A;  1XJ3 A;  2PYP A;  5CGX A;  3TW8 A;  4UQI S;  2RL3 A;  4MN7 A;  1CF0 A;  1P9W A;  3HLG A;  1KVL A;  1IKG A;  1MC0 A;  3LGO A;  4X68 A;  3NDE A;  2J3T C;  3K3D A;  4KQD A;  5U47 A;  4DE2 A;  4Q8I A;  3FV7 A;  2W0N A;  1PWD A;  1BUE A;  1E3U D;  3LO7 A;  2VGL M;  2VGJ A;  1W8Y A;  2ZM8 A;  5DJU A;  3RFB A;  4N1X A;  4X6T A;  1EI5 A;  4Q0I A;  5DFY A;  3VOY A;  4FSF A;  5TGF A;  3BLS A;  3W2Z A;  3PBO A;  3LIF A;  3SOI A;  5EPH A;  2GDN A;  3PBS A;  4KG5 A;  4OOL A;  3PHY A;  5HDC A;  2JKT I;  3MR0 A;  2Z6C A;  3DAV A;  3E4P A;  1RCJ A;  3EGD C;  1BUL A;  1NLZ A;  1T1A A;  5AQA A;  1TS7 A;  5EEC A;  4HBT A;  4KQQ A;  4L0L A;  1TVF A;  5EVI A;  2JCH A;  4PM5 A;  3OPP A;  4I5S A;  1O7E A;  4MN5 A;  3V50 A;  4Y7P A;  5G18 A;  1XJ6 A;  4GDN A;  1BSG A;  4IUK A;  4R6L A;  2EX9 A;  3W8K A;  2ZMV A;  4WEK A;  3OCN A;  1Z6F A;  3C38 A;  1G68 A;  2W3H A;  4CLC C;  2HDS A;  4EER A;  5CGW A;  1H3Q A;  2XFS A;  5FQ9 A;  2J80 A;  4D60 A;  5L07 A;  3T4J A;  4I3A A;  3M6H A;  1CJF A;  3VFH A;  1YKD A;  4DDY A;  2Y2M A;  4XT2 A;  1GCE A;  3F1O A;  3MQO A;  3T1X A;  3H7W A;  1IKI A;  3HUO A;  3HUN A;  4ARZ A;  2GZA A;  4ETZ A;  5DVA A;  3HLW A;  4Y0O A;  4M4X A;  1K4F A;  3GQZ A;  4II7 A;  1H8Y A;  4LV2 A;  5DKK A;  4NXE A;  1MKM A;  1Y28 A;  4LEN A;  4QY5 A;  3LIC A;  5AQ7 A;  4E6X A;  2XLN A;  4OPY A;  3MKE A;  3P09 A;  1G28 A;  3RXW A;  1SDE A;  1T19 A;  1F9I A;  2VV7 A;  3F1N A;  3C5A A;  2JKR M;  2B18 A;  1KGG A;  1HTZ A;  2Y79 A;  4PAU A;  2QJ5 A;  1GSX A;  4R3J A;  1BZA A;  1AXB A;  3PBQ A;  4ZTK A;  2J9O A;  3S7O A;  4B4Z A;  1H5X A;  4PKY G;  1ES5 A;  1TS0 A;  4ZJ3 A;  3Q7V A;  3IBJ A;  1W79 A;  1ES3 A;  4EWF A;  5E2H A;  1FR1 A;  4HIA A;  3BEC A;  1JTD A;  2VLG A;  4JBF A;  5JYP A;  4DJ2 A;  4OLD A;  1NZU A;  3E4O A;  5HD5 A;  3R7W A;  2VGL S;  2HZ5 A;  4N9K A;  2H0Y A;  1K6R A;  2B02 A;  1DJB A;  4LCL A;  4KZ3 A;  2WK0 A;  4NEE D;  2NUP C;  4GOG A;  1K57 A;  3C4O A;  4WL9 A;  2Y4A A;  1KE3 A;  4JF6 A;  2XA7 M;  2V0U A;  4JXV A;  3A3J A;  2W3D A;  3HCY A;  5L09 A;  3IWI A;  1K55 C;  2XSS A;  2JBF A;  4I3J A;  1PWG A;  3QP1 A;  4I38 A;  4EV4 A;  4BBV A;  1YLW A;  3NIA A;  3KO6 A;  3A3E A;  2ZLY A;  2PT7 A;  3A3F A;  4KZ7 A;  5M1A A;  4JGO A;  4BEN A;  2XD1 A;  3Q1F A;  4JXW A;  4WZ4 A;  5J4E A;  3MF0 A; 
#chains in the Genus database with same CATH homology
 4FTX A;  1K0K A;  1VEU B;  2V8F A;  2ACG A;  3MSH A;  1A0K A;  2JKF A;  3NUL A;  3DAV A;  5EV0 A;  3D9Y A;  5FDS A;  1PRQ A;  3CPT B;  4ESP A;  1Y4O A;  1J3W A;  1CQA A;  1VEU A;  3KYE A;  1PFL A;  1SKO B;  3T1R A;  4QWO A;  4X25 A;  1VET B;  5FEF A;  1HLU P;  2ZL1 B;  5FEG A;  3T1S A;  2PBD P;  2B95 A;  1G5U A;  1SZV A;  2HZ5 A;  3CPT A;  2PAV P;  2JKG A;  1FIK A;  3CHW P;  1ACF A;  5EM0 A;  4D60 A;  1SKO A;  3L7H A;  1CJF A;  3L9K A;  5EVE A;  4X1L A;  1D1J A;  1PNE A;  3NEC A;  1YPR A;  3T1Q B;  2PRF A;  1FIL A;  1VET A;  3LEQ A;  2ZL1 A;  3T1X A;  2E8J A;  1F2K A;  3U4L P;  2VK3 A;  1CF0 A;  1AWI A;  3MS6 A;  3LGO A;  1Z09 A;  4FUW A;  3T12 B;  4X1M A;  5EM1 A;  3UB5 P;  2BTF P;  2V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...