1VEUB

Crystal structure of the p14/mp1 complex at 2.15 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
GMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title Crystal structure of the p14/MP1 scaffolding complex: How a twin couple attaches mitogen- activated protein kinase signaling to late endosomes
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/protein binding
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1veuB00
4X25A 1VETA 3T1XA 2JKFA 2V8CA 1ACFA 3L9KA 3LEQA 2V8FA 5EM0A 2PBDP 3NULA 5EM1A 3D9YA 1PRQA 2E8JA 3UB5P 5FEGA 5EV0A 1SKOA 3CPTB 4X1MA 2HZ5A 2ZL1A 3LGOA 2JKGA 3U4LP 2VK3A 1VEUB 4FUWA 3T12B 1VETB 1K0KA 1G5UA 3T1SA 1J3WA 1A0KA 4QWOA 4FTXA 1AWIA 5FEFA 1FIKA 1CQAA 1SZVA 3MSHA 4X1LA 1SKOB 5FDSA 3DAVA 3NECA 2PAVP 1F2KA 3L7HA 3T1RA 2PRFA 1PFLA 4D60A 3CHWP 2ZL1B 1YPRA 2BTFP 1FILA 1D1JA 1CF0A 1CJFA 3T1QB 2B95A 5EVEA 1Z09A 3CPTA 1PNEA 2ACGA 1Y4OA 3KYEA 3MS6A 1VEUA 1HLUP 4ESPA
chains in the Genus database with same CATH superfamily
3SW1A 3LR3A 4R6LA 4E6WA 3NOTC 2XQZA 2A2LA 3GECA 2OAP1 3GMWA 5CGWA 3MF0A 5FAOA 2Y2GA 5HFOA 1KVMA 4Q0JA 1ONHA 1RP5A 1YLPA 5HPFA 3R7WA 1P97A 2I9VA 2X71A 2XROA 2HP5A 2J80A 2L0WA 1G6AA 4ZBEA 1S1YA 2ZL1A 4JXGA 1WA9A 4GLQA 4N9LA 4JXSA 1LI0A 1LSVA 3CMZA 3CUEC 2PR6A 5DF8A 3TSGA 3O86A 3QP5A 4OQGA 3N6IA 4QWOA 2VGLM 3BY9A 2JKRI 2ZC4B 4WEKA 4UA6A 3V39A 3UE3A 1WE4A 4BBUA 3MQ0A 4N9KA 2Y2JA 3EEHA 2DNSA 4WZ4A 1OJ5A 3PAGA 4WYYA 4EEPA 1GSXA 3L7HA 4L9EA 2EX6A 5KIZA 3HUNA 4JF6A 3QHYA 3LO7A 3D4FA 1VQQA 1FILA 4X53A 4Y17A 2ZMVA 4QY6A 2H10A 1DJCA 1NZOA 2JC7A 4IHQA 1BULA 1XA7A 3G31A 5HD5A 4Y3IA 1N9BA 2H5SA 4S2LA 4R3AA 3UPOA 2Y2HA 1MWTA 3MZDA 1K38A 5FI6A 2J3WA 3S7QA 4O8GA 2Z2LB 4O7DA 2GNXA 3OZHA 3FPWA 4QU3A 3SZTA 1H5XA 1E4DA 1BLHA 4ZTKA 5J8XA 5K5BA 3CPTB 1CK3A 4X1MA 2VJWA 1IYSA 4K91A 1SKFA 1DP8A 3OOVA 4R1GA 5DF7A 2L1MA 4EW7A 1LT0A 3CJMA 3HJIA 2W3GA 3O5YA 3LY3A 3MR0A 4KQQA 2O99A 1JTDA 5DVAA 4EWFA 3UN7A 4ZJ2A 1K57C 1BT5A 3NJAA 4WF0A 5HZHA 2M7UA 5F82A 1OTIA 2FFFB 2WKRA 2V0UA 1PW1A 2ZC7A 5E2GA 3ZVTA 3JVVA 1E3UD 2XRNA 2V2FF 4LV3A 4GDNA 3HLWA 4XT2B 3MXRA 3W4PA 3UDFA 5FSRA 2XFTA 4ZRRA 3CPTA 4Y0TA 3HLFA 1PZPA 1VHMA 5CRFA 1YLWA 4GW9A 5HL1A 4RX3A 3C7UA 3LICA 2VLGA 4OP5A 3A0SA 2ZOIA 3MXQA 1JWVA 1TS0A 1PI5A 2WGWB 3EQUA 1ZG6A 3G30A 2MJ6A 4OPYA 3ZCZA 4K0WA 4WEJA 1TDGA 3AGFA 3FPVA 1F5MA 3A3DA 1G68A 3DWZA 4Q8IA 1XP4A 2YKHA 1K25A 4ZJ3A 4R4RA 5EECA 4B4ZA 4Y2FA 4XT2A 4HBUA 3FKWA 2ZQ9A 5HDSA 2ZM2A 2ZQAA 2VEAA 4MBHA 3C4OA 3I7JA 3GQZA 1PI4A 5CX7A 3ICYA 4H8RA 5TGFA 3QP1A 1TDLA 2B02A 2L4RA 1Y28A 3ISGA 4PM6A 5AVEA 2WK0A 3M6HA 2VGKA 3UDXA 1ERQA 5FEFA 1DY6A 3F1PB 2PT7A 5HWWA 2W1TB 2G2UA 1L0EA 4KZ4A 2WGWA 2E8IA 3SH8A 2PRFA 5HDDA 3CHWP 4S2MA 2PYPA 1BLPA 4WN5A 3HLCA 1TVFA 4D2OA 3NIAA 2Y2IA 4EESA 4EBNA 4X6TA 3SOIA 3UE1A 4R38A 5EVIB 2EX9A 5E2FA 2A49A 1YMSA 3GRJA 3HUOA 1T18A 5HW3A 4OOLA 4EV4A 1K4EA 1PWDA 3GV9A 4N1HA 2JKFA 4LRYC 5EPHA 3U2AA 4GNUA 2HDQA 2PYRA 2Z6DA 5F6AA 3HLDA 4P6ZS 3UO9A 2UWXA 1XFQA 4ZJ1A 2PBDP 1DP9A 3VP4A 3BFGA 4UA7A 3WRZA 5J4EA 2WZXA 3D9YA 2Z2MB 3AGEA 3F1PA 3H9WA 2WUQA 2W1TA 3MBZA 2LB9A 3MFDA 5KMWA 1FR6A 5FAQA 3S7NA 4HJ3A 4F94A 1S66L 3BQ8A 4FUWA 5F1GA 2JHEA 4HQAA 1S6RA 3NI9A 1LI9A 4MCWA 3K3DA 1FQGA 1YSPA 5CXWA 3SH7A 1KGGA 5EVIA 2Y91A 3UDIA 5LBRA 1K54C 1BSGA 1NLYA 4NG2A 2Y2KA 5TFQA 4GHIB 1Q2PA 3UE6A 3EGDC 5G18A 4WM9A 4JXVA 1XX2A 2VZWA 4HNBA 4EBLA 3G34A 3DAVA 3T4TA 1S67L 4BD1A 1EWZA 3MMHA 1ES5A 2H0TA 1OTBA 1ZTUA 3ZVWA 2Y2NA 3C30A 1KE0A 4OQHA 1H8MA 2PD7A 4PHTA 2OOLA 2Z6CA 4OQ0A 3UB6A 1LSWA 3E4OA 5L07A 4NXEA 1LSXA 1S4SA 3BYDA 3P01A 1XPBA 2P9VB 4JGPA 2R78A 3LIEA 3G4PA 2Y4AA 3A0VA 2V9AA 2ZBBA 4YINA 3LIDA 3GVBA 4MBFA 2PHYA 2WKPA 4GHIA 4LV0A 3UE0A 4OVDA 2O9CA 4I3JA 1JVJA 3LFVA 2IWDA 4LLOB 2RL3A 4PMAA 4FH2A 4X69A 4ZAMA 3QP8A 3NCKA 2XK1A 4MN5A 1GA0A 1KDSA 1PYYA 3W2ZA 2LB5A 2DCFA 1OTEA 1G5UA 5L2FA 4EUVA 1XJ6A 1K56D 4HOIA 4DKIA 1L0FA 2H28A 1KE3A 2ZMFA 4AFIA 2XEPA 3RXXA 2BG1A 4OLGA 5FA7A 5MC7A 3DTEA 4KZAA 3BM6A 3BFEA 2P9VA 2EX2A 1TS6A 4Y13A 1MBLA 3OCLA 2G2WA 2KX6A 1CF0A 2JE5A 5CHUA 2OSUA 3E2KA 3IXDA 1SDEA 3AGDA 1I2WA 3DW0A 2ACGA 1M40A 3E98A 3BLSA 2NUPC 4DJ2A 4X56A 3VE3A 4GJ4A 2VGLS 2KLIA 4PPRA 4HP4A 2J3TC 4X25A 3Q81A 3QNBA 4PM9A 5C5KA 4HIAA 4IVKA 5A91A 1GSVA 2J8YA 4E3OA 2DMWA 3HJKA 4MDZA 5L09A 4K08A 2HDSA 3Q1FA 3ZG9B 4GKUA 1VM1A 3BJNA 2W3FA 2XR0A 5EUAA 2CC1A 1UGUA 5FEGA 3ZYTA 4CLCC 3UY6A 1XJ4A 3T4QA 3IXBA 4DE0A 1NRJA 4X68A 3HLGA 3E4QA 2O0YA 3CUEA 4WZ5C 4F3LB 4MNRA 1RGYA 1A0KA 1LLBA 3JVUA 1CEFA 2B5RA 2W3HA 3FWLA 3ZGAB 1U60A 4LRZE 5DFYA 3ZQ5A 1EROA 4KQDA 2ZQDA 3GSGA 3OPPA 4MN7A 5DJTA 3IX3A 2QWSA 3NECA 3T1RA 3OPLA 2WAFA 4D60A 3TJZC 2XA7M 3HCYA 4RX2A 4R70A 4ARZB 3OPRA 4E3LA 4OOMA 3T1QB 2PD8A 2JKTI 3LIAA 3QP2A 5FATA 2D02A 4IBXA 2JBFA 4JLFA 1P0ZA 3MZEA 5EE8A 4WL9A 4RQ9A 2VA0A 1ESIA 1MPLA 1DJBA 4CPKA 1MWRA 4OOYA 4F3LA 1FSWA 1J9MA 2WKEA 3NULA 3JPUA 5BOHA 2VKSA 4LFUA 3IX4A 2J9PA 4FD8A 3V5MA 3G35A 4BWIA 5IS1A 3WWXA 4UQIM 1BLSA 2W3EA 3IF5A 3KYZA 4C75A 3U4LP 4O0PA 4II7A 4ARZA 2VV7A 3QP6A 3VFFA 2BLSA 3VP2A 3O88A 4R4SA 4OLDA 1CEGA 4LRXC 4IVIA 4QY5A 4KENB 4E3IA 2J7VA 1BZAA 4FCFA 3S7PA 3G6OA 1P9WA 3WS0A 3UMEA 5TR7A 3VSKA 4ID4A 1FIKA 2OAQ1 4L9FA 5FAPA 1MWSA 2PU4A 3PBNA 4KQOA 4ZDXA 2OLVA 4FOFA 3VSLA 5L10A 5DTKA 4GZBA 5FQIA 3S7OA 1ERMA 1OPXA 2HF6A 4PKYG 5EVEA 1W8QA 2GDNA 1CI8A 5FL3A 3OBFA 3MQOA 2Q0OA 2K31A 3CAXA 4G3KA 4PKYA 1K4FA 1YQSA 3W4QA 4XUXA 1W79A 1ZC2A 1F9IA 3NY4A 1D7EA 2P7JA 2ZC5B 3N4IA 3M2JA 4BBVA 2IA2A 4HBTA 5DFXA 2XDMA 3H7WB 1YSQA 1OMEA 4L9GA 3V50A 2W27A 3S4XA 5A93A 1Q2QA 3VOYA 2JKGA 1SHVA 1DJAA 3BFDA 1D06A 3T12B 1G6OA 2WADA 4DDSA 2ZMAA 1OTAA 2RCXA 5AVFA 3B3XA 4KUKA 2VGJA 3C4PA 3IF6B 4HH3A 1ES4A 5I94A 5CEDA 2QJ7A 3HL9A 1OT9A 2XSSA 3Q82A 2V1BA 3D3OA 1H0MA 4WMCD 2HJ9C 3TE8A 3VV4A 3H7WA 1XFNA 5AQBA 3PBQA 2V20A 1K55C 1E3UA 4KZ3A 5EOEA 5M19A 3KSIA 1D1JA 1M6KA 1XJ3A 4DJ3A 5A8BA 2EWWA 3M2KA 3PYPA 1S0WA 3MZFA 3CZDA 2K7SA 3PAEA 1I5QA 4Y15A 3T4LA 2HGVA 4MEZA 2OLUA 2WKHA 3IF6A 4Q0HA 5CEBA 3KO6A 4H6JB 3EGXC 1HZOA 5HWVA 2O9BA 1EI5A 1SDNA 3N8LA 1S1ZA 1O7EA 2QMIA 4P87A 2M7VA 3RFBA 1ES2A 4GOGA 3NDEA 1L3LA 1N9OA 4GB7A 4GD8A 1K0KA 4NXFA 3UB9A 2QYBA 1W63M 3KSHA 3LI8A 3QP4A 2PDRA 4LCLA 2M1CA 1MC0A 3EWKA 1T1BA 3IXGA 3HLEA 1BYWA 5AQAA 5U47A 1KVLA 4LV2A 3P98A 2H0YA 3ZHHA 4OQIA 4UAAA 3HLBA 3N8SA 4BMWA 4BQMA 5HAIA 4H6JA 5HX9A 1W5DA 4Y5FA 1LL8A 2C5WB 3FV7A 2A24A 3VP0A 4S2JA 3C38A 4EQIA 3ZG5A 4QPRA 4S2KA 4UHUA 2XGNA 1NWZA 4EUZA 4MLLA 3GR2A 5GLCA 4K0XA 1TF1A 2V1AA 4ESPA 3G32A 5G4ZA 2JKTM 4EQ1A 2J3TD 4RVAA 2XFSA 3H82A 4OPRA 5HARA 3L9KA 2W0NA 1KOUA 1LL5A 2Y2LA 3UB7A 1H8YA 4JXWA 4B4XA 5EM1A 3TG9A 4ME4A 4IEDA 4S2NA 3V67A 1N9NA 3DWKA 4HI4A 4CLCD 4LCMA 3N8RA 2C6WB 3E0YA 1GHMA 5EVIC 4OONA 4CLCE 4HJ4A 3G2YA 3A0RA 3UNWA 1VEUB 4YFMA 5DF9A 4P6BA 3A3IA 2VV8A 3C8CA 3WRTA 5A90A 3BFCA 1FR1A 4WBGA 4Y7PA 1RCJA 3A3FA 2EFXA 4R0QA 1FCOA 1L2SA 5KSCA 4NETA 3BFFA 1CQAA 5F68A 1SKOB 5EFWA 2HPBA 5FDSA 4JGQA 2ZC6B 3LIFA 2EWVA 1XGJA 3IWQA 4LGWA 5IHVA 2ZD8A 5FI2A 4OPQA 4JGOA 2Y2PA 1CJFA 3ITBA 3FZCA 1T1AA 3O3VA 4E3KA 2VX8A 5GL9A 3NC8A 1PW8A 2GJ3A 4HY8A 1VEUA 3UPNA 3OC2A 3LI9A 2V8CA 5A92A 2PBYA 5EVLA 4GDBA 3OLOA 1KGEA 2JCHA 3VE4A 5IT5A 4JF5A 4I38A 1IFQA 4RYEA 4BL2A 4KG5A 1E25A 2XA7S 2Q9NA 1HTZA 2P74A 3BY8A 1SKOA 4HESA 2Y79A 1YLJA 3UB8A 2A3UA 1ZHHB 5HPIA 4X55A 5GLAA 2VK3A 4GS9B 1IELA 5HAPA 4GN2A 2FFYA 4HP9A 2B18A 3W8KA 2PR5A 2WGVA 1V9YA 1IYPA 4XXRA 2D01A 3B33A 2Y8HA 4E3JA 1MY8A 1YLZA 3F1OA 3PTEA 1JWPA 4BLMA 1FCMA 1JTGA 4MMNA 2PU2A 4EXOA 3HREA 5M18A 3FKVA 3LIBA 3VOLA 2XLNA 3VFHA 1K56A 5FQ9A 3IT9A 1FCNA 4NXGA 4Z1WA 2ZOHA 2V1ZA 2WKIA 3IHAA 1LHYA 4NXBA 1F2KA 1AXBA 1STZA 2FH5A 1L0GA 4BBTA 4UQIS 3C5AA 1OJGA 1WYCA 2Q9MA 2HV1A 1IYQA 4OKPA 3TW8A 2NUTC 2WKQA 4LV1A 2AVXA 3MQQA 3BW6A 3IX8A 3KYEA 3HUMA 4NKPA 4GS9A 3GDIA 4R3JA 3CWFA 1S4RA 2Y55A 1N4OA 3MKEA 1FSYA 2JN7A 1UWPX 3NBLA 2R9WA 3C7VA 2W1RA 4PM8A 3E2LA 4DE3A 1XKZA 3PBOA 4HHDA 4N1XA 1XJ2A 5IU1A 3VP1A 2GZAA 3E4PA 4M4XA 3T4JA 3ZNYA 4EU0A 3PBRA 4QD4A 4CJNA 4HH2A 2HJEA 4KUOA 3S22A 4E04A 1DRMA 1OTDA 2OWHA 2ZC3B 3IXHA 2ZM0A 3Q07A 2VV6A 1ZKJA 1MKIA 3VP3A 2J9OA 3P7NA 2ZJ9A 2WZZA 3NHQA 1ES3A 5EOOA 3SS3A 1W8YA 4C6YA 3PHYA 4MBKA 5DTTA 1NY0A 4IJGA 3RXWA 3WS2A 3RH8B 3LUQA 5TJJA 3PBSA 3JYIA 1X0OA 2QJ5A 5HWTA 1ODVA 3IWIA 1KDWA 1K57A 2R9XA 1F98A 2EXAA 1Z6FA 4HJ6A 1EW0A 5F1FA 5FASA 4U0XA 5AQ7A 2B95A 3IH9A 2UV0E 2HDUA 1PNEA 1MXOA 3WS4A 4JF4A 1GCEA 5E2EA 5F5YA 4Y0OA 4P0MA 2EX8A 2XH9A 5FQMA 1GSWA 3HVFA 4FSFA 1FOFA 1MWUA 2EA9A 3SH9A 1MZUA 4YWZA 3HBRA 3ZNTA 2XF3A 1IKIA 4S2IA 3VMAA 2V8FA 2WAEA 1WYBA 4E3MA 1JNUA 5HAQA 2OV5A 3T4KA 3BLMA 1Y54A 2QKPA 3A3JA 4BL3A 5EV0A 2W3DA 1PIOA 3BECA 4DRTA 3LEZA 1TD5A 2ZQ7A 3WS1A 3UMDA 5CHJA 4LPZA 3IQAA 4YNRA 3SS4A 5AQ9A 1BTLA 3LY4A 4IBRA 3DTKA 3KX0X 5CTNA 4BENA 4KZ6A 3LR5A 2Y2OA 3C2WA 4M3KA 5CHMA 3V3SA 3RJUA 1YAXA 4DXCA 4QB8A 4B93A 3CG5A 1BUEA 4KG6A 3K3CA 4DDYA 1TS8A 4DE1A 1PWCA 4S2OA 1NJ4A 1K55A 5CTMA 3BEBA 4ETXA 3KSFA 1IEMA 3Q7ZA 3CLOA 1HD8A 4N92A 2HP9A 4JPMA 3B47A 2QPNA 3T4SA 4PM5A 3DBAA 5CECA 1VB6A 2EXBA 2CMNA 4IUHA 2X02A 4JBFA 4LENA 4L0LA 4IUKA 1ZG4A 1PZOA 3OCNA 4DXBA 3MJQA 3QNCA 1MKMA 4E6XA 2X01A 3T1XA 5FQJA 4I3AA 3LYXA 1OT6A 4B88A 4KZBA 3N7WA 1IOUA 5GHXA 3ZG7B 4S2PA 5KSHA 3IBRA 5EM0A 2KDKA 5TBMB 4G3VA 5DKKA 4DE2A 1ALQA 3UB5P 4U3TA 3O87A 1P9RA 5D3OA 2INWA 5J3WA 2HDRA 3ITAA 2HZ5A 4FH4A 1G28A 5EVID 3LGOA 1W7FA 1YKDA 1W63Q 4DMZA 2EFUA 1UWNX 2BASA 3LCEA 1TEMA 1VETB 1CI9A 2A24B 3CI6A 3W4OA 3SS5A 3Q7VB 1YLTA 1NYYA 5GLBA 4WELA 5HD3A 4OP8A 5FQKA 4EEUA 1AWIA 2G7UA 4EETB 1I2SA 1H8ZA 3NDGA 5M1AA 1YT4A 1T19A 4X1LA 3F1NB 1ONGA 1BLCA 3B42A 1K54A 4I3IA 4UA9A 3V3RA 3H82B 3ULFA 5TBMA 1YLYA 1GA9A 4R3BA 3ZFZA 4QJGA 2FZ0A 3GTCA 3KYQA 4WMCA 4R23A 3DTIA 5HDCA 3BWLA 3RTYA 3IF6C 4MN6A 5JYOA 2YKFA 2Y2MA 3MS6A 3TOIA 1KGFA 1VETA 4KG2A 4KQRA 4I5SA 3EQVA 5I5LA 1K6RA 3Q7VA 1ACFA 1RGZA 2IWCA 1KE4A 4KZ7A 2HP6A 1XA1A 1L0DA 5E2HA 5DTSA 3MXSA 5JYPA 1C3BA 4RA7A 3ZDJA 5E43A 4JGRA 1PRQA 3FG8A 2E8JA 3FYZA 5HL6A 2WGIA 3EOIA 3DTMA 3UPPA 4JKTA 4B9OA 2K2NA 4OH0A 1XGIA 3F1NA 3PXPA 1T1CA 4GD6A 1V9ZA 4PM7A 1IYOA 2KOIA 3MFXA 3S1YA 2QZ6A 1NZUA 1JWZA 4U0TA 2XD5A 5F83A 3MKFA 5G4YA 4DF6A 2ZQ8A 2JKRM 4YOFA 5DKLA 4Z9QA 3IBJA 1HLUP 3R4KA 1SCWA 2ZM8A 2GX5A 4P85A 4UEYA 1QMFA 3LR0A 4A5RA 4P6ZM 5GLDA 2P08A 1SZVA 1HVBA 5FQQA 5CERA 3ZG8B 5GHYA 1PFLA 1PWGA 2I72A 4OPZA 1NXYA 2OWJA 4EERA 3IH8A 3PBTA 4GCZA 1YPRA 1NRFA 3NOUC 4NK3A 4CLCB 2P04A 4PAUA 3D72A 3A3EA 1Y4OA 4G3WA 4HEFA 4BJPA 3WS5A 4Y0UA 5HSQA 2O9AA 4Q0IA 1ESUA 5F69A 1NLZA 5AJGA 3ZG0A 3NOPC 4KZ9A 4KZ8A 3PR6A 4S2NC 2ZLYA 5FI7A 3LEQA 2IWBA 5CGSA 3EEAA 3M6BA 1N9LA 2Y59A 3CITA 5FDHA 2WYXA 3F1OB 3IWOA 3T4OA 1NYMA 2V0WA 3TRCA 1YMXA 1K6SA 5KZHA 4QHCA 3K2NA 1GHPA 3T50A 5DJUA 4DN0A 3IS2B 1TS7A 2ZQCA 1GHIA 4XUZA 4WLAA 4CLCA 3BQAA 3T1SA 1J3WA 3OPHA 1QMEA 1XXMA 2XD1A 4KZ5A 4FTXA 3VOZA 5J7EA 3FC7A 4WZ5A 3LR4A 4E3NA 4CQHA 3R7WB 1DP6A 3MSHA 4NEED 4WUJA 3BRMA 3IHBA 2DRWA 2PAVP 3KSGA 2ZL1B 4EBPA 3P09A 2BTFP 5CGXA 4I39A 1LL9A 4O01A 4ETZA 1H3QA 3G2ZA 5L8MA 1Z09A 4BD0A 2Y2QA 1O07A 3IS2A 5GHZA 1YM1A 2QHKA 4C3QA 1IKGA
chains in the Genus database with same CATH topology
4X25A 1VETA 3T1XA 2JKFA 2V8CA 1ACFA 3L9KA 3LEQA 2V8FA 5EM0A 2PBDP 3NULA 5EM1A 3D9YA 1PRQA 2E8JA 3UB5P 5FEGA 5EV0A 1SKOA 3CPTB 4X1MA 2HZ5A 2ZL1A 3LGOA 2JKGA 3U4LP 2VK3A 1VEUB 4FUWA 3T12B 1VETB 1K0KA 1G5UA 3T1SA 1J3WA 1A0KA 4QWOA 4FTXA 1AWIA 5FEFA 1FIKA 1CQAA 1SZVA 3MSHA 4X1LA 1SKOB 5FDSA 3DAVA 3NECA 2PAVP 1F2KA 3L7HA 3T1RA 2PRFA 1PFLA 4D60A 3CHWP 2ZL1B 1YPRA 2BTFP 1FILA 1D1JA 1CF0A 1CJFA 3T1QB 2B95A 5EVEA 1Z09A 3CPTA 1PNEA 2ACGA 1Y4OA 3KYEA 3MS6A 1VEUA 1HLUP 4ESPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X25 A;  1VET A;  3T1X A;  2JKF A;  2V8C A;  1ACF A;  3L9K A;  3LEQ A;  2V8F A;  5EM0 A;  2PBD P;  3NUL A;  5EM1 A;  3D9Y A;  1PRQ A;  2E8J A;  3UB5 P;  5FEG A;  5EV0 A;  1SKO A;  3CPT B;  4X1M A;  2HZ5 A;  2ZL1 A;  3LGO A;  2JKG A;  3U4L P;  2VK3 A;  1VEU B;  4FUW A;  3T12 B;  1VET B;  1K0K A;  1G5U A;  3T1S A;  1J3W A;  1A0K A;  4QWO A;  4FTX A;  1AWI A;  5FEF A;  1FIK A;  1CQA A;  1SZV A;  3MSH A;  4X1L A;  1SKO B;  5FDS A;  3DAV A;  3NEC A;  2PAV P;  1F2K A;  3L7H A;  3T1R A;  2PRF A;  1PFL A;  4D60 A;  3CHW P;  2ZL1 B;  1YPR A;  2BTF P;  1FIL A;  1D1J A;  1CF0 A;  1CJF A;  3T1Q B;  2B95 A;  5EVE A;  1Z09 A;  3CPT A;  1PNE A;  2ACG A;  1Y4O A;  3KYE A;  3MS6 A;  1VEU A;  1HLU P;  4ESP A; 
#chains in the Genus database with same CATH topology
 3SW1 A;  3LR3 A;  4R6L A;  4E6W A;  3NOT C;  2XQZ A;  2A2L A;  3GEC A;  2OAP 1;  3GMW A;  5CGW A;  3MF0 A;  5FAO A;  2Y2G A;  5HFO A;  1KVM A;  4Q0J A;  1ONH A;  1RP5 A;  1YLP A;  5HPF A;  3R7W A;  1P97 A;  2I9V A;  2X71 A;  2XRO A;  2HP5 A;  2J80 A;  2L0W A;  1G6A A;  4ZBE A;  1S1Y A;  2ZL1 A;  4JXG A;  1WA9 A;  4GLQ A;  4N9L A;  4JXS A;  1LI0 A;  1LSV A;  3CMZ A;  3CUE C;  2PR6 A;  5DF8 A;  3TSG A;  3O86 A;  3QP5 A;  4OQG A;  3N6I A;  4QWO A;  2VGL M;  3BY9 A;  2JKR I;  2ZC4 B;  4WEK A;  4UA6 A;  3V39 A;  3UE3 A;  1WE4 A;  4BBU A;  3MQ0 A;  4N9K A;  2Y2J A;  3EEH A;  2DNS A;  4WZ4 A;  1OJ5 A;  3PAG A;  4WYY A;  4EEP A;  1GSX A;  3L7H A;  4L9E A;  2EX6 A;  5KIZ A;  3HUN A;  4JF6 A;  3QHY A;  3LO7 A;  3D4F A;  1VQQ A;  1FIL A;  4X53 A;  4Y17 A;  2ZMV A;  4QY6 A;  2H10 A;  1DJC A;  1NZO A;  2JC7 A;  4IHQ A;  1BUL A;  1XA7 A;  3G31 A;  5HD5 A;  4Y3I A;  1N9B A;  2H5S A;  4S2L A;  4R3A A;  3UPO A;  2Y2H A;  1MWT A;  3MZD A;  1K38 A;  5FI6 A;  2J3W A;  3S7Q A;  4O8G A;  2Z2L B;  4O7D A;  2GNX A;  3OZH A;  3FPW A;  4QU3 A;  3SZT A;  1H5X A;  1E4D A;  1BLH A;  4ZTK A;  5J8X A;  5K5B A;  3CPT B;  1CK3 A;  4X1M A;  2VJW A;  1IYS A;  4K91 A;  1SKF A;  1DP8 A;  3OOV A;  4R1G A;  5DF7 A;  2L1M A;  4EW7 A;  1LT0 A;  3CJM A;  3HJI A;  2W3G A;  3O5Y A;  3LY3 A;  3MR0 A;  4KQQ A;  2O99 A;  1JTD A;  5DVA A;  4EWF A;  3UN7 A;  4ZJ2 A;  1K57 C;  1BT5 A;  3NJA A;  4WF0 A;  5HZH A;  2M7U A;  5F82 A;  1OTI A;  2FFF B;  2WKR A;  2V0U A;  1PW1 A;  2ZC7 A;  5E2G A;  3ZVT A;  3JVV A;  1E3U D;  2XRN A;  2V2F F;  4LV3 A;  4GDN A;  3HLW A;  4XT2 B;  3MXR A;  3W4P A;  3UDF A;  5FSR A;  2XFT A;  4ZRR A;  3CPT A;  4Y0T A;  3HLF A;  1PZP A;  1VHM A;  5CRF A;  1YLW A;  4GW9 A;  5HL1 A;  4RX3 A;  3C7U A;  3LIC A;  2VLG A;  4OP5 A;  3A0S A;  2ZOI A;  3MXQ A;  1JWV A;  1TS0 A;  1PI5 A;  2WGW B;  3EQU A;  1ZG6 A;  3G30 A;  2MJ6 A;  4OPY A;  3ZCZ A;  4K0W A;  4WEJ A;  1TDG A;  3AGF A;  3FPV A;  1F5M A;  3A3D A;  1G68 A;  3DWZ A;  4Q8I A;  1XP4 A;  2YKH A;  1K25 A;  4ZJ3 A;  4R4R A;  5EEC A;  4B4Z A;  4Y2F A;  4XT2 A;  4HBU A;  3FKW A;  2ZQ9 A;  5HDS A;  2ZM2 A;  2ZQA A;  2VEA A;  4MBH A;  3C4O A;  3I7J A;  3GQZ A;  1PI4 A;  5CX7 A;  3ICY A;  4H8R A;  5TGF A;  3QP1 A;  1TDL A;  2B02 A;  2L4R A;  1Y28 A;  3ISG A;  4PM6 A;  5AVE A;  2WK0 A;  3M6H A;  2VGK A;  3UDX A;  1ERQ A;  5FEF A;  1DY6 A;  3F1P B;  2PT7 A;  5HWW A;  2W1T B;  2G2U A;  1L0E A;  4KZ4 A;  2WGW A;  2E8I A;  3SH8 A;  2PRF A;  5HDD A;  3CHW P;  4S2M A;  2PYP A;  1BLP A;  4WN5 A;  3HLC A;  1TVF A;  4D2O A;  3NIA A;  2Y2I A;  4EES A;  4EBN A;  4X6T A;  3SOI A;  3UE1 A;  4R38 A;  5EVI B;  2EX9 A;  5E2F A;  2A49 A;  1YMS A;  3GRJ A;  3HUO A;  1T18 A;  5HW3 A;  4OOL A;  4EV4 A;  1K4E A;  1PWD A;  3GV9 A;  4N1H A;  2JKF A;  4LRY C;  5EPH A;  3U2A A;  4GNU A;  2HDQ A;  2PYR A;  2Z6D A;  5F6A A;  3HLD A;  4P6Z S;  3UO9 A;  2UWX A;  1XFQ A;  4ZJ1 A;  2PBD P;  1DP9 A;  3VP4 A;  3BFG A;  4UA7 A;  3WRZ A;  5J4E A;  2WZX A;  3D9Y A;  2Z2M B;  3AGE A;  3F1P A;  3H9W A;  2WUQ A;  2W1T A;  3MBZ A;  2LB9 A;  3MFD A;  5KMW A;  1FR6 A;  5FAQ A;  3S7N A;  4HJ3 A;  4F94 A;  1S66 L;  3BQ8 A;  4FUW A;  5F1G A;  2JHE A;  4HQA A;  1S6R A;  3NI9 A;  1LI9 A;  4MCW A;  3K3D A;  1FQG A;  1YSP A;  5CXW A;  3SH7 A;  1KGG A;  5EVI A;  2Y91 A;  3UDI A;  5LBR A;  1K54 C;  1BSG A;  1NLY A;  4NG2 A;  2Y2K A;  5TFQ A;  4GHI B;  1Q2P A;  3UE6 A;  3EGD C;  5G18 A;  4WM9 A;  4JXV A;  1XX2 A;  2VZW A;  4HNB A;  4EBL A;  3G34 A;  3DAV A;  3T4T A;  1S67 L;  4BD1 A;  1EWZ A;  3MMH A;  1ES5 A;  2H0T A;  1OTB A;  1ZTU A;  3ZVW A;  2Y2N A;  3C30 A;  1KE0 A;  4OQH A;  1H8M A;  2PD7 A;  4PHT A;  2OOL A;  2Z6C A;  4OQ0 A;  3UB6 A;  1LSW A;  3E4O A;  5L07 A;  4NXE A;  1LSX A;  1S4S A;  3BYD A;  3P01 A;  1XPB A;  2P9V B;  4JGP A;  2R78 A;  3LIE A;  3G4P A;  2Y4A A;  3A0V A;  2V9A A;  2ZBB A;  4YIN A;  3LID A;  3GVB A;  4MBF A;  2PHY A;  2WKP A;  4GHI A;  4LV0 A;  3UE0 A;  4OVD A;  2O9C A;  4I3J A;  1JVJ A;  3LFV A;  2IWD A;  4LLO B;  2RL3 A;  4PMA A;  4FH2 A;  4X69 A;  4ZAM A;  3QP8 A;  3NCK A;  2XK1 A;  4MN5 A;  1GA0 A;  1KDS A;  1PYY A;  3W2Z A;  2LB5 A;  2DCF A;  1OTE A;  1G5U A;  5L2F A;  4EUV A;  1XJ6 A;  1K56 D;  4HOI A;  4DKI A;  1L0F A;  2H28 A;  1KE3 A;  2ZMF A;  4AFI A;  2XEP A;  3RXX A;  2BG1 A;  4OLG A;  5FA7 A;  5MC7 A;  3DTE A;  4KZA A;  3BM6 A;  3BFE A;  2P9V A;  2EX2 A;  1TS6 A;  4Y13 A;  1MBL A;  3OCL A;  2G2W A;  2KX6 A;  1CF0 A;  2JE5 A;  5CHU A;  2OSU A;  3E2K A;  3IXD A;  1SDE A;  3AGD A;  1I2W A;  3DW0 A;  2ACG A;  1M40 A;  3E98 A;  3BLS A;  2NUP C;  4DJ2 A;  4X56 A;  3VE3 A;  4GJ4 A;  2VGL S;  2KLI A;  4PPR A;  4HP4 A;  2J3T C;  4X25 A;  3Q81 A;  3QNB A;  4PM9 A;  5C5K A;  4HIA A;  4IVK A;  5A91 A;  1GSV A;  2J8Y A;  4E3O A;  2DMW A;  3HJK A;  4MDZ A;  5L09 A;  4K08 A;  2HDS A;  3Q1F A;  3ZG9 B;  4GKU A;  1VM1 A;  3BJN A;  2W3F A;  2XR0 A;  5EUA A;  2CC1 A;  1UGU A;  5FEG A;  3ZYT A;  4CLC C;  3UY6 A;  1XJ4 A;  3T4Q A;  3IXB A;  4DE0 A;  1NRJ A;  4X68 A;  3HLG A;  3E4Q A;  2O0Y A;  3CUE A;  4WZ5 C;  4F3L B;  4MNR A;  1RGY A;  1A0K A;  1LLB A;  3JVU A;  1CEF A;  2B5R A;  2W3H A;  3FWL A;  3ZGA B;  1U60 A;  4LRZ E;  5DFY A;  3ZQ5 A;  1ERO A;  4KQD A;  2ZQD A;  3GSG A;  3OPP A;  4MN7 A;  5DJT A;  3IX3 A;  2QWS A;  3NEC A;  3T1R A;  3OPL A;  2WAF A;  4D60 A;  3TJZ C;  2XA7 M;  3HCY A;  4RX2 A;  4R70 A;  4ARZ B;  3OPR A;  4E3L A;  4OOM A;  3T1Q B;  2PD8 A;  2JKT I;  3LIA A;  3QP2 A;  5FAT A;  2D02 A;  4IBX A;  2JBF A;  4JLF A;  1P0Z A;  3MZE A;  5EE8 A;  4WL9 A;  4RQ9 A;  2VA0 A;  1ESI A;  1MPL A;  1DJB A;  4CPK A;  1MWR A;  4OOY A;  4F3L A;  1FSW A;  1J9M A;  2WKE A;  3NUL A;  3JPU A;  5BOH A;  2VKS A;  4LFU A;  3IX4 A;  2J9P A;  4FD8 A;  3V5M A;  3G35 A;  4BWI A;  5IS1 A;  3WWX A;  4UQI M;  1BLS A;  2W3E A;  3IF5 A;  3KYZ A;  4C75 A;  3U4L P;  4O0P A;  4II7 A;  4ARZ A;  2VV7 A;  3QP6 A;  3VFF A;  2BLS A;  3VP2 A;  3O88 A;  4R4S A;  4OLD A;  1CEG A;  4LRX C;  4IVI A;  4QY5 A;  4KEN B;  4E3I A;  2J7V A;  1BZA A;  4FCF A;  3S7P A;  3G6O A;  1P9W A;  3WS0 A;  3UME A;  5TR7 A;  3VSK A;  4ID4 A;  1FIK A;  2OAQ 1;  4L9F A;  5FAP A;  1MWS A;  2PU4 A;  3PBN A;  4KQO A;  4ZDX A;  2OLV A;  4FOF A;  3VSL A;  5L10 A;  5DTK A;  4GZB A;  5FQI A;  3S7O A;  1ERM A;  1OPX A;  2HF6 A;  4PKY G;  5EVE A;  1W8Q A;  2GDN A;  1CI8 A;  5FL3 A;  3OBF A;  3MQO A;  2Q0O A;  2K31 A;  3CAX A;  4G3K A;  4PKY A;  1K4F A;  1YQS A;  3W4Q A;  4XUX A;  1W79 A;  1ZC2 A;  1F9I A;  3NY4 A;  1D7E A;  2P7J A;  2ZC5 B;  3N4I A;  3M2J A;  4BBV A;  2IA2 A;  4HBT A;  5DFX A;  2XDM A;  3H7W B;  1YSQ A;  1OME A;  4L9G A;  3V50 A;  2W27 A;  3S4X A;  5A93 A;  1Q2Q A;  3VOY A;  2JKG A;  1SHV A;  1DJA A;  3BFD A;  1D06 A;  3T12 B;  1G6O A;  2WAD A;  4DDS A;  2ZMA A;  1OTA A;  2RCX A;  5AVF A;  3B3X A;  4KUK A;  2VGJ A;  3C4P A;  3IF6 B;  4HH3 A;  1ES4 A;  5I94 A;  5CED A;  2QJ7 A;  3HL9 A;  1OT9 A;  2XSS A;  3Q82 A;  2V1B A;  3D3O A;  1H0M A;  4WMC D;  2HJ9 C;  3TE8 A;  3VV4 A;  3H7W A;  1XFN A;  5AQB A;  3PBQ A;  2V20 A;  1K55 C;  1E3U A;  4KZ3 A;  5EOE A;  5M19 A;  3KSI A;  1D1J A;  1M6K A;  1XJ3 A;  4DJ3 A;  5A8B A;  2EWW A;  3M2K A;  3PYP A;  1S0W A;  3MZF A;  3CZD A;  2K7S A;  3PAE A;  1I5Q A;  4Y15 A;  3T4L A;  2HGV A;  4MEZ A;  2OLU A;  2WKH A;  3IF6 A;  4Q0H A;  5CEB A;  3KO6 A;  4H6J B;  3EGX C;  1HZO A;  5HWV A;  2O9B A;  1EI5 A;  1SDN A;  3N8L A;  1S1Z A;  1O7E A;  2QMI A;  4P87 A;  2M7V A;  3RFB A;  1ES2 A;  4GOG A;  3NDE A;  1L3L A;  1N9O A;  4GB7 A;  4GD8 A;  1K0K A;  4NXF A;  3UB9 A;  2QYB A;  1W63 M;  3KSH A;  3LI8 A;  3QP4 A;  2PDR A;  4LCL A;  2M1C A;  1MC0 A;  3EWK A;  1T1B A;  3IXG A;  3HLE A;  1BYW A;  5AQA A;  5U47 A;  1KVL A;  4LV2 A;  3P98 A;  2H0Y A;  3ZHH A;  4OQI A;  4UAA A;  3HLB A;  3N8S A;  4BMW A;  4BQM A;  5HAI A;  4H6J A;  5HX9 A;  1W5D A;  4Y5F A;  1LL8 A;  2C5W B;  3FV7 A;  2A24 A;  3VP0 A;  4S2J A;  3C38 A;  4EQI A;  3ZG5 A;  4QPR A;  4S2K A;  4UHU A;  2XGN A;  1NWZ A;  4EUZ A;  4MLL A;  3GR2 A;  5GLC A;  4K0X A;  1TF1 A;  2V1A A;  4ESP A;  3G32 A;  5G4Z A;  2JKT M;  4EQ1 A;  2J3T D;  4RVA A;  2XFS A;  3H82 A;  4OPR A;  5HAR A;  3L9K A;  2W0N A;  1KOU A;  1LL5 A;  2Y2L A;  3UB7 A;  1H8Y A;  4JXW A;  4B4X A;  5EM1 A;  3TG9 A;  4ME4 A;  4IED A;  4S2N A;  3V67 A;  1N9N A;  3DWK A;  4HI4 A;  4CLC D;  4LCM A;  3N8R A;  2C6W B;  3E0Y A;  1GHM A;  5EVI C;  4OON A;  4CLC E;  4HJ4 A;  3G2Y A;  3A0R A;  3UNW A;  1VEU B;  4YFM A;  5DF9 A;  4P6B A;  3A3I A;  2VV8 A;  3C8C A;  3WRT A;  5A90 A;  3BFC A;  1FR1 A;  4WBG A;  4Y7P A;  1RCJ A;  3A3F A;  2EFX A;  4R0Q A;  1FCO A;  1L2S A;  5KSC A;  4NET A;  3BFF A;  1CQA A;  5F68 A;  1SKO B;  5EFW A;  2HPB A;  5FDS A;  4JGQ A;  2ZC6 B;  3LIF A;  2EWV A;  1XGJ A;  3IWQ A;  4LGW A;  5IHV A;  2ZD8 A;  5FI2 A;  4OPQ A;  4JGO A;  2Y2P A;  1CJF A;  3ITB A;  3FZC A;  1T1A A;  3O3V A;  4E3K A;  2VX8 A;  5GL9 A;  3NC8 A;  1PW8 A;  2GJ3 A;  4HY8 A;  1VEU A;  3UPN A;  3OC2 A;  3LI9 A;  2V8C A;  5A92 A;  2PBY A;  5EVL A;  4GDB A;  3OLO A;  1KGE A;  2JCH A;  3VE4 A;  5IT5 A;  4JF5 A;  4I38 A;  1IFQ A;  4RYE A;  4BL2 A;  4KG5 A;  1E25 A;  2XA7 S;  2Q9N A;  1HTZ A;  2P74 A;  3BY8 A;  1SKO A;  4HES A;  2Y79 A;  1YLJ A;  3UB8 A;  2A3U A;  1ZHH B;  5HPI A;  4X55 A;  5GLA A;  2VK3 A;  4GS9 B;  1IEL A;  5HAP A;  4GN2 A;  2FFY A;  4HP9 A;  2B18 A;  3W8K A;  2PR5 A;  2WGV A;  1V9Y A;  1IYP A;  4XXR A;  2D01 A;  3B33 A;  2Y8H A;  4E3J A;  1MY8 A;  1YLZ A;  3F1O A;  3PTE A;  1JWP A;  4BLM A;  1FCM A;  1JTG A;  4MMN A;  2PU2 A;  4EXO A;  3HRE A;  5M18 A;  3FKV A;  3LIB A;  3VOL A;  2XLN A;  3VFH A;  1K56 A;  5FQ9 A;  3IT9 A;  1FCN A;  4NXG A;  4Z1W A;  2ZOH A;  2V1Z A;  2WKI A;  3IHA A;  1LHY A;  4NXB A;  1F2K A;  1AXB A;  1STZ A;  2FH5 A;  1L0G A;  4BBT A;  4UQI S;  3C5A A;  1OJG A;  1WYC A;  2Q9M A;  2HV1 A;  1IYQ A;  4OKP A;  3TW8 A;  2NUT C;  2WKQ A;  4LV1 A;  2AVX A;  3MQQ A;  3BW6 A;  3IX8 A;  3KYE A;  3HUM A;  4NKP A;  4GS9 A;  3GDI A;  4R3J A;  3CWF A;  1S4R A;  2Y55 A;  1N4O A;  3MKE A;  1FSY A;  2JN7 A;  1UWP X;  3NBL A;  2R9W A;  3C7V A;  2W1R A;  4PM8 A;  3E2L A;  4DE3 A;  1XKZ A;  3PBO A;  4HHD A;  4N1X A;  1XJ2 A;  5IU1 A;  3VP1 A;  2GZA A;  3E4P A;  4M4X A;  3T4J A;  3ZNY A;  4EU0 A;  3PBR A;  4QD4 A;  4CJN A;  4HH2 A;  2HJE A;  4KUO A;  3S22 A;  4E04 A;  1DRM A;  1OTD A;  2OWH A;  2ZC3 B;  3IXH A;  2ZM0 A;  3Q07 A;  2VV6 A;  1ZKJ A;  1MKI A;  3VP3 A;  2J9O A;  3P7N A;  2ZJ9 A;  2WZZ A;  3NHQ A;  1ES3 A;  5EOO A;  3SS3 A;  1W8Y A;  4C6Y A;  3PHY A;  4MBK A;  5DTT A;  1NY0 A;  4IJG A;  3RXW A;  3WS2 A;  3RH8 B;  3LUQ A;  5TJJ A;  3PBS A;  3JYI A;  1X0O A;  2QJ5 A;  5HWT A;  1ODV A;  3IWI A;  1KDW A;  1K57 A;  2R9X A;  1F98 A;  2EXA A;  1Z6F A;  4HJ6 A;  1EW0 A;  5F1F A;  5FAS A;  4U0X A;  5AQ7 A;  2B95 A;  3IH9 A;  2UV0 E;  2HDU A;  1PNE A;  1MXO A;  3WS4 A;  4JF4 A;  1GCE A;  5E2E A;  5F5Y A;  4Y0O A;  4P0M A;  2EX8 A;  2XH9 A;  5FQM A;  1GSW A;  3HVF A;  4FSF A;  1FOF A;  1MWU A;  2EA9 A;  3SH9 A;  1MZU A;  4YWZ A;  3HBR A;  3ZNT A;  2XF3 A;  1IKI A;  4S2I A;  3VMA A;  2V8F A;  2WAE A;  1WYB A;  4E3M A;  1JNU A;  5HAQ A;  2OV5 A;  3T4K A;  3BLM A;  1Y54 A;  2QKP A;  3A3J A;  4BL3 A;  5EV0 A;  2W3D A;  1PIO A;  3BEC A;  4DRT A;  3LEZ A;  1TD5 A;  2ZQ7 A;  3WS1 A;  3UMD A;  5CHJ A;  4LPZ A;  3IQA A;  4YNR A;  3SS4 A;  5AQ9 A;  1BTL A;  3LY4 A;  4IBR A;  3DTK A;  3KX0 X;  5CTN A;  4BEN A;  4KZ6 A;  3LR5 A;  2Y2O A;  3C2W A;  4M3K A;  5CHM A;  3V3S A;  3RJU A;  1YAX A;  4DXC A;  4QB8 A;  4B93 A;  3CG5 A;  1BUE A;  4KG6 A;  3K3C A;  4DDY A;  1TS8 A;  4DE1 A;  1PWC A;  4S2O A;  1NJ4 A;  1K55 A;  5CTM A;  3BEB A;  4ETX A;  3KSF A;  1IEM A;  3Q7Z A;  3CLO A;  1HD8 A;  4N92 A;  2HP9 A;  4JPM A;  3B47 A;  2QPN A;  3T4S A;  4PM5 A;  3DBA A;  5CEC A;  1VB6 A;  2EXB A;  2CMN A;  4IUH A;  2X02 A;  4JBF A;  4LEN A;  4L0L A;  4IUK A;  1ZG4 A;  1PZO A;  3OCN A;  4DXB A;  3MJQ A;  3QNC A;  1MKM A;  4E6X A;  2X01 A;  3T1X A;  5FQJ A;  4I3A A;  3LYX A;  1OT6 A;  4B88 A;  4KZB A;  3N7W A;  1IOU A;  5GHX A;  3ZG7 B;  4S2P A;  5KSH A;  3IBR A;  5EM0 A;  2KDK A;  5TBM B;  4G3V A;  5DKK A;  4DE2 A;  1ALQ A;  3UB5 P;  4U3T A;  3O87 A;  1P9R A;  5D3O A;  2INW A;  5J3W A;  2HDR A;  3ITA A;  2HZ5 A;  4FH4 A;  1G28 A;  5EVI D;  3LGO A;  1W7F A;  1YKD A;  1W63 Q;  4DMZ A;  2EFU A;  1UWN X;  2BAS A;  3LCE A;  1TEM A;  1VET B;  1CI9 A;  2A24 B;  3CI6 A;  3W4O A;  3SS5 A;  3Q7V B;  1YLT A;  1NYY A;  5GLB A;  4WEL A;  5HD3 A;  4OP8 A;  5FQK A;  4EEU A;  1AWI A;  2G7U A;  4EET B;  1I2S A;  1H8Z A;  3NDG A;  5M1A A;  1YT4 A;  1T19 A;  4X1L A;  3F1N B;  1ONG A;  1BLC A;  3B42 A;  1K54 A;  4I3I A;  4UA9 A;  3V3R A;  3H82 B;  3ULF A;  5TBM A;  1YLY A;  1GA9 A;  4R3B A;  3ZFZ A;  4QJG A;  2FZ0 A;  3GTC A;  3KYQ A;  4WMC A;  4R23 A;  3DTI A;  5HDC A;  3BWL A;  3RTY A;  3IF6 C;  4MN6 A;  5JYO A;  2YKF A;  2Y2M A;  3MS6 A;  3TOI A;  1KGF A;  1VET A;  4KG2 A;  4KQR A;  4I5S A;  3EQV A;  5I5L A;  1K6R A;  3Q7V A;  1ACF A;  1RGZ A;  2IWC A;  1KE4 A;  4KZ7 A;  2HP6 A;  1XA1 A;  1L0D A;  5E2H A;  5DTS A;  3MXS A;  5JYP A;  1C3B A;  4RA7 A;  3ZDJ A;  5E43 A;  4JGR A;  1PRQ A;  3FG8 A;  2E8J A;  3FYZ A;  5HL6 A;  2WGI A;  3EOI A;  3DTM A;  3UPP A;  4JKT A;  4B9O A;  2K2N A;  4OH0 A;  1XGI A;  3F1N A;  3PXP A;  1T1C A;  4GD6 A;  1V9Z A;  4PM7 A;  1IYO A;  2KOI A;  3MFX A;  3S1Y A;  2QZ6 A;  1NZU A;  1JWZ A;  4U0T A;  2XD5 A;  5F83 A;  3MKF A;  5G4Y A;  4DF6 A;  2ZQ8 A;  2JKR M;  4YOF A;  5DKL A;  4Z9Q A;  3IBJ A;  1HLU P;  3R4K A;  1SCW A;  2ZM8 A;  2GX5 A;  4P85 A;  4UEY A;  1QMF A;  3LR0 A;  4A5R A;  4P6Z M;  5GLD A;  2P08 A;  1SZV A;  1HVB A;  5FQQ A;  5CER A;  3ZG8 B;  5GHY A;  1PFL A;  1PWG A;  2I72 A;  4OPZ A;  1NXY A;  2OWJ A;  4EER A;  3IH8 A;  3PBT A;  4GCZ A;  1YPR A;  1NRF A;  3NOU C;  4NK3 A;  4CLC B;  2P04 A;  4PAU A;  3D72 A;  3A3E A;  1Y4O A;  4G3W A;  4HEF A;  4BJP A;  3WS5 A;  4Y0U A;  5HSQ A;  2O9A A;  4Q0I A;  1ESU A;  5F69 A;  1NLZ A;  5AJG A;  3ZG0 A;  3NOP C;  4KZ9 A;  4KZ8 A;  3PR6 A;  4S2N C;  2ZLY A;  5FI7 A;  3LEQ A;  2IWB A;  5CGS A;  3EEA A;  3M6B A;  1N9L A;  2Y59 A;  3CIT A;  5FDH A;  2WYX A;  3F1O B;  3IWO A;  3T4O A;  1NYM A;  2V0W A;  3TRC A;  1YMX A;  1K6S A;  5KZH A;  4QHC A;  3K2N A;  1GHP A;  3T50 A;  5DJU A;  4DN0 A;  3IS2 B;  1TS7 A;  2ZQC A;  1GHI A;  4XUZ A;  4WLA A;  4CLC A;  3BQA A;  3T1S A;  1J3W A;  3OPH A;  1QME A;  1XXM A;  2XD1 A;  4KZ5 A;  4FTX A;  3VOZ A;  5J7E A;  3FC7 A;  4WZ5 A;  3LR4 A;  4E3N A;  4CQH A;  3R7W B;  1DP6 A;  3MSH A;  4NEE D;  4WUJ A;  3BRM A;  3IHB A;  2DRW A;  2PAV P;  3KSG A;  2ZL1 B;  4EBP A;  3P09 A;  2BTF P;  5CGX A;  4I39 A;  1LL9 A;  4O01 A;  4ETZ A;  1H3Q A;  3G2Z A;  5L8M A;  1Z09 A;  4BD0 A;  2Y2Q A;  1O07 A;  3IS2 A;  5GHZ A;  1YM1 A;  2QHK A;  4C3Q A;  1IKG A; 
#chains in the Genus database with same CATH homology
 4X25 A;  1VET A;  3T1X A;  2JKF A;  2V8C A;  1ACF A;  3L9K A;  3LEQ A;  2V8F A;  5EM0 A;  2PBD P;  3NUL A;  5EM1 A;  3D9Y A;  1PRQ A;  2E8J A;  3UB5 P;  5FEG A;  5EV0 A;  1SKO A;  3CPT B;  4X1M A;  2HZ5 A;  2ZL1 A;  3LGO A;  2JKG A;  3U4L P;  2VK3 A;  1VEU B;  4FUW A;  3T12 B;  1VET B;  1K0K A;  1G5U A;  3T1S A;  1J3W A;  1A0K A;  4QWO A;  4FTX A;  1AWI A;  5FEF A;  1FIK A;  1CQA A;  1SZV A;  3MSH A;  4X1L A;  1SKO B;  5FDS A;  3DAV A;  3NEC A;  2PAV P;  1F2K A;  3L7H A;  3T1R A;  2PRF A;  1PFL A;  4D60 A;  3CHW P;  2ZL1 B;  1YPR A;  2BTF P;  1FIL A;  1D1J A;  1CF0 A;  1CJF A;  3T1Q B;  2B95 A;  5EVE A;  1Z09 A;  3CPT A;  1PNE A;  2ACG A;  1Y4O A;  3KYE A;  3MS6 A;  1VEU A;  1HLU P;  4ESP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...