1VF5D

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
b'DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B6
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
molecule tags Photosynthesis
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1vf5D02
1NDOA 2Q3WA 5CXMA 1BCCE 2NVGA 4H13D 4NBGD 4QDFB 1UUVA 1NTKE 1ZRTE 3L70E 4NBED 1O7PA 1L0NE 2B1XA 3TGUE 2FYUE 4OGQD 3CX5E 1O7GA 1VF5D 1NTME 2YFLA 2E76C 2NUMA 4HM2A 1Q90C 2HMKA 2GBXA 4EMJB 4P1BH 2QJKC 1RFSA 1ULJA 1PPJE 4U3FE 2JZAA 1KB9E 3VCPA 4HM7A 3CXHE 4NBAD 5KLIC 4PD4E 4QDCA 2HMMA 1P84E 2XSHA 2DE6D 3L73E 4QUQA 4HM0A 3GOBA 4HM5A 1SQBE 1SQPE 2E75C 4PV1C 3GL2A 1WQLA 2YMKA 1NTZE 3VCAA 2E4PA 5AEWA 2DE5D 5KLVE 3GB4A 4HJLA 4NBFD 4H44D 5KKZC 3H1KE 2ZT9D 4HM4A 4QDDA 2I7FA 1KYOE 4QUPA 4NBBD 1UUWA 1ULIA 2DE7D 2D2CD 4H13C 1O7WA 2QPZA 1NYKA 4I7ZC 2NVEA 1O7HA 4P1CH 1O7MA 3GZXA 2HMLA 3VMGD 4QURA 1PP9E 4QCKA 4HM3A 4H0LD 4HKVA 4OGQC 4NB9D 1VF5C 2XR8A 2ZYLA 2YIUC 3H1JE 3C0DA 4AIVA 2JO6A 2BMRA 2NVFA 2A06E 1SQVE 2E74D 2YVJB 2YFIA 3GTEA 4NBCD 4HM1A 1G8JB 3L71E 3GKEA 4HM8A 2HMNA 2QJPC 3D89A 3EQQA 1SQXE 3GZYA 2NWFA 2E76D 1SQQE 3L75E 3BCCE 3H1LE 2NUKA 3AZCA 3EN1A 2HMOA 4AAYB 1SJGA 4NB8D 1EZVE 4H44C 1JM1A 2XRXA 3GCEA 2ZT9C 2BMOA 3VMID 1L0LE 2HMJA 2BMQA 3CWBE 4NBDD 1G8KB 3GTSA 1FQTA 3VMHD 3FOUA 2D2CC 2IBZE 3GL0A 2XSOA 1NU1E 3L72E 4QDFA 5AEUA 3N0QA 3H1HE 3L74E 2FYNC 1EG9A 5HL4A 1RIEA 5BOKA 3H1IE 4H0LC 2E75D 4PV1D 2CKFA 1VCKA 2B24A 1O7NA 4HM6A 1VM9A 1BE3E 2YFJA 3DQYA 2QJYC 2GBWA 2BCCE 4NBHD 2E4QA 2E74C
chains in the Genus database with same CATH superfamily
1NDOA 1M8OB 1PP9G 3V2QA 1LTBC 3FX0A 4C7NB 2JJLA 4JBZA 1O7GA 1FZFA 1VF5D 1RF1C 1RFSA 1KB9E 2FBWC 1P84D 3BCCG 3D6ZA 1FZCB 3RL0B 1Q2NA 3D71A 2LXCB 2OYIA 2K3RA 3GOBA 1LT9B 1NTZD 2YMKA 4ZKUA 3KHUA 1L0NJ 4PJ0E 3AE6C 1Y9BA 1NYKA 1VQNP 2K9JB 1YYCA 2KI7B 3H1JE 1RQVA 3VMAA 1YTZI 1SQVJ 1L0LG 2YVJB 1PGPA 3BATA 5KLVK 1G8JB 4R4LA 2XZRA 1CI6B 3CXHH 1DH3A 4PD4H 5CHXA 3L75J 3Q5PA 2CPSA 2BMOA 3VYIA 3VMYA 1SQPG 3GL0A 1NU1E 3H1IJ 1RIEA 1BGYG 1JB0J 3D70A 3TNUB 1VQ5P 2PGDA 2E4QA 1BSNA 2PFXA 4DCKA 3WU2H 4NBGD 1HJBA 3HE5A 2ZYAA 1N7LA 3CWBJ 2E74B 2FYUJ 2NUMA 2YXRB 1OVVA 2M5AA 1PPJD 1KFNA 4U3FD 2WT7A 2XNXA 2FXPA 1PIXA 3CXHE 4L76A 5KLIC 3VTPC 4PD4E 4QDCA 1LTJA 1QGKB 1QLED 5K5GB 4WB4A 3GL2A 5KKZC 1GW3A 3CPWO 1N73B 5KJ7C 4TT3H 2Q5UA 1MFZA 1SP4A 1JY2O 3VMXA 3WMM0 3NXSA 4GOFA 3L73J 3WU2E 5APTA 2NPSD 3TGUG 1RY3A 2QE7H 1JEKA 2KB7P 4XFJA 2OYHB 3N4XA 1S5LX 4QMAA 3RK3E 5CCGC 3FWLA 4AAYB 3B4SA 3A0BH 4H44C 5AVYB 2W6BA 5AW9B 3IFMA 2Q7CA 2BMQA 3VMHD 3L72D 3T97A 1UIIA 1ZP0C 4UB8E 1X8YA 1QVGO 5BOKA 4WY4D 4HKZH 4PV1D 1OX3A 1KQLA 3E1IA 1O7NA 2NPSA 2D2CB 2BCCD 4HJGH 1BCCD 1YJ9P 2NVGA 2N1TD 3G6EP 1OWAA 1QVFO 3L70E 4OGQD 3RK2B 1DEBA 4KHXA 3SSUA 1ULJA 5DJUB 3VP8A 3ITKA 2JZAA 2KLUA 1KV4A 1AVYA 1SFCD 4WY4A 1FU1A 1GW4A 3L37A 1ZRTD 2N1TA 4HYTB 1PZQA 5KLVE 3FGAD 3L35A 1NTMJ 2C9NY 1NHLA 3M06A 1OMIA 5APVA 1AQTA 3HUSA 2O01J 1O7HA 2OYIB 1JCCA 1ZR4A 1PP9E 4OWFA 4NB9D 1GD2E 3AEGC 1L4AD 2JWDA 1JUNA 3BASA 3H1JJ 2YIUC 1PGQA 2NVFA 1A02F 1ZOYC 3OA7A 4EDFA 2KOGA 2POHA 1K05A 1ZMEC 1VF5B 2FY8A 1FZEA 1YQ3C 3BRTB 4AQRD 3BCCE 2QM7A 1FC2C 1VQMP 2KSEA 2ZXEB 1L0LD 1X0TA 1RE3C 4DJGA 2WVRA 1KB9I 1WT6A 1L4AA 1XTGB 1AA0A 1BE3D 2YKPA 1SQXK 3AE4C 3H1KD 3AE9C 3GMAA 4YXDC 1LNQA 1JMMA 1EDLA 2PP6A 1RHZB 1IFIA 4ASWA 1N7SC 2VRSA 3SWYA 2KP8A 1S9KD 1BGYD 3RK3C 5BVZA 2YFLA 3L71G 2M8RA 2ZT9B 1NJIQ 3B5ND 1RE4A 4EYYQ 2Y0EA 3HE5B 2J59M 1RQUA 1EZVG 1SQPE 1LTGC 2Y0DA 4Z1MH 2M5AB 1QL1A 2WT7B 1KILE 2HG5D 1MUUA 1FJPA 1LTJB 3H6PA 1DX7A 4P1CH 3S9OA 2H7HA 2YMYA 3USSA 4H0LD 1GU4A 3B5NA 3V2NA 2JEEA 2IDBA 2KYVA 5KAIH 3FWNA 4IL6X 1SQVD 2QJKB 4XE5B 3MIWA 2BASA 1H88A 1NU1G 1N86A 1IFDA 1KFMA 1SQQD 3L75D 1IJDB 2FXOA 1HTLC 3JC22 2KNCA 1SJGA 4NPFX 4N3YB 4NB8D 1J1DC 1KN7A 2FXMA 3TYYA 1EXIA 3GTSA 1OW8A 1YBKA 1FZGA 3CXHI 3H1ID 1KMIZ 3F5HA 3IF4A 1URQC 1JY3O 2HPCA 1PGOA 2IFMA 2ZVNB 2ZYDA 3H1LJ 1VQPP 3T97B 2MKVA 2QJPB 1IFPA 2FYUD 4L73A 1VL2A 3TGUE 5BU5A 2E76C 3H32A 4HM2A 2K37A 1M7LA 1BDDA 3IR9A 3HTKA 2GUVA 5AVTB 2BCCJ 1YIJP 4EIJA 2QEXP 2XU6A 1NTZK 1JO5A 5BU8B 2E75C 3KZIH 2ZYGA 2QJYB 3VN0A 3H25A 1PFIA 3H1HG 1JMBA 3CCUP 1KYOE 4QUPA 4WY4B 1X79B 4PV1B 2NZ2A 2NVEA 1AV1A 1LJ2A 1PP9J 1Q82Q 3HE4A 1M90Q 2N1TB 1QX8A 1OW6A 1NTKG 4LLHA 2OTKE 3BVHA 1LWUC 4OGQB 3HUSB 5AVWB 1AJYA 2WITA 2WPQA 2G3AA 3HD7C 2KK7A 1VQ4P 1SQXE 3BCCJ 2HMOA 1KILC 3OW2O 2OGUA 2HMJA 3L70G 1KQGB 3N0QA 2H88C 3RL0C 3KZIE 5AW6B 1KB9H 2V4HA 3P8MC 2B24A 1PL5A 2I1KA 2W8ZA 2K1AA 5KJ7D 1L4AB 3II6A 1L0LJ 2GBXA 1MV8A 1M1JB 1NAYA 3NFQA 1KB9D 2AXCA 3M9HA 2IBZI 4HM7A 1NTKK 3OJAB 1SQPJ 5CCGD 4WVZA 5KJ7A 2IBZG 1NTMD 2ZXXA 4H44D 2I1JA 1BGYJ 1H8AA 3L74G 2LR2A 4O9BA 5TJHA 2CPBA 2KXPB 1GZLA 1IK9A 1R8EA 2B9BA 3H1JD 2XR8A 2R5BA 2ITAA 4AIVA 1NWQA 4I7ZB 3LW5J 4D6TG 3P32A 2OQQA 2IFNA 2YKOA 1ZR2A 3L71E 2IYOA 3JSVC 3AEBC 5CCGA 3P8CE 1ZW0A 3B5NB 5AVXB 1IK7A 3EQQA 4Y28J 3AZCA 4RJTA 1M57D 2XV5A 1EZVE 1JM1A 2WPVB 4MN4C 1NU1D 3SFDC 3A0HH 2KNCB 4GOEA 2YFJA 3MTUE 5AVSB 1SQQJ 2KS1A 3WUTA 4H0LB 5H2FH 3P7KA 3CC4P 3MGNA 1USDA 3TGUJ 2HPCB 1MKMA 5APYA 3MZWB 2W83C 2P58A 3CXHD 3OAKA 4PD4D 1RF0C 5CMZA 2GA1A 4Y99C 2FFDC 2DE6D 1S2EA 3H32B 2R3CA 1WQLA 1Y8AA 4JYCA 1CSBA 3Q5SA 3HTKB 1UIXA 3I55P 4QDDA 3A2AA 1MFTA 2HFED 3A0HE 1K9MQ 1N8RQ 4QURA 3PHLA 1HJ0A 1U7JA 3CX5H 3KQGA 5B5EH 2KUBA 4UB8H 5H2FE 1L0NG 1N7SD 2MJZA 2IYPA 4HM8A 3HE4B 5AW4B 1SLQA 3RK3D 3RK2C 3CCLP 1RE3A 4XA4A 1G2CA 3GG2A 3W68A 3FOUA 4EOTA 1VDFA 3H1HE 4HH2A 4DZOA 3CMEP 1N7SA 3H1LD 3M0DC 5CXMA 1Q90D 3MHVA 3SWFA 3L70D 3O8ZA 1NTKE 1KYOI 2A06G 2B1XA 3CX5E 5B5EE 1LP1A 1NGMB 1SS1A 3M0AA 2QIWA 3WUUA 2HMMA 4ASVA 1HGZA 4HM5A 5DJTB 1L0NK 2WPSA 2V7QH 5KLVD 5KLIB 2ZAEB 5AEWA 3TK1A 2I7FA 1TU3F 1GL2C 2WQYC 3Q1MA 4KJMA 1PP9D 1N2DC 1SQXG 3CCEP 1URQD 1NH4A 3GHGC 1SQVK 3ABVC 3TDKA 1W5CE 3KPEA 1VQ8P 2HMNA 2P67A 3C1LA 1YTZT 3V4WA 2OYOA 1NKNA 1K8AQ 1YJNP 2QVAA 3BCCD 2E76D 3W67A 3CCJP 1Q7YQ 1VQ9P 3G9RA 2ZT9C 2WSEH 3L73G 1U57A 1SQBG 4GDOA 1G8KB 1FQTA 4L74A 1SFCA 2IBZE 4RESB 2GUSA 1VQ7P 3SWKA 2R44A 3L74E 4H44B 1EG9A 2E75D 4W7ZA 3R2PA 3U1AA 3DQYA 1M1KQ 2BEQD 3AE1C 1VQKP 2KZIA 1LTJC 1OIPA 1ZRTE 4D6TE 2R32A 4K35A 4CPGA 2L91A 1NU1J 2HMKA 2RN0A 4P1BH 2RH0A 1FDIA 3K5BA 1JY2P 2KS1B 2QJKC 3PP5A 2XNDH 2UWJE 1G1IA 1NAFA 1FOSE 3O6QA 4OH8B 4GT1A 2CK3H 1SQPD 3HD7D 1ZV8A 5CCHC 1KILD 2DE5D 2GM4A 4HB1A 3AE2C 4NBFD 2P2UA 4JQ0D 1AQ5A 4NBBD 1EZVI 1S72P 3RL0D 3V4QA 4HKVA 1SQBK 4N78E 1M56D 2AEJA 3CCRP 4NBCD 3KDPB 3HD7A 1P84I 2QJPC 1JY2N 1AVOA 1KILA 5AVRB 1KQSO 4M3LA 1GDTA 1IFMA 2M0BA 2XRXA 3VMID 1FAVA 4U7JA 1ZLLA 2O01N 1NTZG 3Q5RA 1CZQA 2FYNC 2W6JH 2CKFA 2AEFA 1G2CB 3TF5A 3UIAA 2I8DA 2WSSH 3A5TA 1GMJA 2QJYC 1T3UA 1JM0A 1KORA 4IOIH 2P10A 3TGUD 2Z5HA 1L0NE 1KYOH 5TISH 1N7SB 1GU5A 2WTYA 4EMJB 1Y47A 1YHQP 2IZ0A 3R4YA 3RK3B 4NBAD 2O1JA 4RO0A 1GK4A 2C9LY 2E5YA 1IZNB 1LP1B 2B88A 2N9BA 3L70J 3RBZA 1NTMK 3RBXA 1RF1A 2NPSB 1KYOD 4I6MC 4W80A 2DE7D 4H13C 2HR3A 3CCMP 5AVZB 4QCKA 4OVNF 3V2PA 4IL6H 2KSJA 1HH0A 4GODA 2A06E 2WPRA 4HM1A 5KLVJ 5KAFE 4BWNA 1U7MA 1EDKA 4N6JA 5B66E 5TISE 1PPJG 4U3FG 4AYCA 3EN1A 2M3BA 3CX5I 2AEMA 2YO3A 3HRNA 1M1JC 3I5CA 2LXBA 3M91A 3CWBE 4NBDD 1YI2P 1USEA 2Z5IA 1J1DB 3L74J 2V7QJ 1KD1Q 1IO4A 1NYHA 3B8EB 3V2RA 4K3AA 2Q9IA 2P7JA 4NBHD 2Y9ZA 1LTIC 1RE4C 1SFCB 1VPCA 2J58A 4IL6E 4D6TJ 1X9VA 5AVUB 2SPZA 1H0TA 3U1CA 1FZCC 2E42A 4LC1A 1BDCA 1RF0A 1LT9C 4C46A 2FFDA 3AE5C 3CCVP 5AVVB 2E76B 2ZVOB 3L73E 1SQBE 1T2KC 3B5NC 2YKQA 2FKWB 4HJLA 2HYNA 3L72G 5L8RJ 5AW0B 1VQOP 3AEFC 3O6QB 2Y0CA 1MZ9A 3BRVB 4RKUJ 2E75B 1ULIA 2QPZA 2OARA 2HMLA 2BCCG 1BCCG 1KC8Q 2KLVA 2JO6A 5APQA 5M1BA 5CBOA 4DOJA 1JY3P 3LIEA 3L71D 1KTMA 3QWOC 2R3SA 1J1EB 1IFNA 5CJ4A 1Q86Q 2JP3A 1P84H 3GZYA 2YNYA 1EZVD 3JCUH 3TSIA 1HBWA 3AEDC 3HD7B 2HLOA 2WSCH 1FDOA 1R5LA 1KILB 4QDFA 1W2BO 2W6AA 5HL4A 3CC7P 4I1LA 3GW6A 2IX7C 3V5BA 1AFOA 3M0DA 3D6YA 3C8VA 5AW2B 2E74C 3PLNA 1NO4A 2LKMA 1G1JA 1GL2D 1FBMA 5AW8B 1JY3N 4W7YA 1D7MA 1PV3A 3CCQP 1NTME 3CC2P 1T6AA 2RMZA 1EDIA 1W2EA 3GF3A 3GF7A 3VCPA 3E7KA 3AE3C 1FE6A 1P84E 3L36A 1RH5B 4QUQA 2L5GB 1N73C 4I2LC 3WUVA 3JCUE 1NTZE 1GL2A 3M9QA 1S3JA 1LTTC 2ZT9D 3IAOA 1XTCC 2QM8A 4IFFA 3N7NA 4YTPC 3G3ZA 2Y9YA 3GHGA 1GK6A 1BE3G 2QA4P 2HODA 3H1KG 4WWIA 3SFEC 1RF1B 2BMRA 4ZMDA 2OYHC 5AW7B 1CW5A 3EFGA 5AW1B 2B87A 1HWTC 1DIPA 4BXLA 3LIDA 3NMDA 3MD0A 2WMMA 2WSFH 2XKMA 1S1CX 2JWAA 2D2CC 2C0WA 3H1HD 1JCDA 3MUDC 1WMKA 5CCHD 1VCKA 5APXA 1E5WA 2Q3IA 1SQXJ 3AEAC 1OVUA 3AE8C 1NTKD 1L0LK 4R4MA 1BSHA 3CX5D 1SQVG 2OTLP 3NTNA 1H89A 1EDJA 2JKVA 1X22A 1PPJE 4U3FE 3IN6A 1OW7A 1OXZA 1SQQG 3L75G 2KZJA 5CCHA 5GTHH 1SQPK 1H0TB 2PAJA 3VP9A 1SQBJ 4YPCA 2OYIC 1JOCA 2K9YA 4BRYA 4Y99B 2FFDB 3M9BA 4HM4A 2PRRA 3H1IG 1LTSC 1KZUB 4HM3A 3I56P 2H89C 1E79H 1VF5C 1OZHA 4ZNCA 1FDMA 2YFIA 3CWBG 1PGJA 4NPDA 2FYUG 2QRXA 2WZ7A 2A45I 4IFDK 1JTHA 3H1LE 5AW5B 3Q3DA 5KKZB 2R5DA 2A45G 4UB6H 2IBZD 5GTHE 2FYZA 1QL2A 3L72E 4NPEA 3L74D 5AVQB 3V6IA 2YO2A 3L71J 3B71A 1S5LH 1EXJA 1SQQK 2BCCE 1Z56A 1BCCE 3EWKA 1FZAA 3E1RA 4H13D 4QDFB 3PH0A 4TLFA 4D6TD 1UUVA 1R5SA 3A0BE 5EFWB 1EQ7A 1URQA 2M3EA 2YXQB 1YJWP 1T3JA 1VQLP 3MP7B 1NTZJ 2FYUK 2E4PA 1A02J 2JR8A 5APWA 4UB6E 2Z4EA 2QG4A 2WSCJ 2O1KA 3PRJA 1IC2A 1S5LE 3GZXA 1FS0E 3VOPA 2N9YB 1DEEG 2IPPA 1JNMA 4JYBA 1GL2B 3CMAP 4N78D 1Q81Q 3PTZA 1L2PA 5APUA 3GLMA 1K73Q 2ZFCA 2C0XA 3GHGB 2HODB 5CBNA 2NWFA 3S4RA 1M1JA 3LW5H 1HVVA 4JF7A 2B87B 1L0LE 1LWUA 3KYQA 1WRGA 2B89A 5AEUA 2QSIA 1NTMG 4DT0A 1T2KD 2YIUB 4C7NA 3AEEC 2DW3A 3CCSP 1VM9A 1BE3E 3A3YB 5APSA 3H1KE 1OFCX 2NPSC 1EC5A 3AECC 1J2JB 3H1JG 4NBED 1L0ND 2XDJA 1FZCA 5C39A 1S9KE 5AW3B 4IFMA 4L75A 1BGYE 3H1HJ 1LT9A 3EFFK 1Q90C 1NVOA 5GTIH 4U3FJ 2E5TA 3CI9A 3C9IA 4HM0A 4WY4C 1NTKJ 4PV1C 2K9JA 2WSFJ 2G8YA 2P1JA 4ZKPA 5KAFH 3VCAA 1OVRA 3GB4A 3FXEA 5B66H 3AE7C 2N1TC 1UUWA 1O7WA 1IFJA 1O7MA 1CI6A 3CL3D 4OGQC 3HUSC 2J5UA 3C0DA 2A06D 4BRYB 2W90A 1SQVE 2E74D 3CLQA 2JO1A 4PD4I 1SFCC 2H43A 2W27A 4YXWH 2A45H 1DD4A 2ZJSE 3L4FA 1SQQE 3L75E 3KXDA 2NUKA 2O3JA 3TNUA 5GTIE 3RGUA 2H8PD 1LT1A 3GCEA 1T8ZA 3CWBD 1HUCA 1NOHA 5KAIE 1JTHB 2RKLA 3FXDA 4AUWA 3L72J 2KIKA 3H1IE 1L4AC 1YITP 1SQXD 3ZDMA 2GBWA 4GIFA 2Q3EA 3G4SP 2Q3WA 1BCCJ 2FYNB 1S4XA 1HGVA 2AXTH 2WWWA 4B86A 5CJ0A 1O7PA 1NU1K 2FYUE 3A7OA 5KTBA 1ZN5A 1N73A 2BEZF 1J1EC 3L73D 2XSHA 2OTJP 1URQB 1SQBD 4A7PA 3S1KA 3U59A 1VQ6P 1LTAC 1YQ4C 4WBAA 4JPZB 5E79H 1FJKA 3F89A 4KT0J 1GTWA 2D2CD 4I7ZC 1FOSF 3CD6P 3Q2YA 1KQFB 3VMGD 1DD3A 3H1LG 2OYHA 2ZYLA 4H13B 3EQ2A 1QEXA 3RK2D 3GTEA 2AXTE 3VMZA 2WSEJ 3GKEA 1ZXGA 2Q6QA 3D89A 2IZ1A 4C7RA 1NKZB 2NRGA 1K04A 1SVFA 1FZBA 2E43A 1LGHB 4LGDE 2JDIH 4PJ0H 3G71P 2K88A 2Q1KA 3MUDA 2XSOA 1HF9A 5KLVG 2O01H 4GKGA 4H0LC 3P8CD 3QH9A 4EI2A 5E79E 3PJSK 1BE3J 3H1KJ 3RL0g 4HM6A 1LWUB
chains in the Genus database with same CATH topology
1NDOA 2BEQD 3AE1C 3AEAC 3AE8C 3T97B 2MKVA 4R4MA 1ZRTE 1VL2A 3TGUE 1O7GA 1VF5D 2E76C 4HM2A 2HMKA 4P1BH 1FDIA 2QJKC 1RFSA 1PPJE 4U3FE 3IN6A 1KB9E 1OW7A 2FBWC 3O6QA 3D6ZA 3D71A 3GOBA 2E75C 2YMKA 2DE5D 3AE2C 4NBFD 2K9YA 3H25A 3AE6C 4HM4A 1Y9BA 1KYOE 4QUPA 4NBBD 4PV1B 1NYKA 2NZ2A 2NVEA 4HM3A 4HKVA 2H89C 1VF5C 3H1JE 1RQVA 1OW6A 2YVJB 2YFIA 4NBCD 4OGQB 1G8JB 4R4LA 2QJPC 1AJYA 2G3AA 1SQXE 3H1LE 3Q3DA 3Q5PA 2HMOA 2XRXA 2BMOA 3VMID 2HMJA 4U7JA 1KQGB 3GL0A 1NU1E 3L72E 3Q5RA 3N0QA 2H88C 2FYNC 3B71A 1RIEA 1JB0J 3D70A 2CKFA 2B24A 1EXJA 1PL5A 1GMJA 2QJYC 2BCCE 2E4QA 1KORA 1BCCE 3EWKA 4H13D 4NBGD 4QDFB 1UUVA 2P10A 1L0NE 2E74B 2NUMA 2GBXA 4EMJB 3R4YA 2FXPA 4HM7A 1PIXA 3CXHE 4NBAD 5KLIC 4PD4E 4QDCA 3GL2A 2E4PA 5KKZC 4H44D 2WSCJ 4TT3H 2DE7D 4H13C 3GZXA 4QCKA 1R8EA 2XR8A 4AIVA 4I7ZB 2A06E 3LW5J 2OQQA 3GLMA 4HM1A 3L71E 3AEBC 4XFJA 1S5LX 1IK7A 3EQQA 2NWFA 3RK3E 4Y28J 3AZCA 3EN1A 4AAYB 1EZVE 4H44C 1JM1A 1L0LE 2WPVB 3CWBE 2BMQA 4NBDD 3VMHD 1ZP0C 5AEUA 2QSIA 2V7QJ 5BOKA 3SFDC 4PV1D 1NYHA 3AEEC 1O7NA 2D2CB 1VM9A 1BE3E 2YFJA 4NBHD 3H1KE 2NVGA 4H0LB 3AECC 3L70E 4NBED 4OGQD 1MKMA 1Q90C 1ULJA 2JZAA 3AE5C 2E76B 2DE6D 3L73E 4HM0A 1SQBE 4PV1C 1WQLA 2WSFJ 2G8YA 3VCAA 5KLVE 3FGAD 3GB4A 4HJLA 5L8RJ 3Q5SA 1UIXA 4QDDA 3AE7C 3AEFC 1OMIA 1UUWA 4RKUJ 2E75B 1ULIA 1O7WA 2QPZA 2O01J 1O7HA 1O7MA 2HMLA 4QURA 1PP9E 4OGQC 4NB9D 1HJ0A 3AEGC 2J5UA 2YIUC 3C0DA 2JO6A 5M1BA 2NVFA 1SQVE 2E74D 1ZOYC 1KTMA 1ZMEC 1K05A 2JO1A 1VF5B 4HM8A 1YQ3C 2JP3A 1DD4A 3GZYA 1SQQE 3L75E 3BCCE 2NUKA 3GCEA 3AEDC 3FOUA 1FDOA 4QDFA 3H1HE 5HL4A 3H1IE 3D6YA 3C8VA 3AE4C 3AE9C 3GMAA 2GBWA 2E74C 4YXDC 2Q3WA 1Q90D 5CXMA 1NTKE 1O7PA 2B1XA 2FYUE 3CX5E 1PV3A 1NTME 2YFLA 1NGMB 2ZT9B 3GF3A 2QIWA 3GF7A 3VCPA 3AE3C 2BEZF 2HMMA 1P84E 2XSHA 1RQUA 4QUQA 4HM5A 1SQPE 4Z1MH 1NTZE 5AEWA 1YQ4C 1KILE 2ZT9D 3IAOA 2I7FA 1TU3F 4KT0J 4YTPC 2D2CD 2WQYC 3Q1MA 4I7ZC 4P1CH 3S9OA 3Q2YA 1KQFB 3VMGD 1DD3A 4H0LD 2IDBA 2ZYLA 3SFEC 4H13B 4IL6X 2BMRA 3ABVC 3GTEA 2WSEJ 3GKEA 2HMNA 1DIPA 3D89A 2E76D 1K04A 1SJGA 4NB8D 1EXIA 3G9RA 2ZT9C 1U57A 4GDOA 1S1CX 1G8KB 1FQTA 3GTSA 1OW8A 2D2CC 2IBZE 2XSOA 1HF9A 3L74E 4H44B 1KMIZ 1EG9A 4H0LC 2E75D 1WMKA 1VCKA 3DQYA 3RL0g 4HM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDO A;  2Q3W A;  5CXM A;  1BCC E;  2NVG A;  4H13 D;  4NBG D;  4QDF B;  1UUV A;  1NTK E;  1ZRT E;  3L70 E;  4NBE D;  1O7P A;  1L0N E;  2B1X A;  3TGU E;  2FYU E;  4OGQ D;  3CX5 E;  1O7G A;  1VF5 D;  1NTM E;  2YFL A;  2E76 C;  2NUM A;  4HM2 A;  1Q90 C;  2HMK A;  2GBX A;  4EMJ B;  4P1B H;  2QJK C;  1RFS A;  1ULJ A;  1PPJ E;  4U3F E;  2JZA A;  1KB9 E;  3VCP A;  4HM7 A;  3CXH E;  4NBA D;  5KLI C;  4PD4 E;  4QDC A;  2HMM A;  1P84 E;  2XSH A;  2DE6 D;  3L73 E;  4QUQ A;  4HM0 A;  3GOB A;  4HM5 A;  1SQB E;  1SQP E;  2E75 C;  4PV1 C;  3GL2 A;  1WQL A;  2YMK A;  1NTZ E;  3VCA A;  2E4P A;  5AEW A;  2DE5 D;  5KLV E;  3GB4 A;  4HJL A;  4NBF D;  4H44 D;  5KKZ C;  3H1K E;  2ZT9 D;  4HM4 A;  4QDD A;  2I7F A;  1KYO E;  4QUP A;  4NBB D;  1UUW A;  1ULI A;  2DE7 D;  2D2C D;  4H13 C;  1O7W A;  2QPZ A;  1NYK A;  4I7Z C;  2NVE A;  1O7H A;  4P1C H;  1O7M A;  3GZX A;  2HML A;  3VMG D;  4QUR A;  1PP9 E;  4QCK A;  4HM3 A;  4H0L D;  4HKV A;  4OGQ C;  4NB9 D;  1VF5 C;  2XR8 A;  2ZYL A;  2YIU C;  3H1J E;  3C0D A;  4AIV A;  2JO6 A;  2BMR A;  2NVF A;  2A06 E;  1SQV E;  2E74 D;  2YVJ B;  2YFI A;  3GTE A;  4NBC D;  4HM1 A;  1G8J B;  3L71 E;  3GKE A;  4HM8 A;  2HMN A;  2QJP C;  3D89 A;  3EQQ A;  1SQX E;  3GZY A;  2NWF A;  2E76 D;  1SQQ E;  3L75 E;  3BCC E;  3H1L E;  2NUK A;  3AZC A;  3EN1 A;  2HMO A;  4AAY B;  1SJG A;  4NB8 D;  1EZV E;  4H44 C;  1JM1 A;  2XRX A;  3GCE A;  2ZT9 C;  2BMO A;  3VMI D;  1L0L E;  2HMJ A;  2BMQ A;  3CWB E;  4NBD D;  1G8K B;  3GTS A;  1FQT A;  3VMH D;  3FOU A;  2D2C C;  2IBZ E;  3GL0 A;  2XSO A;  1NU1 E;  3L72 E;  4QDF A;  5AEU A;  3N0Q A;  3H1H E;  3L74 E;  2FYN C;  1EG9 A;  5HL4 A;  1RIE A;  5BOK A;  3H1I E;  4H0L C;  2E75 D;  4PV1 D;  2CKF A;  1VCK A;  2B24 A;  1O7N A;  4HM6 A;  1VM9 A;  1BE3 E;  2YFJ A;  3DQY A;  2QJY C;  2GBW A;  2BCC E;  4NBH D;  2E4Q A;  2E74 C; 
#chains in the Genus database with same CATH topology
 1NDO A;  1M8O B;  1PP9 G;  3V2Q A;  1LTB C;  3FX0 A;  4C7N B;  2JJL A;  4JBZ A;  1O7G A;  1FZF A;  1VF5 D;  1RF1 C;  1RFS A;  1KB9 E;  2FBW C;  1P84 D;  3BCC G;  3D6Z A;  1FZC B;  3RL0 B;  1Q2N A;  3D71 A;  2LXC B;  2OYI A;  2K3R A;  3GOB A;  1LT9 B;  1NTZ D;  2YMK A;  4ZKU A;  3KHU A;  1L0N J;  4PJ0 E;  3AE6 C;  1Y9B A;  1NYK A;  1VQN P;  2K9J B;  1YYC A;  2KI7 B;  3H1J E;  1RQV A;  3VMA A;  1YTZ I;  1SQV J;  1L0L G;  2YVJ B;  1PGP A;  3BAT A;  5KLV K;  1G8J B;  4R4L A;  2XZR A;  1CI6 B;  3CXH H;  1DH3 A;  4PD4 H;  5CHX A;  3L75 J;  3Q5P A;  2CPS A;  2BMO A;  3VYI A;  3VMY A;  1SQP G;  3GL0 A;  1NU1 E;  3H1I J;  1RIE A;  1BGY G;  1JB0 J;  3D70 A;  3TNU B;  1VQ5 P;  2PGD A;  2E4Q A;  1BSN A;  2PFX A;  4DCK A;  3WU2 H;  4NBG D;  1HJB A;  3HE5 A;  2ZYA A;  1N7L A;  3CWB J;  2E74 B;  2FYU J;  2NUM A;  2YXR B;  1OVV A;  2M5A A;  1PPJ D;  1KFN A;  4U3F D;  2WT7 A;  2XNX A;  2FXP A;  1PIX A;  3CXH E;  4L76 A;  5KLI C;  3VTP C;  4PD4 E;  4QDC A;  1LTJ A;  1QGK B;  1QLE D;  5K5G B;  4WB4 A;  3GL2 A;  5KKZ C;  1GW3 A;  3CPW O;  1N73 B;  5KJ7 C;  4TT3 H;  2Q5U A;  1MFZ A;  1SP4 A;  1JY2 O;  3VMX A;  3WMM 0;  3NXS A;  4GOF A;  3L73 J;  3WU2 E;  5APT A;  2NPS D;  3TGU G;  1RY3 A;  2QE7 H;  1JEK A;  2KB7 P;  4XFJ A;  2OYH B;  3N4X A;  1S5L X;  4QMA A;  3RK3 E;  5CCG C;  3FWL A;  4AAY B;  3B4S A;  3A0B H;  4H44 C;  5AVY B;  2W6B A;  5AW9 B;  3IFM A;  2Q7C A;  2BMQ A;  3VMH D;  3L72 D;  3T97 A;  1UII A;  1ZP0 C;  4UB8 E;  1X8Y A;  1QVG O;  5BOK A;  4WY4 D;  4HKZ H;  4PV1 D;  1OX3 A;  1KQL A;  3E1I A;  1O7N A;  2NPS A;  2D2C B;  2BCC D;  4HJG H;  1BCC D;  1YJ9 P;  2NVG A;  2N1T D;  3G6E P;  1OWA A;  1QVF O;  3L70 E;  4OGQ D;  3RK2 B;  1DEB A;  4KHX A;  3SSU A;  1ULJ A;  5DJU B;  3VP8 A;  3ITK A;  2JZA A;  2KLU A;  1KV4 A;  1AVY A;  1SFC D;  4WY4 A;  1FU1 A;  1GW4 A;  3L37 A;  1ZRT D;  2N1T A;  4HYT B;  1PZQ A;  5KLV E;  3FGA D;  3L35 A;  1NTM J;  2C9N Y;  1NHL A;  3M06 A;  1OMI A;  5APV A;  1AQT A;  3HUS A;  2O01 J;  1O7H A;  2OYI B;  1JCC A;  1ZR4 A;  1PP9 E;  4OWF A;  4NB9 D;  1GD2 E;  3AEG C;  1L4A D;  2JWD A;  1JUN A;  3BAS A;  3H1J J;  2YIU C;  1PGQ A;  2NVF A;  1A02 F;  1ZOY C;  3OA7 A;  4EDF A;  2KOG A;  2POH A;  1K05 A;  1ZME C;  1VF5 B;  2FY8 A;  1FZE A;  1YQ3 C;  3BRT B;  4AQR D;  3BCC E;  2QM7 A;  1FC2 C;  1VQM P;  2KSE A;  2ZXE B;  1L0L D;  1X0T A;  1RE3 C;  4DJG A;  2WVR A;  1KB9 I;  1WT6 A;  1L4A A;  1XTG B;  1AA0 A;  1BE3 D;  2YKP A;  1SQX K;  3AE4 C;  3H1K D;  3AE9 C;  3GMA A;  4YXD C;  1LNQ A;  1JMM A;  1EDL A;  2PP6 A;  1RHZ B;  1IFI A;  4ASW A;  1N7S C;  2VRS A;  3SWY A;  2KP8 A;  1S9K D;  1BGY D;  3RK3 C;  5BVZ A;  2YFL A;  3L71 G;  2M8R A;  2ZT9 B;  1NJI Q;  3B5N D;  1RE4 A;  4EYY Q;  2Y0E A;  3HE5 B;  2J59 M;  1RQU A;  1EZV G;  1SQP E;  1LTG C;  2Y0D A;  4Z1M H;  2M5A B;  1QL1 A;  2WT7 B;  1KIL E;  2HG5 D;  1MUU A;  1FJP A;  1LTJ B;  3H6P A;  1DX7 A;  4P1C H;  3S9O A;  2H7H A;  2YMY A;  3USS A;  4H0L D;  1GU4 A;  3B5N A;  3V2N A;  2JEE A;  2IDB A;  2KYV A;  5KAI H;  3FWN A;  4IL6 X;  1SQV D;  2QJK B;  4XE5 B;  3MIW A;  2BAS A;  1H88 A;  1NU1 G;  1N86 A;  1IFD A;  1KFM A;  1SQQ D;  3L75 D;  1IJD B;  2FXO A;  1HTL C;  3JC2 2;  2KNC A;  1SJG A;  4NPF X;  4N3Y B;  4NB8 D;  1J1D C;  1KN7 A;  2FXM A;  3TYY A;  1EXI A;  3GTS A;  1OW8 A;  1YBK A;  1FZG A;  3CXH I;  3H1I D;  1KMI Z;  3F5H A;  3IF4 A;  1URQ C;  1JY3 O;  2HPC A;  1PGO A;  2IFM A;  2ZVN B;  2ZYD A;  3H1L J;  1VQP P;  3T97 B;  2MKV A;  2QJP B;  1IFP A;  2FYU D;  4L73 A;  1VL2 A;  3TGU E;  5BU5 A;  2E76 C;  3H32 A;  4HM2 A;  2K37 A;  1M7L A;  1BDD A;  3IR9 A;  3HTK A;  2GUV A;  5AVT B;  2BCC J;  1YIJ P;  4EIJ A;  2QEX P;  2XU6 A;  1NTZ K;  1JO5 A;  5BU8 B;  2E75 C;  3KZI H;  2ZYG A;  2QJY B;  3VN0 A;  3H25 A;  1PFI A;  3H1H G;  1JMB A;  3CCU P;  1KYO E;  4QUP A;  4WY4 B;  1X79 B;  4PV1 B;  2NZ2 A;  2NVE A;  1AV1 A;  1LJ2 A;  1PP9 J;  1Q82 Q;  3HE4 A;  1M90 Q;  2N1T B;  1QX8 A;  1OW6 A;  1NTK G;  4LLH A;  2OTK E;  3BVH A;  1LWU C;  4OGQ B;  3HUS B;  5AVW B;  1AJY A;  2WIT A;  2WPQ A;  2G3A A;  3HD7 C;  2KK7 A;  1VQ4 P;  1SQX E;  3BCC J;  2HMO A;  1KIL C;  3OW2 O;  2OGU A;  2HMJ A;  3L70 G;  1KQG B;  3N0Q A;  2H88 C;  3RL0 C;  3KZI E;  5AW6 B;  1KB9 H;  2V4H A;  3P8M C;  2B24 A;  1PL5 A;  2I1K A;  2W8Z A;  2K1A A;  5KJ7 D;  1L4A B;  3II6 A;  1L0L J;  2GBX A;  1MV8 A;  1M1J B;  1NAY A;  3NFQ A;  1KB9 D;  2AXC A;  3M9H A;  2IBZ I;  4HM7 A;  1NTK K;  3OJA B;  1SQP J;  5CCG D;  4WVZ A;  5KJ7 A;  2IBZ G;  1NTM D;  2ZXX A;  4H44 D;  2I1J A;  1BGY J;  1H8A A;  3L74 G;  2LR2 A;  4O9B A;  5TJH A;  2CPB A;  2KXP B;  1GZL A;  1IK9 A;  1R8E A;  2B9B A;  3H1J D;  2XR8 A;  2R5B A;  2ITA A;  4AIV A;  1NWQ A;  4I7Z B;  3LW5 J;  4D6T G;  3P32 A;  2OQQ A;  2IFN A;  2YKO A;  1ZR2 A;  3L71 E;  2IYO A;  3JSV C;  3AEB C;  5CCG A;  3P8C E;  1ZW0 A;  3B5N B;  5AVX B;  1IK7 A;  3EQQ A;  4Y28 J;  3AZC A;  4RJT A;  1M57 D;  2XV5 A;  1EZV E;  1JM1 A;  2WPV B;  4MN4 C;  1NU1 D;  3SFD C;  3A0H H;  2KNC B;  4GOE A;  2YFJ A;  3MTU E;  5AVS B;  1SQQ J;  2KS1 A;  3WUT A;  4H0L B;  5H2F H;  3P7K A;  3CC4 P;  3MGN A;  1USD A;  3TGU J;  2HPC B;  1MKM A;  5APY A;  3MZW B;  2W83 C;  2P58 A;  3CXH D;  3OAK A;  4PD4 D;  1RF0 C;  5CMZ A;  2GA1 A;  4Y99 C;  2FFD C;  2DE6 D;  1S2E A;  3H32 B;  2R3C A;  1WQL A;  1Y8A A;  4JYC A;  1CSB A;  3Q5S A;  3HTK B;  1UIX A;  3I55 P;  4QDD A;  3A2A A;  1MFT A;  2HFE D;  3A0H E;  1K9M Q;  1N8R Q;  4QUR A;  3PHL A;  1HJ0 A;  1U7J A;  3CX5 H;  3KQG A;  5B5E H;  2KUB A;  4UB8 H;  5H2F E;  1L0N G;  1N7S D;  2MJZ A;  2IYP A;  4HM8 A;  3HE4 B;  5AW4 B;  1SLQ A;  3RK3 D;  3RK2 C;  3CCL P;  1RE3 A;  4XA4 A;  1G2C A;  3GG2 A;  3W68 A;  3FOU A;  4EOT A;  1VDF A;  3H1H E;  4HH2 A;  4DZO A;  3CME P;  1N7S A;  3H1L D;  3M0D C;  5CXM A;  1Q90 D;  3MHV A;  3SWF A;  3L70 D;  3O8Z A;  1NTK E;  1KYO I;  2A06 G;  2B1X A;  3CX5 E;  5B5E E;  1LP1 A;  1NGM B;  1SS1 A;  3M0A A;  2QIW A;  3WUU A;  2HMM A;  4ASV A;  1HGZ A;  4HM5 A;  5DJT B;  1L0N K;  2WPS A;  2V7Q H;  5KLV D;  5KLI B;  2ZAE B;  5AEW A;  3TK1 A;  2I7F A;  1TU3 F;  1GL2 C;  2WQY C;  3Q1M A;  4KJM A;  1PP9 D;  1N2D C;  1SQX G;  3CCE P;  1URQ D;  1NH4 A;  3GHG C;  1SQV K;  3ABV C;  3TDK A;  1W5C E;  3KPE A;  1VQ8 P;  2HMN A;  2P67 A;  3C1L A;  1YTZ T;  3V4W A;  2OYO A;  1NKN A;  1K8A Q;  1YJN P;  2QVA A;  3BCC D;  2E76 D;  3W67 A;  3CCJ P;  1Q7Y Q;  1VQ9 P;  3G9R A;  2ZT9 C;  2WSE H;  3L73 G;  1U57 A;  1SQB G;  4GDO A;  1G8K B;  1FQT A;  4L74 A;  1SFC A;  2IBZ E;  4RES B;  2GUS A;  1VQ7 P;  3SWK A;  2R44 A;  3L74 E;  4H44 B;  1EG9 A;  2E75 D;  4W7Z A;  3R2P A;  3U1A A;  3DQY A;  1M1K Q;  2BEQ D;  3AE1 C;  1VQK P;  2KZI A;  1LTJ C;  1OIP A;  1ZRT E;  4D6T E;  2R32 A;  4K35 A;  4CPG A;  2L91 A;  1NU1 J;  2HMK A;  2RN0 A;  4P1B H;  2RH0 A;  1FDI A;  3K5B A;  1JY2 P;  2KS1 B;  2QJK C;  3PP5 A;  2XND H;  2UWJ E;  1G1I A;  1NAF A;  1FOS E;  3O6Q A;  4OH8 B;  4GT1 A;  2CK3 H;  1SQP D;  3HD7 D;  1ZV8 A;  5CCH C;  1KIL D;  2DE5 D;  2GM4 A;  4HB1 A;  3AE2 C;  4NBF D;  2P2U A;  4JQ0 D;  1AQ5 A;  4NBB D;  1EZV I;  1S72 P;  3RL0 D;  3V4Q A;  4HKV A;  1SQB K;  4N78 E;  1M56 D;  2AEJ A;  3CCR P;  4NBC D;  3KDP B;  3HD7 A;  1P84 I;  2QJP C;  1JY2 N;  1AVO A;  1KIL A;  5AVR B;  1KQS O;  4M3L A;  1GDT A;  1IFM A;  2M0B A;  2XRX A;  3VMI D;  1FAV A;  4U7J A;  1ZLL A;  2O01 N;  1NTZ G;  3Q5R A;  1CZQ A;  2FYN C;  2W6J H;  2CKF A;  2AEF A;  1G2C B;  3TF5 A;  3UIA A;  2I8D A;  2WSS H;  3A5T A;  1GMJ A;  2QJY C;  1T3U A;  1JM0 A;  1KOR A;  4IOI H;  2P10 A;  3TGU D;  2Z5H A;  1L0N E;  1KYO H;  5TIS H;  1N7S B;  1GU5 A;  2WTY A;  4EMJ B;  1Y47 A;  1YHQ P;  2IZ0 A;  3R4Y A;  3RK3 B;  4NBA D;  2O1J A;  4RO0 A;  1GK4 A;  2C9L Y;  2E5Y A;  1IZN B;  1LP1 B;  2B88 A;  2N9B A;  3L70 J;  3RBZ A;  1NTM K;  3RBX A;  1RF1 A;  2NPS B;  1KYO D;  4I6M C;  4W80 A;  2DE7 D;  4H13 C;  2HR3 A;  3CCM P;  5AVZ B;  4QCK A;  4OVN F;  3V2P A;  4IL6 H;  2KSJ A;  1HH0 A;  4GOD A;  2A06 E;  2WPR A;  4HM1 A;  5KLV J;  5KAF E;  4BWN A;  1U7M A;  1EDK A;  4N6J A;  5B66 E;  5TIS E;  1PPJ G;  4U3F G;  4AYC A;  3EN1 A;  2M3B A;  3CX5 I;  2AEM A;  2YO3 A;  3HRN A;  1M1J C;  3I5C A;  2LXB A;  3M91 A;  3CWB E;  4NBD D;  1YI2 P;  1USE A;  2Z5I A;  1J1D B;  3L74 J;  2V7Q J;  1KD1 Q;  1IO4 A;  1NYH A;  3B8E B;  3V2R A;  4K3A A;  2Q9I A;  2P7J A;  4NBH D;  2Y9Z A;  1LTI C;  1RE4 C;  1SFC B;  1VPC A;  2J58 A;  4IL6 E;  4D6T J;  1X9V A;  5AVU B;  2SPZ A;  1H0T A;  3U1C A;  1FZC C;  2E42 A;  4LC1 A;  1BDC A;  1RF0 A;  1LT9 C;  4C46 A;  2FFD A;  3AE5 C;  3CCV P;  5AVV B;  2E76 B;  2ZVO B;  3L73 E;  1SQB E;  1T2K C;  3B5N C;  2YKQ A;  2FKW B;  4HJL A;  2HYN A;  3L72 G;  5L8R J;  5AW0 B;  1VQO P;  3AEF C;  3O6Q B;  2Y0C A;  1MZ9 A;  3BRV B;  4RKU J;  2E75 B;  1ULI A;  2QPZ A;  2OAR A;  2HML A;  2BCC G;  1BCC G;  1KC8 Q;  2KLV A;  2JO6 A;  5APQ A;  5M1B A;  5CBO A;  4DOJ A;  1JY3 P;  3LIE A;  3L71 D;  1KTM A;  3QWO C;  2R3S A;  1J1E B;  1IFN A;  5CJ4 A;  1Q86 Q;  2JP3 A;  1P84 H;  3GZY A;  2YNY A;  1EZV D;  3JCU H;  3TSI A;  1HBW A;  3AED C;  3HD7 B;  2HLO A;  2WSC H;  1FDO A;  1R5L A;  1KIL B;  4QDF A;  1W2B O;  2W6A A;  5HL4 A;  3CC7 P;  4I1L A;  3GW6 A;  2IX7 C;  3V5B A;  1AFO A;  3M0D A;  3D6Y A;  3C8V A;  5AW2 B;  2E74 C;  3PLN A;  1NO4 A;  2LKM A;  1G1J A;  1GL2 D;  1FBM A;  5AW8 B;  1JY3 N;  4W7Y A;  1D7M A;  1PV3 A;  3CCQ P;  1NTM E;  3CC2 P;  1T6A A;  2RMZ A;  1EDI A;  1W2E A;  3GF3 A;  3GF7 A;  3VCP A;  3E7K A;  3AE3 C;  1FE6 A;  1P84 E;  3L36 A;  1RH5 B;  4QUQ A;  2L5G B;  1N73 C;  4I2L C;  3WUV A;  3JCU E;  1NTZ E;  1GL2 A;  3M9Q A;  1S3J A;  1LTT C;  2ZT9 D;  3IAO A;  1XTC C;  2QM8 A;  4IFF A;  3N7N A;  4YTP C;  3G3Z A;  2Y9Y A;  3GHG A;  1GK6 A;  1BE3 G;  2QA4 P;  2HOD A;  3H1K G;  4WWI A;  3SFE C;  1RF1 B;  2BMR A;  4ZMD A;  2OYH C;  5AW7 B;  1CW5 A;  3EFG A;  5AW1 B;  2B87 A;  1HWT C;  1DIP A;  4BXL A;  3LID A;  3NMD A;  3MD0 A;  2WMM A;  2WSF H;  2XKM A;  1S1C X;  2JWA A;  2D2C C;  2C0W A;  3H1H D;  1JCD A;  3MUD C;  1WMK A;  5CCH D;  1VCK A;  5APX A;  1E5W A;  2Q3I A;  1SQX J;  3AEA C;  1OVU A;  3AE8 C;  1NTK D;  1L0L K;  4R4M A;  1BSH A;  3CX5 D;  1SQV G;  2OTL P;  3NTN A;  1H89 A;  1EDJ A;  2JKV A;  1X22 A;  1PPJ E;  4U3F E;  3IN6 A;  1OW7 A;  1OXZ A;  1SQQ G;  3L75 G;  2KZJ A;  5CCH A;  5GTH H;  1SQP K;  1H0T B;  2PAJ A;  3VP9 A;  1SQB J;  4YPC A;  2OYI C;  1JOC A;  2K9Y A;  4BRY A;  4Y99 B;  2FFD B;  3M9B A;  4HM4 A;  2PRR A;  3H1I G;  1LTS C;  1KZU B;  4HM3 A;  3I56 P;  2H89 C;  1E79 H;  1VF5 C;  1OZH A;  4ZNC A;  1FDM A;  2YFI A;  3CWB G;  1PGJ A;  4NPD A;  2FYU G;  2QRX A;  2WZ7 A;  2A45 I;  4IFD K;  1JTH A;  3H1L E;  5AW5 B;  3Q3D A;  5KKZ B;  2R5D A;  2A45 G;  4UB6 H;  2IBZ D;  5GTH E;  2FYZ A;  1QL2 A;  3L72 E;  4NPE A;  3L74 D;  5AVQ B;  3V6I A;  2YO2 A;  3L71 J;  3B71 A;  1S5L H;  1EXJ A;  1SQQ K;  2BCC E;  1Z56 A;  1BCC E;  3EWK A;  1FZA A;  3E1R A;  4H13 D;  4QDF B;  3PH0 A;  4TLF A;  4D6T D;  1UUV A;  1R5S A;  3A0B E;  5EFW B;  1EQ7 A;  1URQ A;  2M3E A;  2YXQ B;  1YJW P;  1T3J A;  1VQL P;  3MP7 B;  1NTZ J;  2FYU K;  2E4P A;  1A02 J;  2JR8 A;  5APW A;  4UB6 E;  2Z4E A;  2QG4 A;  2WSC J;  2O1K A;  3PRJ A;  1IC2 A;  1S5L E;  3GZX A;  1FS0 E;  3VOP A;  2N9Y B;  1DEE G;  2IPP A;  1JNM A;  4JYB A;  1GL2 B;  3CMA P;  4N78 D;  1Q81 Q;  3PTZ A;  1L2P A;  5APU A;  3GLM A;  1K73 Q;  2ZFC A;  2C0X A;  3GHG B;  2HOD B;  5CBN A;  2NWF A;  3S4R A;  1M1J A;  3LW5 H;  1HVV A;  4JF7 A;  2B87 B;  1L0L E;  1LWU A;  3KYQ A;  1WRG A;  2B89 A;  5AEU A;  2QSI A;  1NTM G;  4DT0 A;  1T2K D;  2YIU B;  4C7N A;  3AEE C;  2DW3 A;  3CCS P;  1VM9 A;  1BE3 E;  3A3Y B;  5APS A;  3H1K E;  1OFC X;  2NPS C;  1EC5 A;  3AEC C;  1J2J B;  3H1J G;  4NBE D;  1L0N D;  2XDJ A;  1FZC A;  5C39 A;  1S9K E;  5AW3 B;  4IFM A;  4L75 A;  1BGY E;  3H1H J;  1LT9 A;  3EFF K;  1Q90 C;  1NVO A;  5GTI H;  4U3F J;  2E5T A;  3CI9 A;  3C9I A;  4HM0 A;  4WY4 C;  1NTK J;  4PV1 C;  2K9J A;  2WSF J;  2G8Y A;  2P1J A;  4ZKP A;  5KAF H;  3VCA A;  1OVR A;  3GB4 A;  3FXE A;  5B66 H;  3AE7 C;  2N1T C;  1UUW A;  1O7W A;  1IFJ A;  1O7M A;  1CI6 A;  3CL3 D;  4OGQ C;  3HUS C;  2J5U A;  3C0D A;  2A06 D;  4BRY B;  2W90 A;  1SQV E;  2E74 D;  3CLQ A;  2JO1 A;  4PD4 I;  1SFC C;  2H43 A;  2W27 A;  4YXW H;  2A45 H;  1DD4 A;  2ZJS E;  3L4F A;  1SQQ E;  3L75 E;  3KXD A;  2NUK A;  2O3J A;  3TNU A;  5GTI E;  3RGU A;  2H8P D;  1LT1 A;  3GCE A;  1T8Z A;  3CWB D;  1HUC A;  1NOH A;  5KAI E;  1JTH B;  2RKL A;  3FXD A;  4AUW A;  3L72 J;  2KIK A;  3H1I E;  1L4A C;  1YIT P;  1SQX D;  3ZDM A;  2GBW A;  4GIF A;  2Q3E A;  3G4S P;  2Q3W A;  1BCC J;  2FYN B;  1S4X A;  1HGV A;  2AXT H;  2WWW A;  4B86 A;  5CJ0 A;  1O7P A;  1NU1 K;  2FYU E;  3A7O A;  5KTB A;  1ZN5 A;  1N73 A;  2BEZ F;  1J1E C;  3L73 D;  2XSH A;  2OTJ P;  1URQ B;  1SQB D;  4A7P A;  3S1K A;  3U59 A;  1VQ6 P;  1LTA C;  1YQ4 C;  4WBA A;  4JPZ B;  5E79 H;  1FJK A;  3F89 A;  4KT0 J;  1GTW A;  2D2C D;  4I7Z C;  1FOS F;  3CD6 P;  3Q2Y A;  1KQF B;  3VMG D;  1DD3 A;  3H1L G;  2OYH A;  2ZYL A;  4H13 B;  3EQ2 A;  1QEX A;  3RK2 D;  3GTE A;  2AXT E;  3VMZ A;  2WSE J;  3GKE A;  1ZXG A;  2Q6Q A;  3D89 A;  2IZ1 A;  4C7R A;  1NKZ B;  2NRG A;  1K04 A;  1SVF A;  1FZB A;  2E43 A;  1LGH B;  4LGD E;  2JDI H;  4PJ0 H;  3G71 P;  2K88 A;  2Q1K A;  3MUD A;  2XSO A;  1HF9 A;  5KLV G;  2O01 H;  4GKG A;  4H0L C;  3P8C D;  3QH9 A;  4EI2 A;  5E79 E;  3PJS K;  1BE3 J;  3H1K J;  3RL0 g;  4HM6 A;  1LWU B; 
#chains in the Genus database with same CATH homology
 1NDO A;  2BEQ D;  3AE1 C;  3AEA C;  3AE8 C;  3T97 B;  2MKV A;  4R4M A;  1ZRT E;  1VL2 A;  3TGU E;  1O7G A;  1VF5 D;  2E76 C;  4HM2 A;  2HMK A;  4P1B H;  1FDI A;  2QJK C;  1RFS A;  1PPJ E;  4U3F E;  3IN6 A;  1KB9 E;  1OW7 A;  2FBW C;  3O6Q A;  3D6Z A;  3D71 A;  3GOB A;  2E75 C;  2YMK A;  2DE5 D;  3AE2 C;  4NBF D;  2K9Y A;  3H25 A;  3AE6 C;  4HM4 A;  1Y9B A;  1KYO E;  4QUP A;  4NBB D;  4PV1 B;  1NYK A;  2NZ2 A;  2NVE A;  4HM3 A;  4HKV A;  2H89 C;  1VF5 C;  3H1J E;  1RQV A;  1OW6 A;  2YVJ B;  2YFI A;  4NBC D;  4OGQ B;  1G8J B;  4R4L A;  2QJP C;  1AJY A;  2G3A A;  1SQX E;  3H1L E;  3Q3D A;  3Q5P A;  2HMO A;  2XRX A;  2BMO A;  3VMI D;  2HMJ A;  4U7J A;  1KQG B;  3GL0 A;  1NU1 E;  3L72 E;  3Q5R A;  3N0Q A;  2H88 C;  2FYN C;  3B71 A;  1RIE A;  1JB0 J;  3D70 A;  2CKF A;  2B24 A;  1EXJ A;  1PL5 A;  1GMJ A;  2QJY C;  2BCC E;  2E4Q A;  1KOR A;  1BCC E;  3EWK A;  4H13 D;  4NBG D;  4QDF B;  1UUV A;  2P10 A;  1L0N E;  2E74 B;  2NUM A;  2GBX A;  4EMJ B;  3R4Y A;  2FXP A;  4HM7 A;  1PIX A;  3CXH E;  4NBA D;  5KLI C;  4PD4 E;  4QDC A;  3GL2 A;  2E4P A;  5KKZ C;  4H44 D;  2WSC J;  4TT3 H;  2DE7 D;  4H13 C;  3GZX A;  4QCK A;  1R8E A;  2XR8 A;  4AIV A;  4I7Z B;  2A06 E;  3LW5 J;  2OQQ A;  3GLM A;  4HM1 A;  3L71 E;  3AEB C;  4XFJ A;  1S5L X;  1IK7 A;  3EQQ A;  2NWF A;  3RK3 E;  4Y28 J;  3AZC A;  3EN1 A;  4AAY B;  1EZV E;  4H44 C;  1JM1 A;  1L0L E;  2WPV B;  3CWB E;  2BMQ A;  4NBD D;  3VMH D;  1ZP0 C;  5AEU A;  2QSI A;  2V7Q J;  5BOK A;  3SFD C;  4PV1 D;  1NYH A;  3AEE C;  1O7N A;  2D2C B;  1VM9 A;  1BE3 E;  2YFJ A;  4NBH D;  3H1K E;  2NVG A;  4H0L B;  3AEC C;  3L70 E;  4NBE D;  4OGQ D;  1MKM A;  1Q90 C;  1ULJ A;  2JZA A;  3AE5 C;  2E76 B;  2DE6 D;  3L73 E;  4HM0 A;  1SQB E;  4PV1 C;  1WQL A;  2WSF J;  2G8Y A;  3VCA A;  5KLV E;  3FGA D;  3GB4 A;  4HJL A;  5L8R J;  3Q5S A;  1UIX A;  4QDD A;  3AE7 C;  3AEF C;  1OMI A;  1UUW A;  4RKU J;  2E75 B;  1ULI A;  1O7W A;  2QPZ A;  2O01 J;  1O7H A;  1O7M A;  2HML A;  4QUR A;  1PP9 E;  4OGQ C;  4NB9 D;  1HJ0 A;  3AEG C;  2J5U A;  2YIU C;  3C0D A;  2JO6 A;  5M1B A;  2NVF A;  1SQV E;  2E74 D;  1ZOY C;  1KTM A;  1ZME C;  1K05 A;  2JO1 A;  1VF5 B;  4HM8 A;  1YQ3 C;  2JP3 A;  1DD4 A;  3GZY A;  1SQQ E;  3L75 E;  3BCC E;  2NUK A;  3GCE A;  3AED C;  3FOU A;  1FDO A;  4QDF A;  3H1H E;  5HL4 A;  3H1I E;  3D6Y A;  3C8V A;  3AE4 C;  3AE9 C;  3GMA A;  2GBW A;  2E74 C;  4YXD C;  2Q3W A;  1Q90 D;  5CXM A;  1NTK E;  1O7P A;  2B1X A;  2FYU E;  3CX5 E;  1PV3 A;  1NTM E;  2YFL A;  1NGM B;  2ZT9 B;  3GF3 A;  2QIW A;  3GF7 A;  3VCP A;  3AE3 C;  2BEZ F;  2HMM A;  1P84 E;  2XSH A;  1RQU A;  4QUQ A;  4HM5 A;  1SQP E;  4Z1M H;  1NTZ E;  5AEW A;  1YQ4 C;  1KIL E;  2ZT9 D;  3IAO A;  2I7F A;  1TU3 F;  4KT0 J;  4YTP C;  2D2C D;  2WQY C;  3Q1M A;  4I7Z C;  4P1C H;  3S9O A;  3Q2Y A;  1KQF B;  3VMG D;  1DD3 A;  4H0L D;  2IDB A;  2ZYL A;  3SFE C;  4H13 B;  4IL6 X;  2BMR A;  3ABV C;  3GTE A;  2WSE J;  3GKE A;  2HMN A;  1DIP A;  3D89 A;  2E76 D;  1K04 A;  1SJG A;  4NB8 D;  1EXI A;  3G9R A;  2ZT9 C;  1U57 A;  4GDO A;  1S1C X;  1G8K B;  1FQT A;  3GTS A;  1OW8 A;  2D2C C;  2IBZ E;  2XSO A;  1HF9 A;  3L74 E;  4H44 B;  1KMI Z;  1EG9 A;  4H0L C;  2E75 D;  1WMK A;  1VCK A;  3DQY A;  3RL0 g;  4HM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...