1VF5D

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
b'DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B6
molecule tags Photosynthesis
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1vf5D02
2NVGA 4QCKA 4QDFA 4QDFB 3VMHD 2E76C 4NBCD 2DE5D 2ZT9D 2NUMA 2XSHA 2JO6A 1SQBE 2HMMA 4HM4A 4AIVA 2HMLA 1NYKA 3FOUA 2BCCE 2YFLA 3GB4A 2IBZE 5KKZC 2YVJB 3CX5E 4QDDA 1L0NE 3L75E 3GZYA 1FQTA 1NTZE 2HMOA 4H0LD 3N0QA 4I7ZC 2E76D 1SJGA 3L74E 1O7WA 1SQPE 4HM5A 4P1BH 1RIEA 2Q3WA 2XSOA 2NVFA 3EN1A 3L70E 5KLVE 2GBXA 5CXMA 1JM1A 2CKFA 4H13D 5KLIC 4U3FE 5BOKA 4HJLA 1NU1E 2YFIA 2BMOA 3TGUE 4HM2A 4HM3A 2QJPC 4P1CH 4HM0A 2HMJA 2ZT9C 1ZRTE 4H13C 1O7GA 2E4PA 2D2CC 2HMNA 1UUVA 2FYNC 4QDCA 4PV1D 1ULIA 3GL2A 4HM1A 4OGQD 2QPZA 4QURA 2BMQA 5AEUA 1KB9E 2YIUC 3AZCA 1O7PA 2NVEA 2QJKC 1SQQE 2HMKA 1VM9A 4H0LC 1NTME 1O7HA 3GL0A 3H1LE 3VCAA 3DQYA 1VCKA 5HL4A 3VMID 1L0LE 2YFJA 2E75D 4NBHD 3GKEA 4NBGD 3D89A 1SQVE 1WQLA 1P84E 4PV1C 4HM8A 4PD4E 5AEWA 3VMGD 1EG9A 1PPJE 1UUWA 3GZXA 2YMKA 3H1JE 4QUQA 1NTKE 4QUPA 2E74D 2GBWA 1G8KB 4H44D 2E4QA 2I7FA 3H1HE 2JZAA 3GTEA 2XR8A 3H1IE 2NUKA 1Q90C 2ZYLA 4H44C 2B1XA 4HM6A 1O7MA 3GTSA 3L72E 3GOBA 4NBFD 4AAYB 3EQQA 4OGQC 1NDOA 3GCEA 4NB9D 1BCCE 2B24A 1VF5D 1EZVE 4HM7A 1ULJA 1SQXE 2DE7D 2QJYC 3BCCE 2D2CD 3L73E 4NBBD 4NBED 2E74C 2DE6D 2XRXA 4HKVA 3C0DA 2A06E 4NBAD 2E75C 1PP9E 1VF5C 1G8JB 2BMRA 3H1KE 4NB8D 3L71E 3CXHE 4NBDD 2FYUE 2NWFA 3VCPA 1KYOE 1BE3E 1O7NA 3CWBE 1RFSA 4EMJB
chains in the Genus database with same CATH superfamily
1BGYE 1FDOA 1SFCB 4NBCD 2AEMA 1EDJA 3H1HJ 3AE8C 3GG2A 2OYHB 5CMZA 2LR2A 5AW1B 2HMOA 3HRNA 1O7WA 3SWKA 5KJ7D 2BCCG 1EXIA 3D6YA 2V7QJ 3O6QA 2ZJSE 2LKMA 3CX5I 5BOKA 3TNUA 4TT3H 4I6MC 3AE2C 1PGQA 2E76B 2WT7B 4BWNA 2HMJA 3C1LA 1SQVD 2H89C 2D2CC 1VQ5P 3IF4A 1KFNA 2M3EA 1KB9E 3HTKA 1O7PA 4ZNCA 1M1KQ 3H1LE 3CCJP 1RF0A 3H1HD 2W6AA 4QUQA 1FZCB 2QSIA 1NAYA 2KLUA 3MIWA 4H44D 2QG4A 4UB6E 3V2NA 2NPSB 1G1IA 3MGNA 1PV3A 5CCHA 2YKQA 2YXQB 2E5YA 2HG5D 2KXPB 2WITA 3M9BA 1UIXA 1RE3C 3H1KJ 3TK1A 1T2KD 4H44B 3FGAD 2PFXA 1DIPA 3H1ID 1JB0J 2OQQA 3BCCG 1DH3A 2OTLP 3CCQP 3AE7C 2NPSD 4DZOA 5TISE 5APXA 1KILC 3GHGC 1RE3A 1NTKJ 4JYBA 1VQMP 1M56D 2Q3WA 3L70E 1LT9A 2B87A 3BRVB 1N7LA 4I1LA 4H13C 2Q6QA 2HMNA 3S4RA 5AW9B 3L75D 4QDCA 4JQ0D 4PV1B 1UIIA 1SQPD 2XV5A 5M1BA 3TGUJ 1O7HA 3BATA 3A0BH 4PJ0E 2QJKB 1AQ5A 4U3FD 1JMMA 1L0LD 3VMGD 1VL2A 1NTKE 5CHXA 4WY4C 2WSFJ 1BCCD 1EZVI 4N78E 2K1AA 4D6TJ 1LP1B 3U1AA 5KJ7C 2Q7CA 4KHXA 3CWBJ 4RJTA 1SFCD 2XNXA 2DW3A 3LIEA 4DCKA 1P84I 1W2EA 1YITP 1ZLLA 1OX3A 3BCCJ 3CXHE 1SQXJ 1YJNP 4NPFX 2NWFA 3VYIA 4EMJB 4IL6E 4QDFA 1BE3D 3CCMP 4C7NB 4HM4A 2AXCA 2XDJA 5C39A 5KKZC 4BXLA 2YVJB 1BGYG 2HLOA 1EZVG 1N73B 2NVFA 2O01H 3H1JG 2QIWA 1Q82Q 3A2AA 5CXMA 4BRYB 2V7QH 2FFDB 4U7JA 1EDLA 4HM3A 1SFCC 3FX0A 1RE4A 2N1TC 1S72P 2OYIC 1L4AB 1T6AA 1BCCG 2O01N 1FS0E 1PL5A 3AE6C 2YO3A 4WY4D 3A7OA 2Q3IA 3FXEA 1BGYJ 3P8CD 4B86A 1OVVA 1S3JA 3D71A 3AE9C 1KMIZ 4MN4C 5APWA 5KLIB 2YIUB 2ZYLA 2B1XA 1WMKA 5CCGC 2A45G 1EDKA 1URQC 1OXZA 3JCUH 4NB9D 3Q5PA 5AW6B 1LWUA 2HODB 1BE3G 3V5BA 2LXBA 3II6A 1FOSE 1MUUA 4WY4B 2JDIH 1BGYD 2K9JB 2R32A 3MUDA 3GLMA 3LW5H 1IK7A 1EZVD 4DJGA 5DJTB 3CCRP 3SFDC 3CXHD 2Y0EA 4OGQB 2IZ1A 2JO6A 1VQKP 1MZ9A 3B5NA 3FOUA 2R3CA 2OGUA 2WTYA 1RQVA 2V4HA 1BDCA 5KAFH 2E76D 2IZ0A 3V2PA 3VMAA 1JUNA 2NZ2A 2GBXA 4DOJA 1VPCA 1JM1A 1GL2B 4ZKPA 1PFIA 1NTMJ 3IFMA 5APQA 5KAIH 3TF5A 3FWLA 4OGQD 5AVRB 3SSUA 2WZ7A 5AEUA 3AZCA 4A7PA 1NU1J 3L4FA 5CBNA 3VCAA 3VN0A 3CC4P 3V4QA 2YFJA 3V4WA 4NBGD 4EOTA 3V2QA 2QE7H 1JY2N 1KQLA 3BCCD 1RF1B 1M57D 1YTZI 1URQB 3C8VA 3HD7B 1NTKK 4PD4D 4N78D 2G3AA 1LTJA 2BEQD 4EI2A 1K73Q 3U1CA 2KNCA 1KYOH 2N1TA 1LWUC 1BSNA 3M9HA 3JCUE 3RL0D 2QJYC 5DJUB 2W83C 1T8ZA 1L0LG 4JF7A 3BVHA 5KAIE 1D7MA 1ZN5A 1NWQA 3AEFC 2KP8A 3AE3C 2AXTE 1IZNB 2DE5D 2C0XA 1SQPG 2H88C 2J58A 2YFLA 2IX7C 3RL0B 4YTPC 2NPSC 3SWYA 2OTKE 4UB6H 5H2FE 4H0LD 3L74E 3AEAC 3KDPB 4HH2A 1JM0A 3GF3A 1NVOA 2HYNA 5AW7B 4AUWA 1YQ3C 1Z56A 2R3SA 4LLHA 2FYUG 1SP4A 5AVSB 2MJZA 5EFWB 1NTZJ 2P67A 1SQQK 2K88A 4LC1A 5HL4A 4L75A 1L0LE 1YYCA 1G2CB 4ASWA 1HBWA 2P1JA 1WQLA 1GMJA 1IC2A 2PRRA 2W90A 4EYYQ 4HM8A 3L71G 3L70G 2B88A 5BU5A 1X22A 2Y9YA 2W6JH 2FFDC 3BRTB 1KB9H 1S5LX 2A06G 3M91A 3GOBA 1L0NG 3RK3E 1M1JA 2B24A 2YKOA 1JY3P 1ZW0A 3E1IA 1LTSC 2HPCA 4CPGA 2FKWB 2IFMA 5AVVB 3FXDA 4NBDD 3E7KA 1BCCJ 4OWFA 1BE3E 2OYOA 1Y9BA 1NTMK 3RL0g 1SFCA 1LJ2A 3USSA 1JCCA 4WVZA 2QVAA 2FYUD 2KB7P 3AE1C 1X0TA 3H1JJ 1Q90D 3MUDC 1QX8A 2RMZA 2XSOA 3GHGB 3EN1A 4JYCA 4HJLA 1E5WA 1NU1E 3TNUB 1JCDA 2N9YB 2WT7A 2O3JA 3Q3DA 2YO2A 1YJ9P 3GL2A 1MKMA 2QPZA 2KIKA 3HTKB 3JSVC 3L75G 2SPZA 1VQ7P 2QRXA 1JOCA 1EG9A 1FAVA 1PPJE 1UUWA 2YMKA 1FDIA 4I7ZB 2JZAA 1BSHA 2NPSA 2O1JA 2BEZF 4AAYB 4OGQC 2OYIB 2DE7D 3L72D 2OARA 2IBZD 1EXJA 1U57A 3VMXA 2QM7A 2Q9IA 4IFDK 1FZGA 3G3ZA 3GW6A 2OTJP 1AVOA 3CCVP 1NTZG 1N7SC 4M3LA 2XSHA 3HE4A 2HMMA 1NYKA 2BCCE 4R4MA 5AVTB 1IFIA 1XTGB 3L73G 1SJGA 3CX5D 1E79H 3PH0A 2Q5UA 5GTIH 5E79H 1SQVJ 5KLVE 2B87B 2FXOA 1MFZA 1HVVA 1NKZB 1RH5B 5KLVJ 1HF9A 3L37A 3H1JD 4H0LB 2ZT9C 1NAFA 4W7YA 1FZCC 1NYHA 1NGMB 4ZMDA 4QURA 2KS1B 2B9BA 1SLQA 3GMAA 5BU8B 3RK3C 4UB8H 2E42A 4NBHD 4IFFA 4PD4E 1P84D 1GU4A 4N6JA 1SQQD 1MFTA 1KYOI 3G6EP 2KLVA 3OW2O 2IPPA 1LP1A 2ZFCA 1O7MA 1S5LE 1ZV8A 2IFNA 2ZT9B 1VQLP 3GCEA 3PRJA 3A0BE 4PJ0H 3RK2C 1ULJA 3BCCE 4NBED 1K8AQ 2DE6D 1K05A 4GOFA 5APSA 3CMAP 3RL0C 3M0DA 1PP9D 2GUSA 4NB8D 2ZXEB 5KAFE 2L91A 3CPWO 3N7NA 2HR3A 2NVGA 4QDFB 3A0HE 2WWWA 5KKZB 4KT0J 3HE5A 4GT1A 4EDFA 1N7SB 3AEDC 3P7KA 1NU1G 3U59A 2WSEJ 1SQBK 5E79E 1WT6A 3L70D 1VQNP 1IFPA 3AEGC 2M8RA 3PTZA 3Q1MA 4BRYA 4W7ZA 1Q86Q 3RBXA 1JEKA 1LT9C 1ZR2A 4HM0A 5K5GB 1DEBA 1U7MA 3B71A 1PPJG 1ZOYC 3B5ND 3P32A 3VMID 1H88A 1FJPA 3L70J 3OJAB 3P8MC 1FE6A 1J1EB 2YKPA 1IFMA 1Y47A 1K9MQ 1LTAC 3CCSP 3B4SA 1CI6A 5CBOA 3GTSA 1GU5A 1IO4A 1LWUB 1IFJA 2FXMA 2HODA 4YXWH 1VQ4P 2I1JA 4HKVA 1FZBA 1SQXD 2E75C 4AYCA 4WY4A 1GW3A 1QL1A 3M9QA 5B5EH 3LIDA 1URQD 1O7NA 4QMAA 4HM5A 3VMHD 3WUUA 1S4XA 2L5GB 3ZDMA 3O8ZA 2KK7A 4RO0A 1DD4A 1HJ0A 2RH0A 3LW5J 4Y99C 2QEXP 1NTZE 1OVUA 1FDMA 3ABVC 1RY3A 2GUVA 2IYPA 1RIEA 3IR9A 1RE4C 1HGVA 1GL2A 1ZRTD 5APVA 1OW8A 2NRGA 1FOSF 4P1CH 1SQPJ 3TGUD 3L74J 4PV1D 4HM1A 4ZKUA 4IL6X 1GK4A 1LTJC 5AW4B 2KSJA 2I8DA 3IN6A 5APUA 4AQRD 1HUCA 4GODA 5KTBA 1RF1A 2JKVA 1N8RQ 1KB9D 4HYTB 1KILB 3MTUE 1LTJB 2OYHC 2NUKA 2KNCB 2P58A 3L72E 2CK3H 1LT1A 3EQQA 2WMMA 4HM7A 1KILD 3L74G 1SQPK 3D6ZA 2XRXA 1LNQA 1Q81Q 3AE4C 2CPSA 2E75B 4Z1MH 2FYUE 1JY2P 2BCCD 2ZYAA 2ZT9D 4AIVA 4XE5B 2Y9ZA 1P84H 5AW8B 3CX5E 4GIFA 5AW3B 2IBZI 3GZYA 1SQVG 2B89A 4HKZH 1LTGC 1GL2C 4JBZA 5B66H 5AVXB 4H13D 1KB9I 3CCUP 1FZAA 3H1HG 3G4SP 3RGUA 1ZRTE 2E4PA 2M5AA 2KYVA 2FYNC 1BDDA 2Y0CA 2BMQA 3GL0A 1NTME 1H0TB 1L0LK 1VQPP 3MHVA 1G2CA 1PP9G 3VOPA 2N9BA 3SWFA 2GM4A 2WPVB 2KI7B 1VQOP 3H1JE 4QUPA 1EDIA 1KQFB 5AW2B 1MV8A 3H1IE 1CSBA 4IL6H 1YBKA 2N1TD 1M1JB 3VP9A 2JJLA 1X9VA 1KC8Q 2HPCB 2ZYDA 1KQGB 2BMRA 1AA0A 2A45H 1AQTA 2JR8A 1SQVK 2ZVOB 1KZUB 2D2CB 1RFSA 5GTIE 3L72J 1GTWA 4TLFA 1SQBE 2HMLA 3H1KG 3RK3B 1YHQP 3WMM0 3CX5H 1PIXA 1VDFA 2Y0DA 4QDDA 3Q2YA 1A02F 1GL2D 1J1EC 1SQXG 1RF1C 1OW6A 1SQPE 3GF7A 3GHGA 3VMZA 1YQ4C 3T97B 3I5CA 1U7JA 1S9KE 4U3FE 3VMYA 2YFIA 3HUSA 3KZIE 1GK6A 3S9OA 1H8AA 3CWBG 1O7GA 4L74A 1LTBC 1KN7A 1SQXK 1N7SD 3PP5A 1VM9A 1IJDB 2QJPB 1OVRA 3H1LD 3D89A 1T3UA 2FYZA 5AEWA 1JTHA 2E74D 3NTNA 3TGUG 3Q5SA 1L4AC 3WU2H 3RK3D 1EZVE 3A0HH 4RESB 2OYIA 1SQXE 4NPEA 4OVNF 2PGDA 1DX7A 2E5TA 3OAKA 2A06E 2O1KA 1G8JB 1JY3O 3H32B 1W5CE 1GDTA 3CWBE 1PZQA 1S5LH 3IAOA 2NUMA 3FWNA 3HE4B 3GB4A 1GW4A 3EFFK 1SQBD 1M8OB 5CJ0A 3SFEC 4OH8B 2OYHA 4H13B 3KPEA 1H89A 4I7ZC 2WSFH 3PLNA 4P1BH 5CCGD 2IBZG 3O6QB 4LGDE 2J5UA 1K04A 2CKFA 1NU1D 4N3YB 4O9BA 3C9IA 2XNDH 1KORA 3TGUE 1KD1Q 1W2BO 3QH9A 1S2EA 1VQ8P 5B5EE 2LXCB 4W80A 1NTZD 2KS1A 1XTCC 2NVEA 2MKVA 1VCKA 1NOHA 3GKEA 1HTLC 3M0AA 1NO4A 2KSEA 3H1IG 1USEA 5GTHE 1TU3F 1NJIQ 3G71P 1FZCA 1R5LA 1L2PA 1G8KB 3I55P 2W6BA 2I7FA 3S1KA 2YXRB 1GD2E 2KZIA 3CD6P 1AFOA 5BVZA 2FYNB 5B66E 4NBFD 3MP7B 1NDOA 4XA4A 3CLQA 1YI2P 4K35A 1KTMA 3C0DA 2H7HA 5L8RJ 3L73D 3F5HA 5KLVK 3EQ2A 2HFED 2E74B 3H1KE 1AJYA 2P7JA 2A06D 3A3YB 5H2FH 4EIJA 4YXDC 3AE5C 3KYQA 1L0NK 4QCKA 3HE5B 1ZR4A 1KILE 2JWAA 2I1KA 1N7SA 5KLVG 3H1LJ 1L0NE 3MZWB 3H25A 2FY8A 4U3FG 5APTA 2FBWC 1N86A 3E1RA 2RKLA 1LT9B 1FJKA 1YTZT 5KLIC 2ZVNB 2XKMA 1OFCX 1UUVA 4Y99B 1ULIA 1RQUA 1QVFO 2C9LY 1L0NJ 4GKGA 2H8PD 2XU6A 3NFQA 4NPDA 4C46A 2BCCJ 4R4LA 1G1JA 1SQVE 3Q5RA 1J1DC 4IFMA 1P84E 3VTPC 1PGJA 1KFMA 1EQ7A 1OZHA 4C7RA 4L76A 1CW5A 1QL2A 1JY2O 3L71J 1OW7A 1Q7YQ 3CXHH 3H1HE 2RN0A 3CMEP 3R4YA 1CI6B 4HM6A 1PGOA 2XZRA 1IFNA 1QLED 2BASA 3I56P 3RK2B 5CCHD 1M7LA 2D2CD 1X8YA 1PPJD 2E43A 3CC2P 4KJMA 1PP9E 2H43A 2PAJA 3CWBD 1RHZB 3VCPA 1J2JB 2JO1A 5AVYB 3W67A 1AV1A 1NHLA 3TDKA 1OWAA 4C7NA 4D6TE 2Q1KA 1QEXA 1T2KC 3CCLP 2IBZE 3H1LG 1T3JA 2K37A 5AVQB 1N73A 3N0QA 2JP3A 1LTIC 1M1JC 4PD4H 4K3AA 3AEBC 1A02J 4GOEA 1NTMD 2FFDA 3CI9A 2WQYC 2WSEH 1OMIA 4WB4A 1N2DC 2WPSA 4DT0A 2WPRA 1L4AA 1L4AD 1SQBG 1JMBA 2KUBA 2A45I 2QJKC 3V2RA 2AEJA 1DD3A 2QA4P 4PV1C 2J59M 4GDOA 1VQ6P 2R44A 3GZXA 2Q3EA 1KILA 1RF0C 2GBWA 1VF5B 3W68A 5TISH 5TJHA 3RK2D 2ZAEB 1FC2C 2XR8A 1NH4A 3CXHI 4PD4I 4RKUJ 5AW0B 2JWDA 1BE3J 1BCCE 1J1DB 1SQQG 3HUSC 3V6IA 2E74C 2UWJE 2G8YA 3M0DC 3BASA 5CCHC 4ASVA 2GA1A 1LTTC 1ZXGA 2P2UA 2FXPA 4HJGH 3PHLA 2FYUK 1S1CX 2K9JA 3L73J 4WWIA 3CL3D 1KYOE 2E76C 1HWTC 3NMDA 3B5NB 3QWOC 3KZIH 1Q2NA 1S9KD 1SQQJ 1YIJP 4D6TD 2WSCH 3L75E 3AEEC 1FQTA 2VRSA 1AVYA 2YNYA 3L74D 4UB8E 5KJ7A 2POHA 1L0LJ 4U3FJ 1R8EA 4HM2A 1ZMEC 2QJPC 1QGKB 1N73C 2W8ZA 2M5AB 4IOIH 3A5TA 5KLVD 5AVZB 2YIUC 3L75J 3NXSA 1SQQE 2HMKA 4H0LC 3B5NC 1H0TA 2JEEA 1NKNA 1GZLA 3JC22 1FBMA 1USDA 2C0WA 2K9YA 1SVFA 2M0BA 5AW5B 3K5BA 3KQGA 1URQA 2CPBA 3L72G 3HD7A 2E4QA 1NTKD 4YPCA 2Z5HA 3GTEA 1CZQA 1SQBJ 1YJWP 4H44C 5APYA 3F89A 3P8CE 2N1TB 2O01J 3N4XA 3L73E 2Z4EA 4NBBD 1VQ9P 3CC7P 1Y8AA 2PP6A 1EC5A 3L71D 5AVUB 3H1IJ 3UIAA 4NBAD 4I2LC 1VF5C 3VP8A 4D6TG 1KV4A 4HB1A 1PGPA 3ITKA 3RBZA 1HH0A 1LGHB 1IK9A 3WU2E 2YMYA 4WBAA 5CJ4A 2AXTH 4L73A 1FU1A 1L0ND 2R5DA 1HGZA 2WPQA 3H6PA 2M3BA 2WSSH 2KOGA 2AEFA 3PJSK 5CCGA 3T97A 2IDBA 4Y28J 1WRGA 1QVGO 3HD7D 3EWKA 3AECC 1IFDA 3B8EB 1HJBA 3HUSB 2BMOA 2Z5IA 2IYOA 3HD7C 1JY3N 3G9RA 1JNMA 3WUTA 3L35A 1R5SA 3M06A 2C9NY 1NTKG 1DEEG 3DQYA 1FZEA 2E75D 2R5BA 3EFGA 1ZP0C 3D70A 3WUVA 1OIPA 1KQSO 1FZFA 2K3RA 2WSCJ 3L36A 1NTMG 2P10A 1JTHB 4XFJA 2FYUJ 1NTZK 1SS1A 2QM8A 3R2PA 2ITAA 1PP9J 1M90Q 3OA7A 1Q90C 3CCEP 3KXDA 1X79B 2W27A 3H1KD 1NU1K 2QJYB 2ZYGA 1VF5D 3KHUA 1JO5A 5GTHH 5AVWB 2WVRA 3TSIA 3H32A 3MD0A 3TYYA 4JPZB 1KYOD 3L71E 2KZJA 2ZXXA
chains in the Genus database with same CATH topology
4QCKA 1FDOA 3VMHD 4NBCD 2DE5D 2H88C 1KILE 2YFLA 1DD4A 4YTPC 1HJ0A 3AE8C 3LW5J 3H25A 1L0NE 1NTZE 2HMOA 4H0LD 3ABVC 3L74E 1O7WA 2FBWC 3AEAC 1EXIA 1RIEA 3D6YA 2V7QJ 3O6QA 3GF3A 5KLIC 1YQ3C 5BOKA 1OW8A 4TT3H 3AE2C 2E76B 4P1CH 2HMJA 2H89C 2D2CC 1UUVA 4PV1D 1ULIA 4HM1A 4IL6X 1RQUA 1KB9E 1O7PA 3H1LE 5HL4A 1L0LE 4R4LA 1SQVE 3IN6A 1WQLA 3Q5RA 1GMJA 1P84E 4HM8A 4QUQA 2QSIA 1OW7A 4H44D 3H1HE 1S5LX 2NUKA 3R4YA 4HM6A 1PV3A 3L72E 3GOBA 3RK3E 3EQQA 2B24A 4HM7A 1UIXA 2D2CD 3D6ZA 2XRXA 4H44B 3AE4C 1PP9E 3FGAD 2E75B 1DIPA 4Z1MH 1JB0J 2FYUE 4NBDD 2OQQA 3VCPA 2JO1A 1BE3E 1Y9BA 3RL0g 2ZT9D 4AIVA 3AE7C 2IBZE 3CX5E 3AE1C 3GZYA 1Q90D 3N0QA 2JP3A 2Q3WA 2XSOA 3EN1A 3L70E 4H13D 3AEBC 4HJLA 1NU1E 2WQYC 1ZRTE 3Q3DA 4H13C 2E4PA 1OMIA 2HMNA 2FYNC 4QDCA 3GL2A 1MKMA 2QPZA 4PV1B 2BMQA 2QJKC 5M1BA 3GL0A 1NTME 1O7HA 1DD3A 4PV1C 4GDOA 3VMGD 1EG9A 2WPVB 1PPJE 1UUWA 3GZXA 2YMKA 1VL2A 3H1JE 1NTKE 4QUPA 1FDIA 2GBWA 1VF5B 2WSFJ 4I7ZB 1KQFB 2JZAA 2XR8A 3H1IE 4RKUJ 2BEZF 4AAYB 4OGQC 1BCCE 2DE7D 2E74C 2G8YA 1EXJA 1U57A 1KQGB 2BMRA 2FXPA 1S1CX 3CXHE 2NWFA 1KYOE 2D2CB 1RFSA 4EMJB 4QDFA 2E76C 2XSHA 1SQBE 2HMMA 4HM4A 2HMLA 1NYKA 2BCCE 4R4MA 1PIXA 5KKZC 2YVJB 4QDDA 3L75E 3Q2YA 3AEEC 1FQTA 1SJGA 1OW6A 1SQPE 3GF7A 2NVFA 1YQ4C 3T97B 2QIWA 5KLVE 5CXMA 4U3FE 1R8EA 2YFIA 4U7JA 4HM2A 3S9OA 1ZMEC 1HF9A 4HM3A 2QJPC 4H0LB 2ZT9C 1O7GA 1NYHA 1NGMB 4QURA 2YIUC 3GMAA 1SQQE 2HMKA 1VM9A 4H0LC 1PL5A 3AE6C 4NBHD 3D89A 2K9YA 5AEWA 4PD4E 2E74D 3D71A 3AE9C 1KMIZ 2E4QA 3GTEA 2ZYLA 4H44C 3Q5SA 2B1XA 1WMKA 1O7MA 2ZT9B 2O01J 3GCEA 4NB9D 3Q5PA 1EZVE 1ULJA 1SQXE 3L73E 4NBBD 3BCCE 4NBED 2DE6D 1K05A 2A06E 4NBAD 1VF5C 1G8JB 4NB8D 3GLMA 1IK7A 3CWBE 2NVGA 3SFDC 4QDFB 3IAOA 4OGQB 2NUMA 2JO6A 4KT0J 3FOUA 3GB4A 3AEDC 3SFEC 1RQVA 4H13B 2WSEJ 4I7ZC 2E76D 4P1BH 2NZ2A 2IDBA 3AEGC 2J5UA 4Y28J 2GBXA 3Q1MA 1K04A 1JM1A 2CKFA 3EWKA 3AECC 1KORA 2BMOA 3TGUE 4HM0A 3G9RA 3B71A 4OGQD 5AEUA 3AZCA 2NVEA 1ZOYC 3VCAA 3DQYA 2MKVA 1VCKA 3VMID 2YFJA 2E75D 1ZP0C 3GKEA 3D70A 4NBGD 1TU3F 2WSCJ 2P10A 3C8VA 4XFJA 1G8KB 2G3AA 2I7FA 2BEQD 1Q90C 3GTSA 4NBFD 1NDOA 1VF5D 2QJYC 4HKVA 1KTMA 3C0DA 5L8RJ 2E75C 2E74B 3H1KE 1AJYA 3L71E 3AEFC 3AE3C 3AE5C 4YXDC 1O7NA 4HM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVG A;  4QCK A;  4QDF A;  4QDF B;  3VMH D;  2E76 C;  4NBC D;  2DE5 D;  2ZT9 D;  2NUM A;  2XSH A;  2JO6 A;  1SQB E;  2HMM A;  4HM4 A;  4AIV A;  2HML A;  1NYK A;  3FOU A;  2BCC E;  2YFL A;  3GB4 A;  2IBZ E;  5KKZ C;  2YVJ B;  3CX5 E;  4QDD A;  1L0N E;  3L75 E;  3GZY A;  1FQT A;  1NTZ E;  2HMO A;  4H0L D;  3N0Q A;  4I7Z C;  2E76 D;  1SJG A;  3L74 E;  1O7W A;  1SQP E;  4HM5 A;  4P1B H;  1RIE A;  2Q3W A;  2XSO A;  2NVF A;  3EN1 A;  3L70 E;  5KLV E;  2GBX A;  5CXM A;  1JM1 A;  2CKF A;  4H13 D;  5KLI C;  4U3F E;  5BOK A;  4HJL A;  1NU1 E;  2YFI A;  2BMO A;  3TGU E;  4HM2 A;  4HM3 A;  2QJP C;  4P1C H;  4HM0 A;  2HMJ A;  2ZT9 C;  1ZRT E;  4H13 C;  1O7G A;  2E4P A;  2D2C C;  2HMN A;  1UUV A;  2FYN C;  4QDC A;  4PV1 D;  1ULI A;  3GL2 A;  4HM1 A;  4OGQ D;  2QPZ A;  4QUR A;  2BMQ A;  5AEU A;  1KB9 E;  2YIU C;  3AZC A;  1O7P A;  2NVE A;  2QJK C;  1SQQ E;  2HMK A;  1VM9 A;  4H0L C;  1NTM E;  1O7H A;  3GL0 A;  3H1L E;  3VCA A;  3DQY A;  1VCK A;  5HL4 A;  3VMI D;  1L0L E;  2YFJ A;  2E75 D;  4NBH D;  3GKE A;  4NBG D;  3D89 A;  1SQV E;  1WQL A;  1P84 E;  4PV1 C;  4HM8 A;  4PD4 E;  5AEW A;  3VMG D;  1EG9 A;  1PPJ E;  1UUW A;  3GZX A;  2YMK A;  3H1J E;  4QUQ A;  1NTK E;  4QUP A;  2E74 D;  2GBW A;  1G8K B;  4H44 D;  2E4Q A;  2I7F A;  3H1H E;  2JZA A;  3GTE A;  2XR8 A;  3H1I E;  2NUK A;  1Q90 C;  2ZYL A;  4H44 C;  2B1X A;  4HM6 A;  1O7M A;  3GTS A;  3L72 E;  3GOB A;  4NBF D;  4AAY B;  3EQQ A;  4OGQ C;  1NDO A;  3GCE A;  4NB9 D;  1BCC E;  2B24 A;  1VF5 D;  1EZV E;  4HM7 A;  1ULJ A;  1SQX E;  2DE7 D;  2QJY C;  3BCC E;  2D2C D;  3L73 E;  4NBB D;  4NBE D;  2E74 C;  2DE6 D;  2XRX A;  4HKV A;  3C0D A;  2A06 E;  4NBA D;  2E75 C;  1PP9 E;  1VF5 C;  1G8J B;  2BMR A;  3H1K E;  4NB8 D;  3L71 E;  3CXH E;  4NBD D;  2FYU E;  2NWF A;  3VCP A;  1KYO E;  1BE3 E;  1O7N A;  3CWB E;  1RFS A;  4EMJ B; 
#chains in the Genus database with same CATH topology
 1BGY E;  1FDO A;  1SFC B;  4NBC D;  2AEM A;  1EDJ A;  3H1H J;  3AE8 C;  3GG2 A;  2OYH B;  5CMZ A;  2LR2 A;  5AW1 B;  2HMO A;  3HRN A;  1O7W A;  3SWK A;  5KJ7 D;  2BCC G;  1EXI A;  3D6Y A;  2V7Q J;  3O6Q A;  2ZJS E;  2LKM A;  3CX5 I;  5BOK A;  3TNU A;  4TT3 H;  4I6M C;  3AE2 C;  1PGQ A;  2E76 B;  2WT7 B;  4BWN A;  2HMJ A;  3C1L A;  1SQV D;  2H89 C;  2D2C C;  1VQ5 P;  3IF4 A;  1KFN A;  2M3E A;  1KB9 E;  3HTK A;  1O7P A;  4ZNC A;  1M1K Q;  3H1L E;  3CCJ P;  1RF0 A;  3H1H D;  2W6A A;  4QUQ A;  1FZC B;  2QSI A;  1NAY A;  2KLU A;  3MIW A;  4H44 D;  2QG4 A;  4UB6 E;  3V2N A;  2NPS B;  1G1I A;  3MGN A;  1PV3 A;  5CCH A;  2YKQ A;  2YXQ B;  2E5Y A;  2HG5 D;  2KXP B;  2WIT A;  3M9B A;  1UIX A;  1RE3 C;  3H1K J;  3TK1 A;  1T2K D;  4H44 B;  3FGA D;  2PFX A;  1DIP A;  3H1I D;  1JB0 J;  2OQQ A;  3BCC G;  1DH3 A;  2OTL P;  3CCQ P;  3AE7 C;  2NPS D;  4DZO A;  5TIS E;  5APX A;  1KIL C;  3GHG C;  1RE3 A;  1NTK J;  4JYB A;  1VQM P;  1M56 D;  2Q3W A;  3L70 E;  1LT9 A;  2B87 A;  3BRV B;  1N7L A;  4I1L A;  4H13 C;  2Q6Q A;  2HMN A;  3S4R A;  5AW9 B;  3L75 D;  4QDC A;  4JQ0 D;  4PV1 B;  1UII A;  1SQP D;  2XV5 A;  5M1B A;  3TGU J;  1O7H A;  3BAT A;  3A0B H;  4PJ0 E;  2QJK B;  1AQ5 A;  4U3F D;  1JMM A;  1L0L D;  3VMG D;  1VL2 A;  1NTK E;  5CHX A;  4WY4 C;  2WSF J;  1BCC D;  1EZV I;  4N78 E;  2K1A A;  4D6T J;  1LP1 B;  3U1A A;  5KJ7 C;  2Q7C A;  4KHX A;  3CWB J;  4RJT A;  1SFC D;  2XNX A;  2DW3 A;  3LIE A;  4DCK A;  1P84 I;  1W2E A;  1YIT P;  1ZLL A;  1OX3 A;  3BCC J;  3CXH E;  1SQX J;  1YJN P;  4NPF X;  2NWF A;  3VYI A;  4EMJ B;  4IL6 E;  4QDF A;  1BE3 D;  3CCM P;  4C7N B;  4HM4 A;  2AXC A;  2XDJ A;  5C39 A;  5KKZ C;  4BXL A;  2YVJ B;  1BGY G;  2HLO A;  1EZV G;  1N73 B;  2NVF A;  2O01 H;  3H1J G;  2QIW A;  1Q82 Q;  3A2A A;  5CXM A;  4BRY B;  2V7Q H;  2FFD B;  4U7J A;  1EDL A;  4HM3 A;  1SFC C;  3FX0 A;  1RE4 A;  2N1T C;  1S72 P;  2OYI C;  1L4A B;  1T6A A;  1BCC G;  2O01 N;  1FS0 E;  1PL5 A;  3AE6 C;  2YO3 A;  4WY4 D;  3A7O A;  2Q3I A;  3FXE A;  1BGY J;  3P8C D;  4B86 A;  1OVV A;  1S3J A;  3D71 A;  3AE9 C;  1KMI Z;  4MN4 C;  5APW A;  5KLI B;  2YIU B;  2ZYL A;  2B1X A;  1WMK A;  5CCG C;  2A45 G;  1EDK A;  1URQ C;  1OXZ A;  3JCU H;  4NB9 D;  3Q5P A;  5AW6 B;  1LWU A;  2HOD B;  1BE3 G;  3V5B A;  2LXB A;  3II6 A;  1FOS E;  1MUU A;  4WY4 B;  2JDI H;  1BGY D;  2K9J B;  2R32 A;  3MUD A;  3GLM A;  3LW5 H;  1IK7 A;  1EZV D;  4DJG A;  5DJT B;  3CCR P;  3SFD C;  3CXH D;  2Y0E A;  4OGQ B;  2IZ1 A;  2JO6 A;  1VQK P;  1MZ9 A;  3B5N A;  3FOU A;  2R3C A;  2OGU A;  2WTY A;  1RQV A;  2V4H A;  1BDC A;  5KAF H;  2E76 D;  2IZ0 A;  3V2P A;  3VMA A;  1JUN A;  2NZ2 A;  2GBX A;  4DOJ A;  1VPC A;  1JM1 A;  1GL2 B;  4ZKP A;  1PFI A;  1NTM J;  3IFM A;  5APQ A;  5KAI H;  3TF5 A;  3FWL A;  4OGQ D;  5AVR B;  3SSU A;  2WZ7 A;  5AEU A;  3AZC A;  4A7P A;  1NU1 J;  3L4F A;  5CBN A;  3VCA A;  3VN0 A;  3CC4 P;  3V4Q A;  2YFJ A;  3V4W A;  4NBG D;  4EOT A;  3V2Q A;  2QE7 H;  1JY2 N;  1KQL A;  3BCC D;  1RF1 B;  1M57 D;  1YTZ I;  1URQ B;  3C8V A;  3HD7 B;  1NTK K;  4PD4 D;  4N78 D;  2G3A A;  1LTJ A;  2BEQ D;  4EI2 A;  1K73 Q;  3U1C A;  2KNC A;  1KYO H;  2N1T A;  1LWU C;  1BSN A;  3M9H A;  3JCU E;  3RL0 D;  2QJY C;  5DJU B;  2W83 C;  1T8Z A;  1L0L G;  4JF7 A;  3BVH A;  5KAI E;  1D7M A;  1ZN5 A;  1NWQ A;  3AEF C;  2KP8 A;  3AE3 C;  2AXT E;  1IZN B;  2DE5 D;  2C0X A;  1SQP G;  2H88 C;  2J58 A;  2YFL A;  2IX7 C;  3RL0 B;  4YTP C;  2NPS C;  3SWY A;  2OTK E;  4UB6 H;  5H2F E;  4H0L D;  3L74 E;  3AEA C;  3KDP B;  4HH2 A;  1JM0 A;  3GF3 A;  1NVO A;  2HYN A;  5AW7 B;  4AUW A;  1YQ3 C;  1Z56 A;  2R3S A;  4LLH A;  2FYU G;  1SP4 A;  5AVS B;  2MJZ A;  5EFW B;  1NTZ J;  2P67 A;  1SQQ K;  2K88 A;  4LC1 A;  5HL4 A;  4L75 A;  1L0L E;  1YYC A;  1G2C B;  4ASW A;  1HBW A;  2P1J A;  1WQL A;  1GMJ A;  1IC2 A;  2PRR A;  2W90 A;  4EYY Q;  4HM8 A;  3L71 G;  3L70 G;  2B88 A;  5BU5 A;  1X22 A;  2Y9Y A;  2W6J H;  2FFD C;  3BRT B;  1KB9 H;  1S5L X;  2A06 G;  3M91 A;  3GOB A;  1L0N G;  3RK3 E;  1M1J A;  2B24 A;  2YKO A;  1JY3 P;  1ZW0 A;  3E1I A;  1LTS C;  2HPC A;  4CPG A;  2FKW B;  2IFM A;  5AVV B;  3FXD A;  4NBD D;  3E7K A;  1BCC J;  4OWF A;  1BE3 E;  2OYO A;  1Y9B A;  1NTM K;  3RL0 g;  1SFC A;  1LJ2 A;  3USS A;  1JCC A;  4WVZ A;  2QVA A;  2FYU D;  2KB7 P;  3AE1 C;  1X0T A;  3H1J J;  1Q90 D;  3MUD C;  1QX8 A;  2RMZ A;  2XSO A;  3GHG B;  3EN1 A;  4JYC A;  4HJL A;  1E5W A;  1NU1 E;  3TNU B;  1JCD A;  2N9Y B;  2WT7 A;  2O3J A;  3Q3D A;  2YO2 A;  1YJ9 P;  3GL2 A;  1MKM A;  2QPZ A;  2KIK A;  3HTK B;  3JSV C;  3L75 G;  2SPZ A;  1VQ7 P;  2QRX A;  1JOC A;  1EG9 A;  1FAV A;  1PPJ E;  1UUW A;  2YMK A;  1FDI A;  4I7Z B;  2JZA A;  1BSH A;  2NPS A;  2O1J A;  2BEZ F;  4AAY B;  4OGQ C;  2OYI B;  2DE7 D;  3L72 D;  2OAR A;  2IBZ D;  1EXJ A;  1U57 A;  3VMX A;  2QM7 A;  2Q9I A;  4IFD K;  1FZG A;  3G3Z A;  3GW6 A;  2OTJ P;  1AVO A;  3CCV P;  1NTZ G;  1N7S C;  4M3L A;  2XSH A;  3HE4 A;  2HMM A;  1NYK A;  2BCC E;  4R4M A;  5AVT B;  1IFI A;  1XTG B;  3L73 G;  1SJG A;  3CX5 D;  1E79 H;  3PH0 A;  2Q5U A;  5GTI H;  5E79 H;  1SQV J;  5KLV E;  2B87 B;  2FXO A;  1MFZ A;  1HVV A;  1NKZ B;  1RH5 B;  5KLV J;  1HF9 A;  3L37 A;  3H1J D;  4H0L B;  2ZT9 C;  1NAF A;  4W7Y A;  1FZC C;  1NYH A;  1NGM B;  4ZMD A;  4QUR A;  2KS1 B;  2B9B A;  1SLQ A;  3GMA A;  5BU8 B;  3RK3 C;  4UB8 H;  2E42 A;  4NBH D;  4IFF A;  4PD4 E;  1P84 D;  1GU4 A;  4N6J A;  1SQQ D;  1MFT A;  1KYO I;  3G6E P;  2KLV A;  3OW2 O;  2IPP A;  1LP1 A;  2ZFC A;  1O7M A;  1S5L E;  1ZV8 A;  2IFN A;  2ZT9 B;  1VQL P;  3GCE A;  3PRJ A;  3A0B E;  4PJ0 H;  3RK2 C;  1ULJ A;  3BCC E;  4NBE D;  1K8A Q;  2DE6 D;  1K05 A;  4GOF A;  5APS A;  3CMA P;  3RL0 C;  3M0D A;  1PP9 D;  2GUS A;  4NB8 D;  2ZXE B;  5KAF E;  2L91 A;  3CPW O;  3N7N A;  2HR3 A;  2NVG A;  4QDF B;  3A0H E;  2WWW A;  5KKZ B;  4KT0 J;  3HE5 A;  4GT1 A;  4EDF A;  1N7S B;  3AED C;  3P7K A;  1NU1 G;  3U59 A;  2WSE J;  1SQB K;  5E79 E;  1WT6 A;  3L70 D;  1VQN P;  1IFP A;  3AEG C;  2M8R A;  3PTZ A;  3Q1M A;  4BRY A;  4W7Z A;  1Q86 Q;  3RBX A;  1JEK A;  1LT9 C;  1ZR2 A;  4HM0 A;  5K5G B;  1DEB A;  1U7M A;  3B71 A;  1PPJ G;  1ZOY C;  3B5N D;  3P32 A;  3VMI D;  1H88 A;  1FJP A;  3L70 J;  3OJA B;  3P8M C;  1FE6 A;  1J1E B;  2YKP A;  1IFM A;  1Y47 A;  1K9M Q;  1LTA C;  3CCS P;  3B4S A;  1CI6 A;  5CBO A;  3GTS A;  1GU5 A;  1IO4 A;  1LWU B;  1IFJ A;  2FXM A;  2HOD A;  4YXW H;  1VQ4 P;  2I1J A;  4HKV A;  1FZB A;  1SQX D;  2E75 C;  4AYC A;  4WY4 A;  1GW3 A;  1QL1 A;  3M9Q A;  5B5E H;  3LID A;  1URQ D;  1O7N A;  4QMA A;  4HM5 A;  3VMH D;  3WUU A;  1S4X A;  2L5G B;  3ZDM A;  3O8Z A;  2KK7 A;  4RO0 A;  1DD4 A;  1HJ0 A;  2RH0 A;  3LW5 J;  4Y99 C;  2QEX P;  1NTZ E;  1OVU A;  1FDM A;  3ABV C;  1RY3 A;  2GUV A;  2IYP A;  1RIE A;  3IR9 A;  1RE4 C;  1HGV A;  1GL2 A;  1ZRT D;  5APV A;  1OW8 A;  2NRG A;  1FOS F;  4P1C H;  1SQP J;  3TGU D;  3L74 J;  4PV1 D;  4HM1 A;  4ZKU A;  4IL6 X;  1GK4 A;  1LTJ C;  5AW4 B;  2KSJ A;  2I8D A;  3IN6 A;  5APU A;  4AQR D;  1HUC A;  4GOD A;  5KTB A;  1RF1 A;  2JKV A;  1N8R Q;  1KB9 D;  4HYT B;  1KIL B;  3MTU E;  1LTJ B;  2OYH C;  2NUK A;  2KNC B;  2P58 A;  3L72 E;  2CK3 H;  1LT1 A;  3EQQ A;  2WMM A;  4HM7 A;  1KIL D;  3L74 G;  1SQP K;  3D6Z A;  2XRX A;  1LNQ A;  1Q81 Q;  3AE4 C;  2CPS A;  2E75 B;  4Z1M H;  2FYU E;  1JY2 P;  2BCC D;  2ZYA A;  2ZT9 D;  4AIV A;  4XE5 B;  2Y9Z A;  1P84 H;  5AW8 B;  3CX5 E;  4GIF A;  5AW3 B;  2IBZ I;  3GZY A;  1SQV G;  2B89 A;  4HKZ H;  1LTG C;  1GL2 C;  4JBZ A;  5B66 H;  5AVX B;  4H13 D;  1KB9 I;  3CCU P;  1FZA A;  3H1H G;  3G4S P;  3RGU A;  1ZRT E;  2E4P A;  2M5A A;  2KYV A;  2FYN C;  1BDD A;  2Y0C A;  2BMQ A;  3GL0 A;  1NTM E;  1H0T B;  1L0L K;  1VQP P;  3MHV A;  1G2C A;  1PP9 G;  3VOP A;  2N9B A;  3SWF A;  2GM4 A;  2WPV B;  2KI7 B;  1VQO P;  3H1J E;  4QUP A;  1EDI A;  1KQF B;  5AW2 B;  1MV8 A;  3H1I E;  1CSB A;  4IL6 H;  1YBK A;  2N1T D;  1M1J B;  3VP9 A;  2JJL A;  1X9V A;  1KC8 Q;  2HPC B;  2ZYD A;  1KQG B;  2BMR A;  1AA0 A;  2A45 H;  1AQT A;  2JR8 A;  1SQV K;  2ZVO B;  1KZU B;  2D2C B;  1RFS A;  5GTI E;  3L72 J;  1GTW A;  4TLF A;  1SQB E;  2HML A;  3H1K G;  3RK3 B;  1YHQ P;  3WMM 0;  3CX5 H;  1PIX A;  1VDF A;  2Y0D A;  4QDD A;  3Q2Y A;  1A02 F;  1GL2 D;  1J1E C;  1SQX G;  1RF1 C;  1OW6 A;  1SQP E;  3GF7 A;  3GHG A;  3VMZ A;  1YQ4 C;  3T97 B;  3I5C A;  1U7J A;  1S9K E;  4U3F E;  3VMY A;  2YFI A;  3HUS A;  3KZI E;  1GK6 A;  3S9O A;  1H8A A;  3CWB G;  1O7G A;  4L74 A;  1LTB C;  1KN7 A;  1SQX K;  1N7S D;  3PP5 A;  1VM9 A;  1IJD B;  2QJP B;  1OVR A;  3H1L D;  3D89 A;  1T3U A;  2FYZ A;  5AEW A;  1JTH A;  2E74 D;  3NTN A;  3TGU G;  3Q5S A;  1L4A C;  3WU2 H;  3RK3 D;  1EZV E;  3A0H H;  4RES B;  2OYI A;  1SQX E;  4NPE A;  4OVN F;  2PGD A;  1DX7 A;  2E5T A;  3OAK A;  2A06 E;  2O1K A;  1G8J B;  1JY3 O;  3H32 B;  1W5C E;  1GDT A;  3CWB E;  1PZQ A;  1S5L H;  3IAO A;  2NUM A;  3FWN A;  3HE4 B;  3GB4 A;  1GW4 A;  3EFF K;  1SQB D;  1M8O B;  5CJ0 A;  3SFE C;  4OH8 B;  2OYH A;  4H13 B;  3KPE A;  1H89 A;  4I7Z C;  2WSF H;  3PLN A;  4P1B H;  5CCG D;  2IBZ G;  3O6Q B;  4LGD E;  2J5U A;  1K04 A;  2CKF A;  1NU1 D;  4N3Y B;  4O9B A;  3C9I A;  2XND H;  1KOR A;  3TGU E;  1KD1 Q;  1W2B O;  3QH9 A;  1S2E A;  1VQ8 P;  5B5E E;  2LXC B;  4W80 A;  1NTZ D;  2KS1 A;  1XTC C;  2NVE A;  2MKV A;  1VCK A;  1NOH A;  3GKE A;  1HTL C;  3M0A A;  1NO4 A;  2KSE A;  3H1I G;  1USE A;  5GTH E;  1TU3 F;  1NJI Q;  3G71 P;  1FZC A;  1R5L A;  1L2P A;  1G8K B;  3I55 P;  2W6B A;  2I7F A;  3S1K A;  2YXR B;  1GD2 E;  2KZI A;  3CD6 P;  1AFO A;  5BVZ A;  2FYN B;  5B66 E;  4NBF D;  3MP7 B;  1NDO A;  4XA4 A;  3CLQ A;  1YI2 P;  4K35 A;  1KTM A;  3C0D A;  2H7H A;  5L8R J;  3L73 D;  3F5H A;  5KLV K;  3EQ2 A;  2HFE D;  2E74 B;  3H1K E;  1AJY A;  2P7J A;  2A06 D;  3A3Y B;  5H2F H;  4EIJ A;  4YXD C;  3AE5 C;  3KYQ A;  1L0N K;  4QCK A;  3HE5 B;  1ZR4 A;  1KIL E;  2JWA A;  2I1K A;  1N7S A;  5KLV G;  3H1L J;  1L0N E;  3MZW B;  3H25 A;  2FY8 A;  4U3F G;  5APT A;  2FBW C;  1N86 A;  3E1R A;  2RKL A;  1LT9 B;  1FJK A;  1YTZ T;  5KLI C;  2ZVN B;  2XKM A;  1OFC X;  1UUV A;  4Y99 B;  1ULI A;  1RQU A;  1QVF O;  2C9L Y;  1L0N J;  4GKG A;  2H8P D;  2XU6 A;  3NFQ A;  4NPD A;  4C46 A;  2BCC J;  4R4L A;  1G1J A;  1SQV E;  3Q5R A;  1J1D C;  4IFM A;  1P84 E;  3VTP C;  1PGJ A;  1KFM A;  1EQ7 A;  1OZH A;  4C7R A;  4L76 A;  1CW5 A;  1QL2 A;  1JY2 O;  3L71 J;  1OW7 A;  1Q7Y Q;  3CXH H;  3H1H E;  2RN0 A;  3CME P;  3R4Y A;  1CI6 B;  4HM6 A;  1PGO A;  2XZR A;  1IFN A;  1QLE D;  2BAS A;  3I56 P;  3RK2 B;  5CCH D;  1M7L A;  2D2C D;  1X8Y A;  1PPJ D;  2E43 A;  3CC2 P;  4KJM A;  1PP9 E;  2H43 A;  2PAJ A;  3CWB D;  1RHZ B;  3VCP A;  1J2J B;  2JO1 A;  5AVY B;  3W67 A;  1AV1 A;  1NHL A;  3TDK A;  1OWA A;  4C7N A;  4D6T E;  2Q1K A;  1QEX A;  1T2K C;  3CCL P;  2IBZ E;  3H1L G;  1T3J A;  2K37 A;  5AVQ B;  1N73 A;  3N0Q A;  2JP3 A;  1LTI C;  1M1J C;  4PD4 H;  4K3A A;  3AEB C;  1A02 J;  4GOE A;  1NTM D;  2FFD A;  3CI9 A;  2WQY C;  2WSE H;  1OMI A;  4WB4 A;  1N2D C;  2WPS A;  4DT0 A;  2WPR A;  1L4A A;  1L4A D;  1SQB G;  1JMB A;  2KUB A;  2A45 I;  2QJK C;  3V2R A;  2AEJ A;  1DD3 A;  2QA4 P;  4PV1 C;  2J59 M;  4GDO A;  1VQ6 P;  2R44 A;  3GZX A;  2Q3E A;  1KIL A;  1RF0 C;  2GBW A;  1VF5 B;  3W68 A;  5TIS H;  5TJH A;  3RK2 D;  2ZAE B;  1FC2 C;  2XR8 A;  1NH4 A;  3CXH I;  4PD4 I;  4RKU J;  5AW0 B;  2JWD A;  1BE3 J;  1BCC E;  1J1D B;  1SQQ G;  3HUS C;  3V6I A;  2E74 C;  2UWJ E;  2G8Y A;  3M0D C;  3BAS A;  5CCH C;  4ASV A;  2GA1 A;  1LTT C;  1ZXG A;  2P2U A;  2FXP A;  4HJG H;  3PHL A;  2FYU K;  1S1C X;  2K9J A;  3L73 J;  4WWI A;  3CL3 D;  1KYO E;  2E76 C;  1HWT C;  3NMD A;  3B5N B;  3QWO C;  3KZI H;  1Q2N A;  1S9K D;  1SQQ J;  1YIJ P;  4D6T D;  2WSC H;  3L75 E;  3AEE C;  1FQT A;  2VRS A;  1AVY A;  2YNY A;  3L74 D;  4UB8 E;  5KJ7 A;  2POH A;  1L0L J;  4U3F J;  1R8E A;  4HM2 A;  1ZME C;  2QJP C;  1QGK B;  1N73 C;  2W8Z A;  2M5A B;  4IOI H;  3A5T A;  5KLV D;  5AVZ B;  2YIU C;  3L75 J;  3NXS A;  1SQQ E;  2HMK A;  4H0L C;  3B5N C;  1H0T A;  2JEE A;  1NKN A;  1GZL A;  3JC2 2;  1FBM A;  1USD A;  2C0W A;  2K9Y A;  1SVF A;  2M0B A;  5AW5 B;  3K5B A;  3KQG A;  1URQ A;  2CPB A;  3L72 G;  3HD7 A;  2E4Q A;  1NTK D;  4YPC A;  2Z5H A;  3GTE A;  1CZQ A;  1SQB J;  1YJW P;  4H44 C;  5APY A;  3F89 A;  3P8C E;  2N1T B;  2O01 J;  3N4X A;  3L73 E;  2Z4E A;  4NBB D;  1VQ9 P;  3CC7 P;  1Y8A A;  2PP6 A;  1EC5 A;  3L71 D;  5AVU B;  3H1I J;  3UIA A;  4NBA D;  4I2L C;  1VF5 C;  3VP8 A;  4D6T G;  1KV4 A;  4HB1 A;  1PGP A;  3ITK A;  3RBZ A;  1HH0 A;  1LGH B;  1IK9 A;  3WU2 E;  2YMY A;  4WBA A;  5CJ4 A;  2AXT H;  4L73 A;  1FU1 A;  1L0N D;  2R5D A;  1HGZ A;  2WPQ A;  3H6P A;  2M3B A;  2WSS H;  2KOG A;  2AEF A;  3PJS K;  5CCG A;  3T97 A;  2IDB A;  4Y28 J;  1WRG A;  1QVG O;  3HD7 D;  3EWK A;  3AEC C;  1IFD A;  3B8E B;  1HJB A;  3HUS B;  2BMO A;  2Z5I A;  2IYO A;  3HD7 C;  1JY3 N;  3G9R A;  1JNM A;  3WUT A;  3L35 A;  1R5S A;  3M06 A;  2C9N Y;  1NTK G;  1DEE G;  3DQY A;  1FZE A;  2E75 D;  2R5B A;  3EFG A;  1ZP0 C;  3D70 A;  3WUV A;  1OIP A;  1KQS O;  1FZF A;  2K3R A;  2WSC J;  3L36 A;  1NTM G;  2P10 A;  1JTH B;  4XFJ A;  2FYU J;  1NTZ K;  1SS1 A;  2QM8 A;  3R2P A;  2ITA A;  1PP9 J;  1M90 Q;  3OA7 A;  1Q90 C;  3CCE P;  3KXD A;  1X79 B;  2W27 A;  3H1K D;  1NU1 K;  2QJY B;  2ZYG A;  1VF5 D;  3KHU A;  1JO5 A;  5GTH H;  5AVW B;  2WVR A;  3TSI A;  3H32 A;  3MD0 A;  3TYY A;  4JPZ B;  1KYO D;  3L71 E;  2KZJ A;  2ZXX A; 
#chains in the Genus database with same CATH homology
 4QCK A;  1FDO A;  3VMH D;  4NBC D;  2DE5 D;  2H88 C;  1KIL E;  2YFL A;  1DD4 A;  4YTP C;  1HJ0 A;  3AE8 C;  3LW5 J;  3H25 A;  1L0N E;  1NTZ E;  2HMO A;  4H0L D;  3ABV C;  3L74 E;  1O7W A;  2FBW C;  3AEA C;  1EXI A;  1RIE A;  3D6Y A;  2V7Q J;  3O6Q A;  3GF3 A;  5KLI C;  1YQ3 C;  5BOK A;  1OW8 A;  4TT3 H;  3AE2 C;  2E76 B;  4P1C H;  2HMJ A;  2H89 C;  2D2C C;  1UUV A;  4PV1 D;  1ULI A;  4HM1 A;  4IL6 X;  1RQU A;  1KB9 E;  1O7P A;  3H1L E;  5HL4 A;  1L0L E;  4R4L A;  1SQV E;  3IN6 A;  1WQL A;  3Q5R A;  1GMJ A;  1P84 E;  4HM8 A;  4QUQ A;  2QSI A;  1OW7 A;  4H44 D;  3H1H E;  1S5L X;  2NUK A;  3R4Y A;  4HM6 A;  1PV3 A;  3L72 E;  3GOB A;  3RK3 E;  3EQQ A;  2B24 A;  4HM7 A;  1UIX A;  2D2C D;  3D6Z A;  2XRX A;  4H44 B;  3AE4 C;  1PP9 E;  3FGA D;  2E75 B;  1DIP A;  4Z1M H;  1JB0 J;  2FYU E;  4NBD D;  2OQQ A;  3VCP A;  2JO1 A;  1BE3 E;  1Y9B A;  3RL0 g;  2ZT9 D;  4AIV A;  3AE7 C;  2IBZ E;  3CX5 E;  3AE1 C;  3GZY A;  1Q90 D;  3N0Q A;  2JP3 A;  2Q3W A;  2XSO A;  3EN1 A;  3L70 E;  4H13 D;  3AEB C;  4HJL A;  1NU1 E;  2WQY C;  1ZRT E;  3Q3D A;  4H13 C;  2E4P A;  1OMI A;  2HMN A;  2FYN C;  4QDC A;  3GL2 A;  1MKM A;  2QPZ A;  4PV1 B;  2BMQ A;  2QJK C;  5M1B A;  3GL0 A;  1NTM E;  1O7H A;  1DD3 A;  4PV1 C;  4GDO A;  3VMG D;  1EG9 A;  2WPV B;  1PPJ E;  1UUW A;  3GZX A;  2YMK A;  1VL2 A;  3H1J E;  1NTK E;  4QUP A;  1FDI A;  2GBW A;  1VF5 B;  2WSF J;  4I7Z B;  1KQF B;  2JZA A;  2XR8 A;  3H1I E;  4RKU J;  2BEZ F;  4AAY B;  4OGQ C;  1BCC E;  2DE7 D;  2E74 C;  2G8Y A;  1EXJ A;  1U57 A;  1KQG B;  2BMR A;  2FXP A;  1S1C X;  3CXH E;  2NWF A;  1KYO E;  2D2C B;  1RFS A;  4EMJ B;  4QDF A;  2E76 C;  2XSH A;  1SQB E;  2HMM A;  4HM4 A;  2HML A;  1NYK A;  2BCC E;  4R4M A;  1PIX A;  5KKZ C;  2YVJ B;  4QDD A;  3L75 E;  3Q2Y A;  3AEE C;  1FQT A;  1SJG A;  1OW6 A;  1SQP E;  3GF7 A;  2NVF A;  1YQ4 C;  3T97 B;  2QIW A;  5KLV E;  5CXM A;  4U3F E;  1R8E A;  2YFI A;  4U7J A;  4HM2 A;  3S9O A;  1ZME C;  1HF9 A;  4HM3 A;  2QJP C;  4H0L B;  2ZT9 C;  1O7G A;  1NYH A;  1NGM B;  4QUR A;  2YIU C;  3GMA A;  1SQQ E;  2HMK A;  1VM9 A;  4H0L C;  1PL5 A;  3AE6 C;  4NBH D;  3D89 A;  2K9Y A;  5AEW A;  4PD4 E;  2E74 D;  3D71 A;  3AE9 C;  1KMI Z;  2E4Q A;  3GTE A;  2ZYL A;  4H44 C;  3Q5S A;  2B1X A;  1WMK A;  1O7M A;  2ZT9 B;  2O01 J;  3GCE A;  4NB9 D;  3Q5P A;  1EZV E;  1ULJ A;  1SQX E;  3L73 E;  4NBB D;  3BCC E;  4NBE D;  2DE6 D;  1K05 A;  2A06 E;  4NBA D;  1VF5 C;  1G8J B;  4NB8 D;  3GLM A;  1IK7 A;  3CWB E;  2NVG A;  3SFD C;  4QDF B;  3IAO A;  4OGQ B;  2NUM A;  2JO6 A;  4KT0 J;  3FOU A;  3GB4 A;  3AED C;  3SFE C;  1RQV A;  4H13 B;  2WSE J;  4I7Z C;  2E76 D;  4P1B H;  2NZ2 A;  2IDB A;  3AEG C;  2J5U A;  4Y28 J;  2GBX A;  3Q1M A;  1K04 A;  1JM1 A;  2CKF A;  3EWK A;  3AEC C;  1KOR A;  2BMO A;  3TGU E;  4HM0 A;  3G9R A;  3B71 A;  4OGQ D;  5AEU A;  3AZC A;  2NVE A;  1ZOY C;  3VCA A;  3DQY A;  2MKV A;  1VCK A;  3VMI D;  2YFJ A;  2E75 D;  1ZP0 C;  3GKE A;  3D70 A;  4NBG D;  1TU3 F;  2WSC J;  2P10 A;  3C8V A;  4XFJ A;  1G8K B;  2G3A A;  2I7F A;  2BEQ D;  1Q90 C;  3GTS A;  4NBF D;  1NDO A;  1VF5 D;  2QJY C;  4HKV A;  1KTM A;  3C0D A;  5L8R J;  2E75 C;  2E74 B;  3H1K E;  1AJY A;  3L71 E;  3AEF C;  3AE3 C;  3AE5 C;  4YXD C;  1O7N A;  4HM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...