1VEUB

Crystal structure of the p14/mp1 complex at 2.15 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'GMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
molecule tags Signaling protein/protein binding
source organism Mus musculus
publication title Crystal structure of the p14/MP1 scaffolding complex: How a twin couple attaches mitogen- activated protein kinase signaling to late endosomes
pubmed doi rcsb
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1veuB00
3T1QB 4FTXA 1YPRA 4QWOA 1J3WA 3LEQA 1HLUP 5FDSA 2PBDP 3L7HA 5EV0A 1ACFA 3T12B 1VEUA 3T1SA 3L9KA 4X1MA 1PNEA 1SZVA 2VK3A 3KYEA 4ESPA 3T1XA 1SKOB 2PAVP 3DAVA 1Y4OA 3D9YA 1CQAA 4X25A 1K0KA 4D60A 1G5UA 1CJFA 1VETA 2BTFP 4FUWA 1CF0A 5EVEA 2PRFA 1D1JA 3U4LP 5FEGA 1PRQA 3CPTB 2JKFA 1VEUB 2ZL1A 1FILA 2B95A 2JKGA 3MS6A 5EM0A 5EM1A 1VETB 2ACGA 2V8CA 3T1RA 3CHWP 1PFLA 3MSHA 4X1LA 2E8JA 1SKOA 3NULA 3UB5P 1AWIA 1A0KA 1F2KA 2HZ5A 5FEFA 2V8FA 1Z09A 2ZL1B 3LGOA 3NECA 3CPTA 1FIKA
chains in the Genus database with same CATH superfamily
1ES5A 5FDHA 4NXBA 2B5RA 1IFQA 3CAXA 4MDZA 4CLCE 2DCFA 2HP5A 3Q07A 3IF6A 4RX2A 3ZNTA 2KDKA 4Y0TA 2HP9A 3CPTA 5FI7A 5HL6A 1NLZA 1JTDA 1ES4A 4KZ6A 4I3JA 5HX9A 1XA1A 2X02A 3WS2A 2W27A 3S1YA 3P98A 1FQGA 1W63M 1YT4A 4OPQA 3T4OA 2YKHA 3BFGA 1TVFA 4MEZA 2ZQDA 4DXBA 3G35A 4JGQA 3NI9A 2VV6A 4UA6A 3LCEA 3RTYA 2Y2HA 3C2WA 2WKQA 3IHBA 1YLYA 2A24A 1L0EA 5KZHA 1PZPA 4QD4A 2E8JA 2WAEA 3LY3A 4CPKA 1Y28A 2Q9MA 1KDSA 3G30A 1HLUP 4WLAA 3IXBA 2WKRA 3F1NB 1MKMA 5D3OA 4ESPA 5AVFA 2Y59A 4B9OA 3KYZA 2JHEA 1L3LA 2ZMVA 3LFVA 1H5XA 2WGWB 1F5MA 2OOLA 1OJGA 1S67L 3IX4A 4Y7PA 1XX2A 1S0WA 2ZL1B 2VJWA 3C7UA 4R4SA 4I38A 4EETB 3BQAA 5KSCA 5FDSA 2R9WA 4EESA 4U3TA 2IWDA 4KG2A 4PM9A 3R7WB 4IHQA 2G7UA 3WS0A 1YLJA 3H82B 3Q7ZA 1ES2A 4DDSA 5DF9A 3E4PA 1UGUA 3B42A 3C38A 2L4RA 3VP4A 2X01A 1IYPA 3VFFA 2EWVA 1TS8A 3NCKA 4C3QA 2K31A 1E3UA 1GA9A 5IHVA 3CWFA 2WK0A 1NZOA 2AVXA 4LV3A 1H0MA 3MQQA 4N92A 2DMWA 4GNUA 1MWUA 3VOYA 4ZDXA 4LRXC 1RCJA 3GR2A 5J7EA 5DTKA 4BJPA 2HF6A 4O0PA 5EVEA 1S1ZA 4RQ9A 2H0YA 3ZG0A 3PR6A 3MS6A 5CHUA 3KYQA 5DF8A 4HP4A 4PPRA 1NXYA 1N9OA 4P85A 5CX7A 3MR0A 2K2NA 3VSLA 5IS1A 4II7A 2VX8A 2ZOIA 1J3WA 3JYIA 4OLDA 4QU3A 1NJ4A 1GHIA 4GJ4A 4R4RA 1ALQA 4IBRA 3D9YA 1MPLA 1W63Q 1BTLA 3IWQA 3KSIA 1YSPA 1MBLA 3PBTA 4BBVA 2A24B 1PW1A 3HVFA 1WA9A 4DXCA 3UE6A 2ZQ9A 1LSVA 2KOIA 4YOFA 3UDXA 3L9KA 1V9YA 1E4DA 1SKOB 4IUKA 4FOFA 3VOLA 3A0SA 3PXPA 4HJ6A 3BWLA 4OP5A 1V9ZA 2D01A 4H8RA 4DE2A 2PR5A 3OLOA 1M40A 3FV7A 2ZC6B 4EU0A 2NUPC 1HD8A 1K57C 5E2HA 2VGJA 2XEPA 3ZQ5A 3EQVA 4MN5A 4X69A 4EUZA 5HAPA 3BJNA 3O87A 4WZ5A 3UDFA 4DKIA 4BL3A 2JC7A 2J8YA 3E2KA 4R23A 3LR3A 1KE4A 3OZHA 5JYOA 3RJUA 2PU4A 3MFDA 5HDCA 2MJ6A 1MXOA 1YKDA 1ZG6A 4WF0A 4LENA 5EOOA 1SCWA 4BL2A 3P01A 3LR0A 2ZC4B 4KQRA 1U60A 4WELA 1XJ2A 2A2LA 5GLBA 1YAXA 3G2ZA 4R0QA 3KO6A 4JF5A 4WUJA 5G18A 2GDNA 2WKIA 3TRCA 4C6YA 2OLUA 2O0YA 4L9FA 4N1XA 4EBPA 5FASA 3G31A 1L0DA 2HDQA 2Y2MA 1LL9A 2IWCA 1BULA 2HZ5A 1FIKA 4XUZA 3C4PA 4UA7A 3A3EA 1ZTUA 1RGZA 3DW0A 3M6HA 1WYCA 4MN6A 3PAGA 5CHMA 2G2UA 4OQHA 1CI8A 2P7JA 2W3DA 1EI5A 4LPZA 2ZQCA 2V20A 1BT5A 2QWSA 5CGWA 3JVUA 1XFQA 1XGJA 2JE5A 3GMWA 1FCOA 3F1PB 5EFWA 1MWRA 3NY4A 3HLEA 3FG8A 1OJ5A 2W1RA 3VE3A 4BENA 3UB7A 4GCZA 4X25A 3HREA 1G68A 2H10A 1KVMA 2FFYA 2V0UA 1FCMA 3DTEA 3MXRA 2A49A 5KMWA 4LCMA 1Q2QA 2EXBA 2J80A 1H8MA 1CEFA 5FQMA 2WUQA 4LRZE 2JKTI 3U2AA 5EOEA 4O7DA 2BLSA 1ONGA 3L7HA 3EGXC 2WYXA 3BFCA 5F82A 2V1AA 1YLZA 5F83A 2IA2A 3MSHA 3TW8A 5DKLA 4KG6A 1VQQA 3EEAA 1S6RA 5GHYA 3GQZA 1VB6A 5DKKA 1NYMA 3O86A 3HUMA 2QZ6A 2EX8A 4XUXA 3LICA 4OPRA 4D2OA 5E2FA 4QY5A 1N9BA 2J9OA 4RX3A 4Y17A 1LI9A 1IYOA 1K56D 5HD5A 3LUQA 3QP4A 1ZG4A 3C30A 4PKYG 3QP6A 3A0RA 1DY6A 1JWVA 3WWXA 1QMEA 3MZEA 1Z6FA 1H8ZA 3EWKA 1SZVA 1T1AA 1NZUA 4D60A 3S7OA 5A91A 2XSSA 1QMFA 4HOIA 1T18A 2VEAA 2W3GA 4XT2A 4R1GA 3H7WB 1CI9A 2Z6CA 3AGDA 1HZOA 4X68A 2XR0A 3A3JA 5FI6A 2OAQ1 1DJCA 4E3NA 3OPLA 3RXXA 3HJKA 4E3OA 1K0KA 4EV4A 1G5UA 1VETA 3E2LA 4RVAA 5FATA 3QP8A 4ZJ2A 3ZG8B 3CG5A 1YMXA 5DTSA 3G4PA 4BQMA 3P09A 3SS3A 3W4QA 1K25A 1UWPX 5CXWA 5HZHA 2WADA 1DJAA 3PHYA 3OPPA 2XH9A 4JPMA 3PYPA 1IYSA 4G3WA 3PAEA 4YWZA 4S2NC 3GSGA 3NBLA 2B18A 5LBRA 4OLGA 1MC0A 3IHAA 2INWA 3OCNA 4KUKA 5E2EA 4WZ5C 1OT9A 1LSXA 4E3LA 1FSWA 2PD7A 4OQIA 2J9PA 1STZA 2WZZA 3FKWA 2QJ7A 3N8LA 5EM1A 4PM6A 3CHWP 5HD3A 3ZDJA 2XD5A 2V1BA 3V67A 4QPRA 5A92A 2ZQAA 3FPWA 4ETXA 3H9WA 3IXGA 3NOTC 1WYBA 4GD8A 5DJUA 3F1OB 1Y54A 4HY8A 1W8QA 4HEFA 1FSYA 3A3FA 2C5WB 4MNRA 4M3KA 2QMIA 5HPFA 3NC8A 3UB5P 1PWDA 3LYXA 3ZCZA 4MMNA 1K56A 4I3AA 5EVIB 3VP3A 1S4SA 1K38A 2JKRM 4EERA 4B93A 4NK3A 3IH9A 3MF0A 2HJEA 3V39A 4EWFA 4L9EA 4I39A 3T4LA 1K55C 5L10A 4ZJ3A 4PM7A 5F1GA 3IS2A 3WRTA 3GECA 3OBFA 4S2IA 3GTCA 3IS2B 4S2LA 3A0VA 4DDYA 2VGLS 4P6ZS 2DRWA 3LIEA 4FH2A 2ZL1A 4JXWA 2XFTA 3K3CA 5FEFA 2DNSA 4JXSA 3HJIA 4IJGA 4HBTA 5FAOA 3LEZA 4PM8A 5MC7A 3UN7A 4S2OA 5FQ9A 3O5YA 4KZAA 3KSFA 1GHMA 3D72A 5L09A 2XA7S 4X1LA 5CRFA 3ISGA 1YSQA 5TGFA 4FTXA 1K54A 1LHYA 4WEJA 5GHXA 1XJ4A 3CLOA 3V3SA 2BG1A 3LR5A 2BASA 2L1MA 3IF6B 3OC2A 4WL9A 4FD8A 1FOFA 5FQIA 4EEPA 5M19A 1ESUA 1PIOA 3CMZA 2P9VA 3S7NA 4HIAA 2PYRA 1I2SA 2EFXA 2XROA 1F98A 3R7WA 4EQ1A 5HSQA 1YLPA 3T12B 4GB7A 5FAQA 2CC1A 4O01A 1GA0A 4KZ4A 4HHDA 2PAVP 4CJNA 2OV5A 5E43A 1MY8A 2VGLM 1NRJA 1LL8A 1CF0A 3NHQA 1PRQA 3T50A 4OOMA 2P08A 1OTIA 4DE0A 3Q1FA 2PD8A 2JBFA 4MCWA 4P87A 3N7WA 2NUTC 3LR4A 5C5KA 4E3JA 4EBLA 1F9IA 5GLAA 3DBAA 2ZQ8A 2Z2MB 3WS1A 4G3KA 3G34A 4ID4A 4ZJ1A 1BZAA 2ZM2A 4R38A 4ARZA 4NEED 1K6SA 5DVAA 4A5RA 1BYWA 4R3JA 2Y79A 1XXMA 2A3UA 3LEQA 3UO9A 4BBTA 1NRFA 1ZKJA 2M1CA 2WGWA 3CJMA 2W0NA 3IQAA 3JVVA 5FAPA 3VP0A 5AVEA 3IT9A 3HCYA 4E04A 1NLYA 4UAAA 5IU1A 4ZRRA 1SKOA 4HJ4A 1ERQA 4Y3IA 3A3IA 2WKHA 2LB5A 2WGIA 4GS9A 4E3KA 1TS7A 4NG2A 3S7QA 1TEMA 1N4OA 1TS6A 3W2ZA 2XFSA 3T4TA 3ICYA 1RGYA 4WZ4A 1G28A 5BOHA 3IX3A 1BLCA 1S1YA 2Y2QA 1DP6A 2EX6A 3E98A 3T4KA 4R3BA 3UE1A 5HDSA 1UWNX 4B4XA 1K4EA 2VV8A 3M2JA 2ZJ9A 3IH8A 1X0OA 3MJQA 3SH7A 1DRMA 2CMNA 3G32A 5J8XA 5TFQA 4OVDA 5TJJA 3SH9A 4IUHA 4Y13A 4S2NA 3ZG9B 4U0XA 1P9RA 3TE8A 3FKVA 1GSXA 3UB6A 3VV4A 3V3RA 4OOLA 1G6AA 4FSFA 3LO7A 1EWZA 3MXQA 5AJGA 1HVBA 3WS4A 1MKIA 2HDSA 2JN7A 3C5AA 2Y2JA 1GCEA 1W7FA 4WMCA 2QHKA 2W1TB 3LI8A 1TD5A 4E6XA 4ZBEA 3IF5A 3D4FA 5J4EA 3SZTA 4QHCA 3UPNA 2WKPA 2BTFP 3U4LP 3T1QB 4F94A 4PKYA 3R4KA 3C7VA 2VLGA 3A3DA 2ZOHA 2EX9A 3MBZA 4I5SA 3Q7VA 3MQ0A 2RCXA 4MLLA 2RL3A 2ZM0A 5F1FA 4HH2A 1ES3A 2WZXA 3EQUA 5DTTA 5HWWA 5F6AA 2FZ0A 1BLPA 2OAP1 2Y8HA 4QB8A 2VA0A 2EFUA 2IWBA 4PHTA 5TBMB 3UNWA 1DP8A 4WM9A 1I2WA 3IWIA 2GX5A 4NETA 3IBJA 4ETZA 5CEBA 1ONHA 3LIAA 3MZDA 4QY6A 2ZC7A 3N8RA 5A90A 4GN2A 2HV1A 5AQ7A 3V50A 3HL9A 3VP1A 3T1SA 1OTDA 3KYEA 4B88A 3LIBA 4JF6A 2EX2A 4Q0IA 3DWKA 1VHMA 3N4IA 3ZVWA 3MMHA 4U0TA 3IWOA 1NY0A 1K55A 4F3LB 5HAQA 3OOVA 3TJZC 4PAUA 2XGNA 4HNBA 3BW6A 2ACGA 3E4OA 3WS5A 1PW8A 3MKEA 2M7UA 2R9XA 1S4RA 3FYZA 5GHZA 4HI4A 2V9AA 3NIAA 3C8CA 5AQAA 5DF7A 1BSGA 4FCFA 2G2WA 4NKPA 3JPUA 1TF1A 2ZM8A 1FILA 3NJAA 3O88A 4R6LA 3QNBA 4DJ3A 3QP1A 1PWCA 4K0XA 5HL1A 1BLHA 2V8FA 3VSKA 1P97A 2ZMFA 1XGIA 1E3UD 3UE3A 4KZBA 3EGDC 1VEUA 1XPBA 2XF3A 3HLDA 1EROA 2GNXA 4H6JB 1JNUA 4UHUA 2KX6A 4OQ0A 1YM1A 4BWIA 3RXWA 2W3FA 1KDWA 3ZNYA 1F2KA 2PHYA 1OTAA 4WMCD 4Y0OA 5HDDA 5EECA 3N8SA 4S2PA 5DFXA 3UB9A 3DAVA 2Q0OA 5TBMA 3D3OA 1E25A 4H6JA 3HLWA 2PRFA 3KSHA 4ZAMA 1OPXA 2M7VA 4PM5A 2Y91A 4OQGA 5CGSA 1KGFA 1K57A 2FH5A 1XJ3A 4Y15A 1CQAA 5E2GA 2E8IA 3S22A 4OKPA 1KVLA 1JWPA 1VM1A 3HUOA 3ITAA 3I7JA 4OPYA 4WEKA 4L9GA 3UY6A 3B3XA 1PYYA 2OWHA 2JKGA 3G6OA 5EVIC 4BD0A 2W3HA 1K6RA 3IXHA 3F1OA 3FPVA 1T19A 3HUNA 1YLWA 3O3VA 4GW9A 2VGKA 3CZDA 1W8YA 3LIDA 3T4QA 3H7WA 3PBOA 3ZGAB 4GOGA 2OSUA 2LB9A 2V0WA 4HH3A 1BLSA 3Q82A 5J3WA 1ODVA 3BM6A 1ESIA 2J3WA 2Z6DA 3FWLA 2O99A 3Q81A 3TSGA 5G4ZA 4NXGA 1P0ZA 1M6KA 1D7EA 4JGRA 1YQSA 1VEUB 3MKFA 4LV1A 1BUEA 3OCLA 1SKFA 1AWIA 1Z09A 4M4XA 4CLCA 3LGOA 1RP5A 3VP2A 5FQJA 4OPZA 4LRYC 4KUOA 5DJTA 4Z9QA 2I9VA 2FFFB 3BRMA 4LCLA 2QKPA 3SS5A 2ZC3B 2R78A 1CK3A 3QNCA 3VOZA 2OWJA 3P7NA 1KOUA 5G4YA 4BD1A 5I94A 2PBYA 5KSHA 3DWZA 1Y4OA 2P04A 3BECA 2O9BA 4X56A 4GKUA 1OT6A 4KQQA 1SDNA 4WN5A 3VMAA 2ZLYA 4WBGA 2XRNA 2PT7A 3MXSA 3PBSA 2H0TA 2PBDP 3PBNA 2HGVA 2W3EA 4JBFA 2J7VA 1GHPA 5GLCA 3CPTB 3MFXA 4CLCC 4UQIM 1PFLA 3ZG5A 3BLMA 2I72A 4P0MA 1IYQA 2HPBA 4LLOB 4GDNA 2XA7M 5EV0A 4Q0JA 1ACFA 2H28A 3BFEA 5CGXA 5L8MA 2C6WB 4DRTA 3V5MA 3GDIA 1I5QA 5CERA 1S66L 3F1NA 2ZC5B 1KE3A 2K7SA 3OPRA 1NWZA 1H8YA 2Y2LA 2ZMAA 3K3DA 1JTGA 1TDGA 1DJBA 4DMZA 3PTEA 4E3MA 4X55A 4KQDA 4EQIA 4KG5A 4IVKA 1P9WA 1FCNA 3NDGA 2JKRI 3PBQA 1O07A 5L07A 4DE1A 4DE3A 3B33A 1HTZA 4LFUA 5A8BA 1EW0A 2XDMA 5M1AA 4R3AA 3BYDA 4JXGA 3M6BA 2Z2LB 2PYPA 4EUVA 4CLCB 5HPIA 2Y4AA 2Y2GA 5FEGA 4GS9B 5F68A 4LV0A 2HJ9C 2WAFA 3QP5A 3FZCA 1L0GA 1YPRA 5CHJA 3LI9A 4ME4A 1N9NA 1WE4A 4I3IA 1LI0A 5U47A 2VZWA 2B95A 3S4XA 4MN7A 1OMEA 3IX8A 1NYYA 1XP4A 2KLIA 2Y2PA 4PMAA 2HDUA 1TS0A 3H82A 3VFHA 1PZOA 4O8GA 1KE0A 1J9MA 4E3IA 1ZHHB 3ZYTA 3ZHHA 4ARZB 3LY4A 3GRJA 4R70A 1JVJA 3CUEC 1MWTA 4JLFA 3KSGA 1XKZA 3TG9A 5DFYA 3BFDA 3UPPA 3DTIA 4Y2FA 3Q7VB 2B02A 4GD6A 5F69A 1KGGA 3LIFA 4RYEA 1C3BA 3RFBA 1L0FA 1XFNA 3DTMA 3E0YA 1JWZA 4S2JA 2O9CA 2UWXA 3FC7A 3NOPC 1O7EA 1AXBA 5AQ9A 4C75A 2JCHA 2Y55A 2PR6A 2P74A 1LLBA 2ZBBA 3BFFA 1CJFA 4X6TA 4ZTKA 5CTMA 5KIZA 4AFIA 3BQ8A 2H5SA 2L0WA 2Q9NA 4IBXA 3WRZA 1ZC2A 4QJGA 1OTEA 4YINA 2XK1A 3T4JA 3HBRA 3F1PA 1H3QA 5CECA 5FI2A 2VK3A 4HBUA 4NXFA 1GSVA 3QP2A 3S7PA 3ZG7B 1D1JA 3NOUC 4F3LA 1PI4A 1IKGA 3BY9A 3QHYA 3NULA 3VE4A 4EW7A 1OTBA 1GSWA 1K4FA 4KZ5A 3UPOA 1TDLA 1PI5A 3MZFA 4HESA 4FH4A 2V1ZA 4B4ZA 4LGWA 1XA7A 5GL9A 5I5LA 5A93A 2OLVA 3CITA 3GV9A 1W5DA 2W1TA 2Y2NA 3UMDA 4EEUA 5FQKA 3HLBA 5IT5A 5HARA 4NXEA 4S2KA 3N6IA 1PNEA 2Y2IA 2ZD8A 5FA7A 3UB8A 4XT2B 4IEDA 1SHVA 4BMWA 3IF6C 4KZ3A 4XXRA 4OOYA 1IKIA 4UEYA 4E6WA 3SW1A 3HLFA 4KQOA 4JGOA 4K91A 2Y2KA 2WKEA 3DTKA 4BBUA 4UQIS 5EUAA 4Q8IA 5L2FA 2EXAA 5HW3A 3ZFZA 4YNRA 1K54C 4X53A 4GDBA 5JYPA 4S2MA 2VKSA 4KENB 5M18A 5HAIA 1IEMA 3SH8A 5AQBA 3M2KA 2O9AA 3IBRA 1D06A 1LSWA 1YLTA 3CI6A 1KGEA 1XJ6A 2ZQ7A 4P6ZM 1ERMA 4GLQA 5EVLA 3W4PA 4IVIA 3TOIA 1L2SA 1G6OA 3SS4A 4G3VA 4HP9A 4OP8A 1VETB 2JKTM 3G2YA 4KZ7A 5CTNA 4CLCD 1PWGA 3UE0A 4GHIB 4UA9A 4EXOA 3PBRA 4FUWA 5CEDA 3KX0X 1MZUA 1FR1A 4GHIA 2PU2A 5EVID 2UV0E 4GZBA 4JKTA 3E4QA 1SDEA 4Y0UA 3EOIA 4KZ9A 4CQHA 3UMEA 1T1BA 4JGPA 3UDIA 4KZ8A 2X71A 2GJ3A 5EPHA 2EA9A 2PDRA 2QYBA 3T1RA 5HWTA 3SOIA 2XD1A 2VV7A 5TR7A 2WGVA 5GLDA 3NECA 3ZVTA 3BY8A 2EWWA 3B47A 5EVIA 3T1XA 4K0WA 1W79A 4MBKA 4DF6A 4N9KA 4N1HA 3RH8B 3T4SA 3MQOA 2JKFA 5FL3A 4K08A 4Z1WA 2QJ5A 4DN0A 1IOUA 2XQZA 3C4OA 4QWOA 3GVBA 2D02A 3AGFA 3HLGA 4BLMA 2QPNA 2XLNA 2HP6A 1T1CA 3ULFA 3NDEA 4OH0A 4EBNA 5FSRA 5F5YA 3K2NA 3BLSA 4MBHA 3CUEA 1FR6A 4WYYA 5HFOA 3ITBA 4JF4A 4DJ2A 4N9LA 4MBFA 1CEGA 4Y5FA 5HWVA 5FQQA 5EE8A 2Y2OA 1IELA 4HJ3A 2V2FF 2YKFA 3OPHA 4RA7A 1YMSA 3IXDA 1N9LA 1DP9A 5EM0A 2J3TD 3HLCA 2V8CA 1MWSA 1Q2PA 2J3TC 4OONA 2GZAA 4YFMA 4Q0HA 3W4OA 3BEBA 3EEHA 4X1MA 4L0LA 4LV2A 4JXVA 1LT0A 3W8KA 1LL5A 5K5BA 2HDRA 1A0KA 4P6BA 4HQAA 3AGEA 2P9VB
chains in the Genus database with same CATH topology
3T1QB 4FTXA 1YPRA 4QWOA 1J3WA 3LEQA 1HLUP 5FDSA 2PBDP 3L7HA 5EV0A 1ACFA 3T12B 1VEUA 3T1SA 3L9KA 4X1MA 1PNEA 1SZVA 2VK3A 3KYEA 4ESPA 3T1XA 1SKOB 2PAVP 3DAVA 1Y4OA 3D9YA 1CQAA 4X25A 1K0KA 4D60A 1G5UA 1CJFA 1VETA 2BTFP 4FUWA 1CF0A 5EVEA 2PRFA 1D1JA 3U4LP 5FEGA 1PRQA 3CPTB 2JKFA 1VEUB 2ZL1A 1FILA 2B95A 2JKGA 3MS6A 5EM0A 5EM1A 1VETB 2ACGA 2V8CA 3T1RA 3CHWP 1PFLA 3MSHA 4X1LA 2E8JA 1SKOA 3NULA 3UB5P 1AWIA 1A0KA 1F2KA 2HZ5A 5FEFA 2V8FA 1Z09A 2ZL1B 3LGOA 3NECA 3CPTA 1FIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Q B;  4FTX A;  1YPR A;  4QWO A;  1J3W A;  3LEQ A;  1HLU P;  5FDS A;  2PBD P;  3L7H A;  5EV0 A;  1ACF A;  3T12 B;  1VEU A;  3T1S A;  3L9K A;  4X1M A;  1PNE A;  1SZV A;  2VK3 A;  3KYE A;  4ESP A;  3T1X A;  1SKO B;  2PAV P;  3DAV A;  1Y4O A;  3D9Y A;  1CQA A;  4X25 A;  1K0K A;  4D60 A;  1G5U A;  1CJF A;  1VET A;  2BTF P;  4FUW A;  1CF0 A;  5EVE A;  2PRF A;  1D1J A;  3U4L P;  5FEG A;  1PRQ A;  3CPT B;  2JKF A;  1VEU B;  2ZL1 A;  1FIL A;  2B95 A;  2JKG A;  3MS6 A;  5EM0 A;  5EM1 A;  1VET B;  2ACG A;  2V8C A;  3T1R A;  3CHW P;  1PFL A;  3MSH A;  4X1L A;  2E8J A;  1SKO A;  3NUL A;  3UB5 P;  1AWI A;  1A0K A;  1F2K A;  2HZ5 A;  5FEF A;  2V8F A;  1Z09 A;  2ZL1 B;  3LGO A;  3NEC A;  3CPT A;  1FIK A; 
#chains in the Genus database with same CATH topology
 1ES5 A;  5FDH A;  4NXB A;  2B5R A;  1IFQ A;  3CAX A;  4MDZ A;  4CLC E;  2DCF A;  2HP5 A;  3Q07 A;  3IF6 A;  4RX2 A;  3ZNT A;  2KDK A;  4Y0T A;  2HP9 A;  3CPT A;  5FI7 A;  5HL6 A;  1NLZ A;  1JTD A;  1ES4 A;  4KZ6 A;  4I3J A;  5HX9 A;  1XA1 A;  2X02 A;  3WS2 A;  2W27 A;  3S1Y A;  3P98 A;  1FQG A;  1W63 M;  1YT4 A;  4OPQ A;  3T4O A;  2YKH A;  3BFG A;  1TVF A;  4MEZ A;  2ZQD A;  4DXB A;  3G35 A;  4JGQ A;  3NI9 A;  2VV6 A;  4UA6 A;  3LCE A;  3RTY A;  2Y2H A;  3C2W A;  2WKQ A;  3IHB A;  1YLY A;  2A24 A;  1L0E A;  5KZH A;  1PZP A;  4QD4 A;  2E8J A;  2WAE A;  3LY3 A;  4CPK A;  1Y28 A;  2Q9M A;  1KDS A;  3G30 A;  1HLU P;  4WLA A;  3IXB A;  2WKR A;  3F1N B;  1MKM A;  5D3O A;  4ESP A;  5AVF A;  2Y59 A;  4B9O A;  3KYZ A;  2JHE A;  1L3L A;  2ZMV A;  3LFV A;  1H5X A;  2WGW B;  1F5M A;  2OOL A;  1OJG A;  1S67 L;  3IX4 A;  4Y7P A;  1XX2 A;  1S0W A;  2ZL1 B;  2VJW A;  3C7U A;  4R4S A;  4I38 A;  4EET B;  3BQA A;  5KSC A;  5FDS A;  2R9W A;  4EES A;  4U3T A;  2IWD A;  4KG2 A;  4PM9 A;  3R7W B;  4IHQ A;  2G7U A;  3WS0 A;  1YLJ A;  3H82 B;  3Q7Z A;  1ES2 A;  4DDS A;  5DF9 A;  3E4P A;  1UGU A;  3B42 A;  3C38 A;  2L4R A;  3VP4 A;  2X01 A;  1IYP A;  3VFF A;  2EWV A;  1TS8 A;  3NCK A;  4C3Q A;  2K31 A;  1E3U A;  1GA9 A;  5IHV A;  3CWF A;  2WK0 A;  1NZO A;  2AVX A;  4LV3 A;  1H0M A;  3MQQ A;  4N92 A;  2DMW A;  4GNU A;  1MWU A;  3VOY A;  4ZDX A;  4LRX C;  1RCJ A;  3GR2 A;  5J7E A;  5DTK A;  4BJP A;  2HF6 A;  4O0P A;  5EVE A;  1S1Z A;  4RQ9 A;  2H0Y A;  3ZG0 A;  3PR6 A;  3MS6 A;  5CHU A;  3KYQ A;  5DF8 A;  4HP4 A;  4PPR A;  1NXY A;  1N9O A;  4P85 A;  5CX7 A;  3MR0 A;  2K2N A;  3VSL A;  5IS1 A;  4II7 A;  2VX8 A;  2ZOI A;  1J3W A;  3JYI A;  4OLD A;  4QU3 A;  1NJ4 A;  1GHI A;  4GJ4 A;  4R4R A;  1ALQ A;  4IBR A;  3D9Y A;  1MPL A;  1W63 Q;  1BTL A;  3IWQ A;  3KSI A;  1YSP A;  1MBL A;  3PBT A;  4BBV A;  2A24 B;  1PW1 A;  3HVF A;  1WA9 A;  4DXC A;  3UE6 A;  2ZQ9 A;  1LSV A;  2KOI A;  4YOF A;  3UDX A;  3L9K A;  1V9Y A;  1E4D A;  1SKO B;  4IUK A;  4FOF A;  3VOL A;  3A0S A;  3PXP A;  4HJ6 A;  3BWL A;  4OP5 A;  1V9Z A;  2D01 A;  4H8R A;  4DE2 A;  2PR5 A;  3OLO A;  1M40 A;  3FV7 A;  2ZC6 B;  4EU0 A;  2NUP C;  1HD8 A;  1K57 C;  5E2H A;  2VGJ A;  2XEP A;  3ZQ5 A;  3EQV A;  4MN5 A;  4X69 A;  4EUZ A;  5HAP A;  3BJN A;  3O87 A;  4WZ5 A;  3UDF A;  4DKI A;  4BL3 A;  2JC7 A;  2J8Y A;  3E2K A;  4R23 A;  3LR3 A;  1KE4 A;  3OZH A;  5JYO A;  3RJU A;  2PU4 A;  3MFD A;  5HDC A;  2MJ6 A;  1MXO A;  1YKD A;  1ZG6 A;  4WF0 A;  4LEN A;  5EOO A;  1SCW A;  4BL2 A;  3P01 A;  3LR0 A;  2ZC4 B;  4KQR A;  1U60 A;  4WEL A;  1XJ2 A;  2A2L A;  5GLB A;  1YAX A;  3G2Z A;  4R0Q A;  3KO6 A;  4JF5 A;  4WUJ A;  5G18 A;  2GDN A;  2WKI A;  3TRC A;  4C6Y A;  2OLU A;  2O0Y A;  4L9F A;  4N1X A;  4EBP A;  5FAS A;  3G31 A;  1L0D A;  2HDQ A;  2Y2M A;  1LL9 A;  2IWC A;  1BUL A;  2HZ5 A;  1FIK A;  4XUZ A;  3C4P A;  4UA7 A;  3A3E A;  1ZTU A;  1RGZ A;  3DW0 A;  3M6H A;  1WYC A;  4MN6 A;  3PAG A;  5CHM A;  2G2U A;  4OQH A;  1CI8 A;  2P7J A;  2W3D A;  1EI5 A;  4LPZ A;  2ZQC A;  2V20 A;  1BT5 A;  2QWS A;  5CGW A;  3JVU A;  1XFQ A;  1XGJ A;  2JE5 A;  3GMW A;  1FCO A;  3F1P B;  5EFW A;  1MWR A;  3NY4 A;  3HLE A;  3FG8 A;  1OJ5 A;  2W1R A;  3VE3 A;  4BEN A;  3UB7 A;  4GCZ A;  4X25 A;  3HRE A;  1G68 A;  2H10 A;  1KVM A;  2FFY A;  2V0U A;  1FCM A;  3DTE A;  3MXR A;  2A49 A;  5KMW A;  4LCM A;  1Q2Q A;  2EXB A;  2J80 A;  1H8M A;  1CEF A;  5FQM A;  2WUQ A;  4LRZ E;  2JKT I;  3U2A A;  5EOE A;  4O7D A;  2BLS A;  1ONG A;  3L7H A;  3EGX C;  2WYX A;  3BFC A;  5F82 A;  2V1A A;  1YLZ A;  5F83 A;  2IA2 A;  3MSH A;  3TW8 A;  5DKL A;  4KG6 A;  1VQQ A;  3EEA A;  1S6R A;  5GHY A;  3GQZ A;  1VB6 A;  5DKK A;  1NYM A;  3O86 A;  3HUM A;  2QZ6 A;  2EX8 A;  4XUX A;  3LIC A;  4OPR A;  4D2O A;  5E2F A;  4QY5 A;  1N9B A;  2J9O A;  4RX3 A;  4Y17 A;  1LI9 A;  1IYO A;  1K56 D;  5HD5 A;  3LUQ A;  3QP4 A;  1ZG4 A;  3C30 A;  4PKY G;  3QP6 A;  3A0R A;  1DY6 A;  1JWV A;  3WWX A;  1QME A;  3MZE A;  1Z6F A;  1H8Z A;  3EWK A;  1SZV A;  1T1A A;  1NZU A;  4D60 A;  3S7O A;  5A91 A;  2XSS A;  1QMF A;  4HOI A;  1T18 A;  2VEA A;  2W3G A;  4XT2 A;  4R1G A;  3H7W B;  1CI9 A;  2Z6C A;  3AGD A;  1HZO A;  4X68 A;  2XR0 A;  3A3J A;  5FI6 A;  2OAQ 1;  1DJC A;  4E3N A;  3OPL A;  3RXX A;  3HJK A;  4E3O A;  1K0K A;  4EV4 A;  1G5U A;  1VET A;  3E2L A;  4RVA A;  5FAT A;  3QP8 A;  4ZJ2 A;  3ZG8 B;  3CG5 A;  1YMX A;  5DTS A;  3G4P A;  4BQM A;  3P09 A;  3SS3 A;  3W4Q A;  1K25 A;  1UWP X;  5CXW A;  5HZH A;  2WAD A;  1DJA A;  3PHY A;  3OPP A;  2XH9 A;  4JPM A;  3PYP A;  1IYS A;  4G3W A;  3PAE A;  4YWZ A;  4S2N C;  3GSG A;  3NBL A;  2B18 A;  5LBR A;  4OLG A;  1MC0 A;  3IHA A;  2INW A;  3OCN A;  4KUK A;  5E2E A;  4WZ5 C;  1OT9 A;  1LSX A;  4E3L A;  1FSW A;  2PD7 A;  4OQI A;  2J9P A;  1STZ A;  2WZZ A;  3FKW A;  2QJ7 A;  3N8L A;  5EM1 A;  4PM6 A;  3CHW P;  5HD3 A;  3ZDJ A;  2XD5 A;  2V1B A;  3V67 A;  4QPR A;  5A92 A;  2ZQA A;  3FPW A;  4ETX A;  3H9W A;  3IXG A;  3NOT C;  1WYB A;  4GD8 A;  5DJU A;  3F1O B;  1Y54 A;  4HY8 A;  1W8Q A;  4HEF A;  1FSY A;  3A3F A;  2C5W B;  4MNR A;  4M3K A;  2QMI A;  5HPF A;  3NC8 A;  3UB5 P;  1PWD A;  3LYX A;  3ZCZ A;  4MMN A;  1K56 A;  4I3A A;  5EVI B;  3VP3 A;  1S4S A;  1K38 A;  2JKR M;  4EER A;  4B93 A;  4NK3 A;  3IH9 A;  3MF0 A;  2HJE A;  3V39 A;  4EWF A;  4L9E A;  4I39 A;  3T4L A;  1K55 C;  5L10 A;  4ZJ3 A;  4PM7 A;  5F1G A;  3IS2 A;  3WRT A;  3GEC A;  3OBF A;  4S2I A;  3GTC A;  3IS2 B;  4S2L A;  3A0V A;  4DDY A;  2VGL S;  4P6Z S;  2DRW A;  3LIE A;  4FH2 A;  2ZL1 A;  4JXW A;  2XFT A;  3K3C A;  5FEF A;  2DNS A;  4JXS A;  3HJI A;  4IJG A;  4HBT A;  5FAO A;  3LEZ A;  4PM8 A;  5MC7 A;  3UN7 A;  4S2O A;  5FQ9 A;  3O5Y A;  4KZA A;  3KSF A;  1GHM A;  3D72 A;  5L09 A;  2XA7 S;  4X1L A;  5CRF A;  3ISG A;  1YSQ A;  5TGF A;  4FTX A;  1K54 A;  1LHY A;  4WEJ A;  5GHX A;  1XJ4 A;  3CLO A;  3V3S A;  2BG1 A;  3LR5 A;  2BAS A;  2L1M A;  3IF6 B;  3OC2 A;  4WL9 A;  4FD8 A;  1FOF A;  5FQI A;  4EEP A;  5M19 A;  1ESU A;  1PIO A;  3CMZ A;  2P9V A;  3S7N A;  4HIA A;  2PYR A;  1I2S A;  2EFX A;  2XRO A;  1F98 A;  3R7W A;  4EQ1 A;  5HSQ A;  1YLP A;  3T12 B;  4GB7 A;  5FAQ A;  2CC1 A;  4O01 A;  1GA0 A;  4KZ4 A;  4HHD A;  2PAV P;  4CJN A;  2OV5 A;  5E43 A;  1MY8 A;  2VGL M;  1NRJ A;  1LL8 A;  1CF0 A;  3NHQ A;  1PRQ A;  3T50 A;  4OOM A;  2P08 A;  1OTI A;  4DE0 A;  3Q1F A;  2PD8 A;  2JBF A;  4MCW A;  4P87 A;  3N7W A;  2NUT C;  3LR4 A;  5C5K A;  4E3J A;  4EBL A;  1F9I A;  5GLA A;  3DBA A;  2ZQ8 A;  2Z2M B;  3WS1 A;  4G3K A;  3G34 A;  4ID4 A;  4ZJ1 A;  1BZA A;  2ZM2 A;  4R38 A;  4ARZ A;  4NEE D;  1K6S A;  5DVA A;  4A5R A;  1BYW A;  4R3J A;  2Y79 A;  1XXM A;  2A3U A;  3LEQ A;  3UO9 A;  4BBT A;  1NRF A;  1ZKJ A;  2M1C A;  2WGW A;  3CJM A;  2W0N A;  3IQA A;  3JVV A;  5FAP A;  3VP0 A;  5AVE A;  3IT9 A;  3HCY A;  4E04 A;  1NLY A;  4UAA A;  5IU1 A;  4ZRR A;  1SKO A;  4HJ4 A;  1ERQ A;  4Y3I A;  3A3I A;  2WKH A;  2LB5 A;  2WGI A;  4GS9 A;  4E3K A;  1TS7 A;  4NG2 A;  3S7Q A;  1TEM A;  1N4O A;  1TS6 A;  3W2Z A;  2XFS A;  3T4T A;  3ICY A;  1RGY A;  4WZ4 A;  1G28 A;  5BOH A;  3IX3 A;  1BLC A;  1S1Y A;  2Y2Q A;  1DP6 A;  2EX6 A;  3E98 A;  3T4K A;  4R3B A;  3UE1 A;  5HDS A;  1UWN X;  4B4X A;  1K4E A;  2VV8 A;  3M2J A;  2ZJ9 A;  3IH8 A;  1X0O A;  3MJQ A;  3SH7 A;  1DRM A;  2CMN A;  3G32 A;  5J8X A;  5TFQ A;  4OVD A;  5TJJ A;  3SH9 A;  4IUH A;  4Y13 A;  4S2N A;  3ZG9 B;  4U0X A;  1P9R A;  3TE8 A;  3FKV A;  1GSX A;  3UB6 A;  3VV4 A;  3V3R A;  4OOL A;  1G6A A;  4FSF A;  3LO7 A;  1EWZ A;  3MXQ A;  5AJG A;  1HVB A;  3WS4 A;  1MKI A;  2HDS A;  2JN7 A;  3C5A A;  2Y2J A;  1GCE A;  1W7F A;  4WMC A;  2QHK A;  2W1T B;  3LI8 A;  1TD5 A;  4E6X A;  4ZBE A;  3IF5 A;  3D4F A;  5J4E A;  3SZT A;  4QHC A;  3UPN A;  2WKP A;  2BTF P;  3U4L P;  3T1Q B;  4F94 A;  4PKY A;  3R4K A;  3C7V A;  2VLG A;  3A3D A;  2ZOH A;  2EX9 A;  3MBZ A;  4I5S A;  3Q7V A;  3MQ0 A;  2RCX A;  4MLL A;  2RL3 A;  2ZM0 A;  5F1F A;  4HH2 A;  1ES3 A;  2WZX A;  3EQU A;  5DTT A;  5HWW A;  5F6A A;  2FZ0 A;  1BLP A;  2OAP 1;  2Y8H A;  4QB8 A;  2VA0 A;  2EFU A;  2IWB A;  4PHT A;  5TBM B;  3UNW A;  1DP8 A;  4WM9 A;  1I2W A;  3IWI A;  2GX5 A;  4NET A;  3IBJ A;  4ETZ A;  5CEB A;  1ONH A;  3LIA A;  3MZD A;  4QY6 A;  2ZC7 A;  3N8R A;  5A90 A;  4GN2 A;  2HV1 A;  5AQ7 A;  3V50 A;  3HL9 A;  3VP1 A;  3T1S A;  1OTD A;  3KYE A;  4B88 A;  3LIB A;  4JF6 A;  2EX2 A;  4Q0I A;  3DWK A;  1VHM A;  3N4I A;  3ZVW A;  3MMH A;  4U0T A;  3IWO A;  1NY0 A;  1K55 A;  4F3L B;  5HAQ A;  3OOV A;  3TJZ C;  4PAU A;  2XGN A;  4HNB A;  3BW6 A;  2ACG A;  3E4O A;  3WS5 A;  1PW8 A;  3MKE A;  2M7U A;  2R9X A;  1S4R A;  3FYZ A;  5GHZ A;  4HI4 A;  2V9A A;  3NIA A;  3C8C A;  5AQA A;  5DF7 A;  1BSG A;  4FCF A;  2G2W A;  4NKP A;  3JPU A;  1TF1 A;  2ZM8 A;  1FIL A;  3NJA A;  3O88 A;  4R6L A;  3QNB A;  4DJ3 A;  3QP1 A;  1PWC A;  4K0X A;  5HL1 A;  1BLH A;  2V8F A;  3VSK A;  1P97 A;  2ZMF A;  1XGI A;  1E3U D;  3UE3 A;  4KZB A;  3EGD C;  1VEU A;  1XPB A;  2XF3 A;  3HLD A;  1ERO A;  2GNX A;  4H6J B;  1JNU A;  4UHU A;  2KX6 A;  4OQ0 A;  1YM1 A;  4BWI A;  3RXW A;  2W3F A;  1KDW A;  3ZNY A;  1F2K A;  2PHY A;  1OTA A;  4WMC D;  4Y0O A;  5HDD A;  5EEC A;  3N8S A;  4S2P A;  5DFX A;  3UB9 A;  3DAV A;  2Q0O A;  5TBM A;  3D3O A;  1E25 A;  4H6J A;  3HLW A;  2PRF A;  3KSH A;  4ZAM A;  1OPX A;  2M7V A;  4PM5 A;  2Y91 A;  4OQG A;  5CGS A;  1KGF A;  1K57 A;  2FH5 A;  1XJ3 A;  4Y15 A;  1CQA A;  5E2G A;  2E8I A;  3S22 A;  4OKP A;  1KVL A;  1JWP A;  1VM1 A;  3HUO A;  3ITA A;  3I7J A;  4OPY A;  4WEK A;  4L9G A;  3UY6 A;  3B3X A;  1PYY A;  2OWH A;  2JKG A;  3G6O A;  5EVI C;  4BD0 A;  2W3H A;  1K6R A;  3IXH A;  3F1O A;  3FPV A;  1T19 A;  3HUN A;  1YLW A;  3O3V A;  4GW9 A;  2VGK A;  3CZD A;  1W8Y A;  3LID A;  3T4Q A;  3H7W A;  3PBO A;  3ZGA B;  4GOG A;  2OSU A;  2LB9 A;  2V0W A;  4HH3 A;  1BLS A;  3Q82 A;  5J3W A;  1ODV A;  3BM6 A;  1ESI A;  2J3W A;  2Z6D A;  3FWL A;  2O99 A;  3Q81 A;  3TSG A;  5G4Z A;  4NXG A;  1P0Z A;  1M6K A;  1D7E A;  4JGR A;  1YQS A;  1VEU B;  3MKF A;  4LV1 A;  1BUE A;  3OCL A;  1SKF A;  1AWI A;  1Z09 A;  4M4X A;  4CLC A;  3LGO A;  1RP5 A;  3VP2 A;  5FQJ A;  4OPZ A;  4LRY C;  4KUO A;  5DJT A;  4Z9Q A;  2I9V A;  2FFF B;  3BRM A;  4LCL A;  2QKP A;  3SS5 A;  2ZC3 B;  2R78 A;  1CK3 A;  3QNC A;  3VOZ A;  2OWJ A;  3P7N A;  1KOU A;  5G4Y A;  4BD1 A;  5I94 A;  2PBY A;  5KSH A;  3DWZ A;  1Y4O A;  2P04 A;  3BEC A;  2O9B A;  4X56 A;  4GKU A;  1OT6 A;  4KQQ A;  1SDN A;  4WN5 A;  3VMA A;  2ZLY A;  4WBG A;  2XRN A;  2PT7 A;  3MXS A;  3PBS A;  2H0T A;  2PBD P;  3PBN A;  2HGV A;  2W3E A;  4JBF A;  2J7V A;  1GHP A;  5GLC A;  3CPT B;  3MFX A;  4CLC C;  4UQI M;  1PFL A;  3ZG5 A;  3BLM A;  2I72 A;  4P0M A;  1IYQ A;  2HPB A;  4LLO B;  4GDN A;  2XA7 M;  5EV0 A;  4Q0J A;  1ACF A;  2H28 A;  3BFE A;  5CGX A;  5L8M A;  2C6W B;  4DRT A;  3V5M A;  3GDI A;  1I5Q A;  5CER A;  1S66 L;  3F1N A;  2ZC5 B;  1KE3 A;  2K7S A;  3OPR A;  1NWZ A;  1H8Y A;  2Y2L A;  2ZMA A;  3K3D A;  1JTG A;  1TDG A;  1DJB A;  4DMZ A;  3PTE A;  4E3M A;  4X55 A;  4KQD A;  4EQI A;  4KG5 A;  4IVK A;  1P9W A;  1FCN A;  3NDG A;  2JKR I;  3PBQ A;  1O07 A;  5L07 A;  4DE1 A;  4DE3 A;  3B33 A;  1HTZ A;  4LFU A;  5A8B A;  1EW0 A;  2XDM A;  5M1A A;  4R3A A;  3BYD A;  4JXG A;  3M6B A;  2Z2L B;  2PYP A;  4EUV A;  4CLC B;  5HPI A;  2Y4A A;  2Y2G A;  5FEG A;  4GS9 B;  5F68 A;  4LV0 A;  2HJ9 C;  2WAF A;  3QP5 A;  3FZC A;  1L0G A;  1YPR A;  5CHJ A;  3LI9 A;  4ME4 A;  1N9N A;  1WE4 A;  4I3I A;  1LI0 A;  5U47 A;  2VZW A;  2B95 A;  3S4X A;  4MN7 A;  1OME A;  3IX8 A;  1NYY A;  1XP4 A;  2KLI A;  2Y2P A;  4PMA A;  2HDU A;  1TS0 A;  3H82 A;  3VFH A;  1PZO A;  4O8G A;  1KE0 A;  1J9M A;  4E3I A;  1ZHH B;  3ZYT A;  3ZHH A;  4ARZ B;  3LY4 A;  3GRJ A;  4R70 A;  1JVJ A;  3CUE C;  1MWT A;  4JLF A;  3KSG A;  1XKZ A;  3TG9 A;  5DFY A;  3BFD A;  3UPP A;  3DTI A;  4Y2F A;  3Q7V B;  2B02 A;  4GD6 A;  5F69 A;  1KGG A;  3LIF A;  4RYE A;  1C3B A;  3RFB A;  1L0F A;  1XFN A;  3DTM A;  3E0Y A;  1JWZ A;  4S2J A;  2O9C A;  2UWX A;  3FC7 A;  3NOP C;  1O7E A;  1AXB A;  5AQ9 A;  4C75 A;  2JCH A;  2Y55 A;  2PR6 A;  2P74 A;  1LLB A;  2ZBB A;  3BFF A;  1CJF A;  4X6T A;  4ZTK A;  5CTM A;  5KIZ A;  4AFI A;  3BQ8 A;  2H5S A;  2L0W A;  2Q9N A;  4IBX A;  3WRZ A;  1ZC2 A;  4QJG A;  1OTE A;  4YIN A;  2XK1 A;  3T4J A;  3HBR A;  3F1P A;  1H3Q A;  5CEC A;  5FI2 A;  2VK3 A;  4HBU A;  4NXF A;  1GSV A;  3QP2 A;  3S7P A;  3ZG7 B;  1D1J A;  3NOU C;  4F3L A;  1PI4 A;  1IKG A;  3BY9 A;  3QHY A;  3NUL A;  3VE4 A;  4EW7 A;  1OTB A;  1GSW A;  1K4F A;  4KZ5 A;  3UPO A;  1TDL A;  1PI5 A;  3MZF A;  4HES A;  4FH4 A;  2V1Z A;  4B4Z A;  4LGW A;  1XA7 A;  5GL9 A;  5I5L A;  5A93 A;  2OLV A;  3CIT A;  3GV9 A;  1W5D A;  2W1T A;  2Y2N A;  3UMD A;  4EEU A;  5FQK A;  3HLB A;  5IT5 A;  5HAR A;  4NXE A;  4S2K A;  3N6I A;  1PNE A;  2Y2I A;  2ZD8 A;  5FA7 A;  3UB8 A;  4XT2 B;  4IED A;  1SHV A;  4BMW A;  3IF6 C;  4KZ3 A;  4XXR A;  4OOY A;  1IKI A;  4UEY A;  4E6W A;  3SW1 A;  3HLF A;  4KQO A;  4JGO A;  4K91 A;  2Y2K A;  2WKE A;  3DTK A;  4BBU A;  4UQI S;  5EUA A;  4Q8I A;  5L2F A;  2EXA A;  5HW3 A;  3ZFZ A;  4YNR A;  1K54 C;  4X53 A;  4GDB A;  5JYP A;  4S2M A;  2VKS A;  4KEN B;  5M18 A;  5HAI A;  1IEM A;  3SH8 A;  5AQB A;  3M2K A;  2O9A A;  3IBR A;  1D06 A;  1LSW A;  1YLT A;  3CI6 A;  1KGE A;  1XJ6 A;  2ZQ7 A;  4P6Z M;  1ERM A;  4GLQ A;  5EVL A;  3W4P A;  4IVI A;  3TOI A;  1L2S A;  1G6O A;  3SS4 A;  4G3V A;  4HP9 A;  4OP8 A;  1VET B;  2JKT M;  3G2Y A;  4KZ7 A;  5CTN A;  4CLC D;  1PWG A;  3UE0 A;  4GHI B;  4UA9 A;  4EXO A;  3PBR A;  4FUW A;  5CED A;  3KX0 X;  1MZU A;  1FR1 A;  4GHI A;  2PU2 A;  5EVI D;  2UV0 E;  4GZB A;  4JKT A;  3E4Q A;  1SDE A;  4Y0U A;  3EOI A;  4KZ9 A;  4CQH A;  3UME A;  1T1B A;  4JGP A;  3UDI A;  4KZ8 A;  2X71 A;  2GJ3 A;  5EPH A;  2EA9 A;  2PDR A;  2QYB A;  3T1R A;  5HWT A;  3SOI A;  2XD1 A;  2VV7 A;  5TR7 A;  2WGV A;  5GLD A;  3NEC A;  3ZVT A;  3BY8 A;  2EWW A;  3B47 A;  5EVI A;  3T1X A;  4K0W A;  1W79 A;  4MBK A;  4DF6 A;  4N9K A;  4N1H A;  3RH8 B;  3T4S A;  3MQO A;  2JKF A;  5FL3 A;  4K08 A;  4Z1W A;  2QJ5 A;  4DN0 A;  1IOU A;  2XQZ A;  3C4O A;  4QWO A;  3GVB A;  2D02 A;  3AGF A;  3HLG A;  4BLM A;  2QPN A;  2XLN A;  2HP6 A;  1T1C A;  3ULF A;  3NDE A;  4OH0 A;  4EBN A;  5FSR A;  5F5Y A;  3K2N A;  3BLS A;  4MBH A;  3CUE A;  1FR6 A;  4WYY A;  5HFO A;  3ITB A;  4JF4 A;  4DJ2 A;  4N9L A;  4MBF A;  1CEG A;  4Y5F A;  5HWV A;  5FQQ A;  5EE8 A;  2Y2O A;  1IEL A;  4HJ3 A;  2V2F F;  2YKF A;  3OPH A;  4RA7 A;  1YMS A;  3IXD A;  1N9L A;  1DP9 A;  5EM0 A;  2J3T D;  3HLC A;  2V8C A;  1MWS A;  1Q2P A;  2J3T C;  4OON A;  2GZA A;  4YFM A;  4Q0H A;  3W4O A;  3BEB A;  3EEH A;  4X1M A;  4L0L A;  4LV2 A;  4JXV A;  1LT0 A;  3W8K A;  1LL5 A;  5K5B A;  2HDR A;  1A0K A;  4P6B A;  4HQA A;  3AGE A;  2P9V B; 
#chains in the Genus database with same CATH homology
 3T1Q B;  4FTX A;  1YPR A;  4QWO A;  1J3W A;  3LEQ A;  1HLU P;  5FDS A;  2PBD P;  3L7H A;  5EV0 A;  1ACF A;  3T12 B;  1VEU A;  3T1S A;  3L9K A;  4X1M A;  1PNE A;  1SZV A;  2VK3 A;  3KYE A;  4ESP A;  3T1X A;  1SKO B;  2PAV P;  3DAV A;  1Y4O A;  3D9Y A;  1CQA A;  4X25 A;  1K0K A;  4D60 A;  1G5U A;  1CJF A;  1VET A;  2BTF P;  4FUW A;  1CF0 A;  5EVE A;  2PRF A;  1D1J A;  3U4L P;  5FEG A;  1PRQ A;  3CPT B;  2JKF A;  1VEU B;  2ZL1 A;  1FIL A;  2B95 A;  2JKG A;  3MS6 A;  5EM0 A;  5EM1 A;  1VET B;  2ACG A;  2V8C A;  3T1R A;  3CHW P;  1PFL A;  3MSH A;  4X1L A;  2E8J A;  1SKO A;  3NUL A;  3UB5 P;  1AWI A;  1A0K A;  1F2K A;  2HZ5 A;  5FEF A;  2V8F A;  1Z09 A;  2ZL1 B;  3LGO A;  3NEC A;  3CPT A;  1FIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...