1VFCA

Solution structure of the dna complex of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
EDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Short G-rich strand
publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 14
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vfcA00
2L9RA 1MBFA 3A01B 5FLVA 3GTMJ 1MBGA 4XRSA 1IC8A 2CRGA 1ETKA 1MBEA 1OCPA 3G1OA 5E3LA 3SJMA 5FKKA 2LD5A 2E2JJ 3BTLA 5BNGA 1YRNB 5IP7J 2M8GX 2NVXJ 2K9NA 2ID3A 2ME0A 4V2GA 3GTLJ 3Q0WA 4A3EJ 4QIWN 1ORKA 4XIDA 4XRMA 1F43A 2XPUA 5JLXA 1ETVA 1B72B 1MSFC 3LOCA 2G0EA 4X6AJ 3IH4A 3I4NJ 3GTGJ 4UUSA 2ECCA 1ETXA 2KT0A 2LK2A 2HXIA 3BR6A 2JMWA 3W6VA 1MBKA 2COBA 2R93J 3S1QJ 4RBOA 3WHBA 1ZTRA 3FK6A 3QQAA 1TWAJ 1SFOJ 1HLVA 1ZK8A 3RQIA 1B72A 3LSJA 5GPAA 1BW6A 1AKHA 2M9HA 1TWFJ 2E2HJ 3HKZN 4M3BA 4FISA 1K61A 4BBRJ 3S14J 3ZOBA 2K9QA 4S0HB 2HYJA 1Q1VA 3HOZJ 3RZOJ 1WCMJ 1RKTA 2GBYA 1BJZA 5GP9A 1S7EA 1LE8A 3ZQCA 1TC3C 4DZPA 1Z0XA 2QCOA 1FJLA 3C2BA 2XB5A 3F0CA 1VF9A 1O4XA 2DMPA 5C4XJ 1UHSA 3JREA 4D7NA 2VPRA 1ENHA 5FKOA 2VKVA 2B63J 3GTOJ 4AC0A 2JA8J 4JP0A 2Y31A 2XPVA 1MH3A 5IYCJ 2NOGA 1NK2P 2DA5A 5C3EJ 4D5FA 1FTTA 1XG1A 3MN2A 5F08A 1JTYA 1WH5A 5IOZA 3JRHA 2NS7A 3RZDJ 3HDDA 2LLKA 2JWTA 3PM1A 2NS8A 1JGGA 1MBJA 3JRDA 1IUFA 5JLWA 4Y52J 2JA7J 4A93J 2HOSA 4IHXA 1ETYA 3O8GA 4GFBA 2DTZA 3ZQIA 5F04A 4W1UA 3HOWJ 1BA5A 1RPWA 3HOUJ 3IV5A 4D5CA 2TRTA 3K7AJ 3TW7A 1IJWC 1PUFB 3CCYA 2XGDA 1RKWA 2VKEA 1GV2A 4A69C 2OPTA 2R5ZA 1U78A 1HF0A 4DW6A 3HEFA 4FE7A 3SDGA 1X58A 2EZLA 9ANTA 1AHDP 3RKQA 4M3EA 2K9SA 2AHQA 4MLOA 3HOVJ 4MFDA 2CU7A 2R0QC 1H89C 1T56A 1P7IA 5E3NA 3JRBA 1U8BA 4NDLA 2HI3A 1U9OA 4HNVA 4BBSJ 1WGXA 3Q0VA 1FIPA 3OSFA 3BTCA 3HOXJ 4IHYA 2GM4A 3OSGA 2LR8A 4G12A 5EGOA 4CYCA 5F0CA 2GLOA 1E3OC 2L7MP 2X9DA 4ABZA 2EZKA 5J1UA 1Y1WJ 2DMQA 2IEKA 3O8HA 2NVYJ 2ME6A 4I6ZA 1XC5A 2N8GA 5IPAA 3A01A 1TWCJ 4MFEA 2DA6A 5HODA 1B8IB 4AYBN 2LFBA 2M2EA 4FE4A 1YRNA 4QSHA 1WH7A 2XSDC 1LFUP 3H0GJ 2HDDA 2K40A 4L5EA 3BR2A 5DS9A 5J1RA 2LP0A 5C44J 1JT6A 1IG7A 2XGCA 5E3MA 1H8AC 2R92J 2AO9A 3FKIJ 2Y9YA 2MW8A 3OOUA 2EZHA 2JJ7A 4M6VA 3NAUA 3I4MJ 2FQ4A 3GTQJ 1DU6A 4DYCA 1I3QJ 4C3JJ 2VUMJ 4MIMA 1MSEC 2JN6A 2XPWA 3HB9A 1I50J 3S2DJ 5EEAA 5J3LA 1A5JA 1SANA 2DMTA 1T33A 2QF7A 5M3MJ 2LKXA 1MNMC 3D1NI 3HBLA 4LOCA 5M3FJ 3S16J 1Y1VJ 2WV1A 2NVTJ 5EG0B 1UMQA 1HCRA 3QPLA 1IV6A 4DYQA 4RDUA 3QPSA 1DU0A 1QPIA 1APLC 2DA3A 1JT0A 2DMUA 3BG5A 1ITYA 5EZHA 5EYRA 3MVPA 2CQXA 4BY1J 2WB1N 3FISA 1D5YA 2YU9J 2CUFA 2DA2A 3H3VK 1I6HJ 1FIAA 1GT0C 3BTIA 1G2HA 3ZQGA 1X2MA 5FKLA 1QVUA 3G1LA 1GUUA 2JA5J 3GTPJ 3BR5A 3B6AA 5IYDJ 1ETOA 3BQZA 3OIOA 2P81A 2ID6A 5IP9J 2ECBA 2DN0A 3BR3A 1IGNA 2ZB9A 2JK3A 2L7FP 5IOYA 4A3BJ 4A3GJ 5FKNA 3ZQFA 4A3DJ 3E7LA 3LSPA 4IEJA 3BR1A 4A3KJ 1W0UA 4B4CA 1JJ6C 1IDYA 4UUTA 3CDLA 2TCTA 2I10A 2DMNA 1H88C 2L0KA 1ZR4A 1UG2A 3FIWA 1PUFA 2DJNA 4JYKA 3S15J 1RESA 4XICA 3GTJJ 2HOTA 2RAEA 3JRAA 3JRIA 3CMYA 4V2FA 5K7FA 2LY9A 5M5YJ 2M34A 2L7ZA 3HGGA 1RETA 3DEWA 2E2IJ 4M3DA 4JX5A 2Y0SN 3JRGA 4C3HJ 2O9LA 2FJ1A 2W48A 3NARA 3B6CA 3S1MJ 3LSGA 2Y2ZA 5EDNA 2DA4A 1ZGWA 3Q0UA 1HOMA 2OF7A 1FEXA 3JR9A 4JX6A 1W0TA 1U9NA 3IH3A 5F27A 3A02A 3ZQLA 1MBHA 2KDZA 4UUSB 1EF4A 2EBIA 3G1MA 1HDDC 2DA1A 4B3AA 4XK4A 2DA7A 1F36A 1ZKGA 1B8IA 4IHWA 4XRSG 1OFCX 3BG3A 1LFBA 1AKHB 1QRYA 4MO7A 5FJ8J 1K83J 2IBDA 2YUSA 4EEFG 1IRZA 3CQZJ 2R7ZJ 1TWGJ 5FKMA 2ELKA 3FK7A 2X48A 5E3OA 1Z77A 1GVDA 3BR0A 2EZIA 3GBGA 5F0HA 1NK3P 3PO3J 1AU7A 2JA6J 3DCFA 2H1KA 3MKLA 1LE8B 1JUMA 1BL0A 1TWHJ 3S17J 1JKOC 3S1NJ 5GPCA 2CUEA 3VPRA 2R5YB 5K7ZA 1JKRC 1POGA 1QVTA 4A3FJ 4D7MA 1MH4A 5F0FA 1GV5A 2E19A 5DTDA 4AUXA 3UKGA 4X1EA 5J1YA 1JTXA 4JX4A 2HXOA 4M3FA 1P7JA 2YS9A 4DZJA 4M3GA 3TEDA 2R5YA 1WPKA 2MSYA 5EZGA 2MGQA 1GDTA 3BG9A 1JUSA 1OJLA 2LVSA 5M5XJ 2O7OA 5EG0A 3LNQA 2X6OA 4C3IJ 2XGEA 2PMZN 3BT9A 1CQTA 4B1RA 2MG4A 2XRLA 3BQYA 2FX0A 1JKPC 3K2AA 2LTPA 3GTKJ 4A3LJ 4BXXJ 1ETQA 1OCTC 2D5VA 1HDPA 4IHVA 5EF6A 2WAQN 3LSRA 3SFIA 1NTCA 1WI3A 4W97A 3TP0A 1VI0A 4I76A 5C4JJ 5K7HA 1VFCA 4A3CJ 2VI6A 1IDZA 3S2HJ 3S1RJ 2R5ZB 1XS9A 3M3YJ 3IH2A 2EH3A 2FD5A 1ZQ3P 2CQQA 3Q3SA 2HOAA 1ETWA 1X2NA 2CJJA 3HGYA 1ZR2A 4QTRA 2Y30A 5F1JA 4FCYA 1RR7A 3HM5A 2HQ5A 1JJ8C 3WHCA 3M4OJ 4BY7J 3HOYJ 4FTHA 4A3IJ 4C2MJ 4A3MJ 3PO2J 1A6IA 2Y9ZA 2H8RA 3TP3A 5M5WJ 2M0CA 5IYBJ 2E1OA 4CYCB 5EGOB 4BKXA 2O8KA 3TW6A 5IP6A 3JRFA 1JKQC 1BW5A 5FLMJ 4DYRA 4Y7NJ 2EQRA 1VNDA 3BTJA 4J19A 3L1PA 2IAIA 3JRCA 1JUPA 3A03A 3ZQHA 2NVQJ 1FTZA 4A3JJ 2XB0X 1R9TJ
chains in the Genus database with same CATH superfamily
2L9RA 3A01B 1A04A 2LSOA 3FHNA 3G1OA 1ETKA 3GYHX 1OCPA 2DT6A 5E3LA 3SJMA 2LD5A 4S05A 1ZARA 3CLQA 1ZRDA 2NVXJ 2K9NA 1W36D 2LMDA 1MJ9A 3E6BA 4BEHB 4KN7X 2KIFA 2LH9A 4IRGA 3L00A 3BWGA 2ZSHB 1ETVA 2VQCA 1REPC 3VSKA 2BVMA 4UVCA 4X6AJ 1B59A 3C3WA 4XOTA 2GAUA 3LQQA 1N75A 4RM2A 3SFZA 2KT0A 2LK2A 1Z3XA 5DD4A 5LHGA 2FE3A 1MBKA 4PJNA 4ZYHA 1ZRFA 2R93J 1P2FA 3GO5A 3I0TA 3LA7A 1I6XA 3CCRI 1ZK8A 3OYEA 2CV2A 5D8LB 3DU6A 5GPAA 1D8KA 2M9HA 3M8EA 3MZHA 2L9SA 2DK5A 1TWFJ 4FX0A 4CYDA 2M8EA 3PNYA 2IXSA 3GFJA 3SZGA 4BE2A 5LEKA 4BXFA 1D1AA 2CUZA 3WTSC 3S14J 5DCFA 3ZOBA 2K9QA 4RLQA 1R1TA 5B66C 2I5UA 2K85A 4F55A 1WCMJ 3K2ZA 2R7XA 1T39A 1BJZA 3MMYB 5GP9A 4E7ZA 1IXSB 1OYWA 2JA2A 2LF8A 1TC3C 3I58A 2KRCA 2ZNYA 3EETA 1JXSA 2BV6A 3SQNA 2DMPA 1UHSA 1ZHFA 3FBNB 1BBYA 1ZH5A 2YSRA 3GTOJ 5IY5H 3AAFA 1DP7P 2JPBA 4OAYA 5J40A 5IYCJ 5B1BH 5ICEA 2KZVA 3HJEA 3F6VA 4C2TA 4XR6A 5E8GA 3OYHA 3MN2A 4LK0F 2G7UA 3H5NA 2VBXA 5IOZA 1OYYA 3AG4H 5JI6A 3IHUA 2PI0A 3F21A 1KQ9A 1XCVA 2H94A 2NS8A 1MMDA 3JRDA 3K4JA 2ZC2A 4ZYGA 1R5ID 2LDUA 1A36A 2PJPA 3D5SC 1XCBA 1ETYA 1SVLA 4GFBA 2DTZA 5FLXZ 3HOWJ 4W1UA 1BA5A 1YJWI 2KPMA 4XN3A 2P5KA 5AIQA 2R7TA 2R7RA 1FWZA 1D0XA 4B3XA 1MZBA 1T6SA 1X1BA 2TRTA 4EJVA 5GAGJ 4J00A 2GXGA 2VKEA 4BHPA 2PG4A 3A0HC 2HEOA 4DW6A 3HEFA 1QZYA 1RI7A 1XMAA 2EZLA 1AHDP 1SD6A 3W2VA 5KNLA 4MLOA 2UZKA 4QPQA 2JRTA 4KT5C 4BHBA 2E35A 4MFDA 4G94A 3HUGA 3ZMVA 1WVRA 2MD0A 1H89C 5CJ9A 4NDLA 4BQNA 4AVZA 2DLLA 4ZJZA 1FY7A 3BZ6A 5ICFA 3ABUA 1BI0A 2ZJ2A 3ZMDA 3OSFA 1DPRA 3E97A 1ZLKA 4LFUA 4Q5SF 4LMYA 4HF1A 1VQNI 4M9ZA 1TT5B 3OSGA 3VDXA 2LR8A 4U7DA 3CCVI 4G12A 4CYCA 1G3TA 2HS5A 2RQPA 3CP8A 3K4BA 3J7YJ 3GF2A 1SVMA 4CZCA 2W84A 4MQ9F 4EMSA 2L7MP 2X9DA 2EZKA 1YW8A 2DMQA 1SFXA 3TBIA 1XSDA 4ZC3A 4KYWA 2ME6A 2OQRA 2M5WA 3OYJA 2ZXJA 5HODA 2DA6A 1B8IB 5E1XA 4AYBN 1HKQA 3U21A 1PP8F 2F2EA 5FLXK 3OL3A 3RPUA 3HRUA 4Y15A 1LFUP 3H0GJ 4L0YB 3HSRA 3HL2A 4EQQA 5LEJA 2LP0A 2W00A 3VYSB 5C44J 3E1SA 3OYGA 4GYGA 2HQNA 3IWFA 1V3FA 1P4AA 1YHQI 4NQWA 5E3MA 1H8AC 2L2OA 1Z9CA 4Y3OA 3FKIJ 2MW8A 4XRFA 2UV1A 4A0ZA 2XAGA 3RKYA 4MEYF 1VQ9I 3T0YA 4NHJA 2FQ4A 2MH9A 1DU6A 2ISYA 4DYCA 1I3QJ 3DEEA 3W6KB 3OS2A 1U5TB 4AIJA 2VUMJ 2FRHA 4NUBA 1MSEC 2JN6A 1MDMB 4U0YA 2CFXA 1I50J 2VN2A 3BG7A 2DQLA 1A5JA 1T33A 1X3ZB 4JBAA 2LKXA 2J5PA 1S7OA 3ZCOA 1MNMC 1FX7A 2HPIA 2ZJRF 5M3FJ 4O3MA 1I1GA 2QVOA 1XTAA 2XAJA 4E7KA 2QA4I 1SMYF 3AL0C 6PAXA 2HWVA 3ZN0A 3QPLA 3NRVA 2GXBA 1RRJA 4DYQA 3PJRA 1DU0A 2VJIA 1JE8A 1G59A 1MD0A 5LHHA 5K5RA 4PFPA 4XORA 2Y48A 5DD8A 2VKHA 2RNJA 2W85A 4BY1J 1UJ8A 1E3PA 4N9HA 2DT5A 1FIAA 3CC4I 5JHFA 2RV8A 2R7FA 5IYDJ 1K78A 2JA5J 3BR5A 2KKOA 1ETOA 3U9GA 3AG2H 1W7PA 3MZ8A 1WJAA 2XAFA 1R71A 2VC0A 1UELB 3EDPA 4HSRA 2L7FP 5FO5A 3HPGA 1FP2A 1IRFA 3F8BA 2XF7A 4IEJA 4XLEA 2EFNA 4A3KJ 5K5OA 1W0UA 4WXHA 4B4CA 2QWWA 3KYCB 1HQCA 1BR4A 1B1BA 2AQEA 2RVCA 4OWRB 2BEOA 2TCTA 4HX7A 5CQEA 2DU9A 1ZR4A 3EPZA 5L3DA 1PUFA 1FBSA 3VWBA 4JYKA 3CP2A 3LSKA 4A6EA 1UZCA 4IX7A 2HNHA 3S15J 1RESA 1S8NA 4M9XA 3L2VA 3JRAA 3KYLA 4WXCA 3CMYA 3PNTA 2LRDA 5M5YJ 4XL9A 2M34A 2VL8A 2L9NA 2EV0A 3K0LA 3QYBA 4JX5A 3ZR8X 2Y0SN 1R00A 4C3HJ 1TQIA 3NARA 4CXFA 3TOBA 3KEYA 1EH8A 3LSGA 3OOPA 2V9KA 3CC7I 4M6YA 4XN0A 2V6CA 3R0AA 2VJJA 5H20A 3LSHA 1FEXA 1I3AA 3KZZA 4LGWA 5D5XB 2MLGA 1ZREA 5HLTA 5HNFA 2QSFX 2OC6A 3IRRA 2Y0MA 5B3SH 4E7SA 2ZMEB 5CVVA 2HTSA 2KDZA 1FOYA 1FT9A 3G1MA 1HDDC 3I5UA 1LVKA 3IKTA 4FASD 2DA7A 5CYVA 5B5EC 2OV7A 5DCMA 3M7GA 1XSVA 3C18A 3NWSA 3OS1A 2M7AA 3BG3A 2PN6A 4MO7A 1Y0UA 2D2WA 2AQFA 1ZELA 3CUQC 2GZWA 2V4JC 1X1DA 1TL8A 5HDKA 1S5LC 3CQZJ 4F92B 5J8FA 2X48A 2JT1A 1TLHB 2Z2SB 1ZG1A 4XQFA 1NK3P 1V5GA 2LY2A 1UFMA 2H1KA 3CCQI 2QENA 4LLLA 2VLAA 4XNFA 2Z99A 4ESBA 5KVRA 1JKOC 4YEJA 2NNYA 4HW0A 4I09A 4R8HA 3LFKA 1G3WA 5A2QK 2WBMA 1QVTA 4D7MA 3KLOA 2H6CA 1X19A 5F0FA 3R60A 3TMOA 2HQAA 4F7ZA 1LVAA 1S9HA 4BXUA 4JX4A 1IRXA 4N4NB 2DOFA 2HXOA 2CMPA 4M3FA 1P7JA 2YS9A 2K5CA 4IQ4A 4M3GA 3QP5A 4DZJA 2DYSH 2R5YA 1KU2A 3TEDA 1J7KA 2GOMA 2MGQA 1GDTA 3BG9A 1OJLA 3HXLA 2X4HA 3KZIC 2QKLB 2OJED 2XGEA 2PMZN 3IRQA 1EH7A 2MYSA 3H3UA 1TNTA 2ELJA 2MG4A 2XRLA 2CH0A 3HHGA 4XMYA 3RJPA 3K6GA 4UY8I 4A3LJ 3J7AO 3WODF 2WY7Q 1KYWA 1WZ2A 3T8RA 1Y6IA 1FYLA 2HR3A 1HDPA 3L09A 2DYRH 1WI3A 5L3CA 1VI0A 1MW7A 2EIKH 3F72A 2OCCH 4ITVA 2B0LA 2VXZA 1SAUA 2HVQA 2RKHA 2KIUA 5ED4A 1IDZA 1TNSA 2EV6A 5D5UB 2E1MB 1W5CC 3R0JA 1IXCA 2OUMA 2HOAA 1E3HA 3OV8A 3Q3SA 2AXTC 3LA2A 3CMMA 2ESHA 1ERDA 1BR2A 2QBYA 3HM5A 1OCRH 1YX3A 2DO7A 3PL8A 3WHCA 2VODA 4BY7J 4BUPA 3P9IA 2IGMA 5CLSA 2ZFWA 3EYYA 1D1BA 2XAHA 4BHCA 3MKYB 1A6IA 2JVHA 2VBZA 2DT7B 4H4KC 2DFEA 3S3OA 5EGOB 3OYAA 3V8LA 3JRFA 2ZCWA 5FLMJ 3KEQA 4Q4ZF 4B43A 2EJRA 1IN5A 3H9GA 1WJ5A 2A68F 3ABKH 1L0OC 3L1PA 3SXYA 3CUQA 3JRCA 4E6KG 4RAZA 4A3JJ 3DP7A 2FNAA 2XB0X 4C2UA 4RB1A 5FLVA 2A07F 1MBGA 2CRGA 5FKKA 1TBXA 3W6JB 3BTLA 3VODA 1E17A 3M1EA 3FWEA 2OZ6A 4KUMA 3O6BB 4HDUA 3Q0WA 4XIDA 4BDZA 4XRMA 2P5VA 5H6RA 2A3SA 4EGYA 3O3KA 3QAHA 1BI3A 3LOCA 2ZBKA 2BW3A 3IH4A 2IGOA 4ZYAA 3B02A 4DBQA 3I4NJ 2Z16A 3GZ5A 3HSEA 3ELKA 2VQGA 2ECCA 4IXAA 2ADUA 2KRHA 2HXIA 3WE3A 3W6VA 4LG3A 4IL6C 2COBA 4AYBA 4BEHA 2E1NA 2NAZA 4RBOA 2KISA 2JSPA 1TQPA 1ZTRA 1IW7F 3QQAA 5GTIC 1WHUA 1WJEA 1KA8A 2HYFA 2IT0A 2A61A 4U88A 2A69F 2ZFUA 2JUCA 3HRTA 3W2AA 2LF7A 2K9MA 3HKZN 4M3BA 2E34A 1U6GA 3I3LA 4A6DA 1RIOH 1FP1D 2Y75A 2NNNA 2QM3A 3PQKA 1FMWA 5ICCA 4G7OF 3AG1H 2Q1ZB 3HOZJ 3CCLI 3RZOJ 1YYVA 2R7VA 4OIOF 2A5WA 1LE8A 3ZQCA 1YI2I 4GCVA 2IP2A 2QCOA 4UVBA 2M7BA 3GZNB 2X51A 5LHIA 1IN6A 5FB2A 2P0WA 3DFGA 2FNPA 2VPRA 4RGXA 1MNEA 4BE1A 4HF0A 2CQNA 4Q47A 1Z6RA 2XPVA 1QPMA 2FXAA 5E18F 2DA5A 3CZ6A 4WWCA 3K4LA 3QU6A 5F08A 5HLIA 2WWYA 5TISC 4XM3A 2DJIA 3RZDJ 2JWTA 3PM1A 3G6EI 2EWNA 4WCGA 2VE8A 1MBJA 2YX7A 3BY6A 3D0SA 5FFXA 3CCEI 3FHZA 3DF8A 1U8RA 3SDBA 4PFOA 2WC2A 5E79C 5JLWA 2JA7J 2HOSA 4IHXA 3O8GA 3FX3A 2BYVE 1YW9A 2PLYA 2XV4S 3HOUJ 2M30A 1TTYA 2JQ7A 2VBWA 2FBHA 3TW7A 3MKZA 3CF2A 4Z6YA 1FYMA 2XGDA 1RKWA 4B09A 3CF5F 3CJQB 3PQJA 2KJCA 4DGWB 2BY2A 5HVQC 2NVUB 4A69C 2R5ZA 4ZDPA 1T0FC 3K70C 1HF0A 3C1DA 3PFIA 1YOVB 2L02A 1FOXA 2PMUA 4OMZA 3RKQA 4RAGA 2CW0F 2R7DA 3RCOA 2ZXHA 3HOVJ 3H5RA 2CU7A 2KIQA 3BP8A 3IP4B 1P7IA 2CW7A 1WRJA 2HI3A 1U9OA 1ON2A 2RQQA 2STWA 5TJJA 1RNLA 2BY3A 1G3SA 1FOKA 3BTCA 2X6XA 3QU3A 5CVUA 1IZ1A 3CCJI 2PJRA 2M1BA 1D3YA 1K6OA 5CVRA 5F0CA 1VQLI 3CC2I 2X6WA 2EPFA 4F91B 1USSA 2W7NA 1T2KA 3F9KA 2D45A 1Y1WJ 2IS2A 4EGZA 2LY1A 2HFHA 3I54A 5F64A 1QA6A 3E6CC 4N0BA 2CS3A 2IA1A 4I6ZA 3K70D 4IHSA 1TWCJ 2EFQA 1V5FA 2ZXWH 5DEQA 2AXLA 3DKXA 4LG0B 2HGCA 2M2EA 1YRNA 2P4WA 4II3A 1GXQA 1IXRC 2K40A 4L5EA 3BR2A 3WG9A 4HSTA 5DUIA 5CVJA 2EIMH 3ABLH 3C7JA 3CLOA 2FA5A 4L9JA 1HXDA 4E70A 1IG7A 3K1NA 3OYLA 2F48A 3DBRB 2RNGA 3ZMTA 4OIPF 2R92J 1UCRA 2Y9YA 2JJ7A 1PP7U 2QLZA 1VTNC 1YS6A 5F6FA 1TW3A 3S32A 2MFZA 3NAUA 2QKMB 3I4MJ 3HG9A 5BQTA 3GTQJ 2ACJA 3R6SA 2KZGA 1YIJI 2PEXA 3L2CA 1EKEA 1OCCH 1X1PA 2F5VA 2M3AA 4GO1A 2R7QA 2XPWA 3U1KA 2XSJC 3QP6A 5J3LA 2V1XA 2DMTA 1HC8A 2H8WA 3FXJA 2ESNA 2NOJB 3WE2A 3CJRB 3MQ0A 4CUGA 2ICWG 4ANJA 2E5NA 2H27A 3U2RA 2CQKA 5FRNA 2KJBA 3T8TA 1Y1VJ 2ZMEC 3LAJA 4AWXB 3GX4X 4CZZA 5EG0B 1KYZA 3ZXSA 1HCRA 2ZJQF 1C0WA 5DM7F 2YR2A 4RDUA 2DA3A 2FMLA 4P5OA 1ITYA 1KONA 5EZHA 3LMMA 3I59A 2CYYA 1T0FA 5HS8A 2E1CA 4MNUA 3F23A 5HLHA 2MC3A 2D1VA 1TZLA 2DA2A 5ICGA 1S29A 3FXQA 1I6HJ 3K10A 4HX8A 1CF7B 3N97A 2WB1A 3KIOA 1Z21A 1G2HA 2COMA 3M9AA 1J75A 1QVUA 3G1LA 3RPUD 3WTYC 5FD6A 2LKSA 2VQHA 2V6EA 4HEA2 5IP9J 2ECBA 2X1EA 4AIKA 3BR3A 2DN0A 1DGWY 3LSTA 2JK3A 4OAZA 4ENNA 5IOYA 4A3GJ 1VQ4I 3WTTC 2HDWA 4BQOA 4CGZA 1UHMA 2A6EF 1IO2A 3DU5A 2DCEA 4KITB 4UB8C 1JJ6C 1IDYA 3KCCA 2YX4A 2HU9A 1DDNA 3CDLA 2ELHA 2DMNA 1H88C 2L0KA 2W25A 1VQKI 3FIWA 4ZDLA 3F8NA 4I99C 3OMYA 1W5SA 2RAEA 4TV7A 2F5EA 4LIUA 3OWTA 5L3FA 3JRIA 3BZKA 4LLNA 4FX4A 2MLKA 4V2FA 5K7FA 1FPQA 2FUG2 3GW2A 4LIVA 3HGGA 3KP2A 3VSLA 2FU4A 5JR3A 2X6YA 3LA3A 2JRMA 3DEWA 4RGUA 4M3DA 1AWCA 3E0JB 2E2IJ 2GXAA 2CV1A 1R6RA 2VJ5A 3JRGA 2CUJA 1KU3A 3L2RA 1EV7A 3GFIA 3KE2A 2IA0A 2YPRA 3OYKA 3S1MJ 3CO7C 4ESJA 2X0LA 2WAEA 2DW4A 3F8MA 4ZZDA 1BI1A 1LJ9A 2M87A 3K4CA 1PDNC 1BOAA 1PJRA 3Q0UA 1HOMA 1U0JA 2OF7A 5D6EA 1VZ0A 1W0TA 4UHTA 4EVIA 2QQ9A 3DPLC 1YJ9I 3JAMZ 2E1MC 1K6YA 1T95A 3TKYA 1R22A 4D9JA 2DXIA 3ZQLA 5JVTA 1J09A 1MBHA 4RGSA 5LRSA 1R36A 3HRMA 1W7PD 3J7AY 4KMFA 2VPLA 1F36A 4RAYA 4UVAA 1O7LA 5IT3A 2KFDA 4PGHA 4IHWA 1OFCX 1BOBA 4OIRF 1LFBA 3NEUA 3CCSI 5FJ8J 3JSOA 2YUSA 4D1QA 2O3FA 1J5YA 1RC9A 4OINF 3OL4A 1TWGJ 4ESFA 4PSWA 1MKMA 5J6XA 3FXKA 1QNTA 1L3LA 5IT9Z 4U7BA 5FROA 3ULQB 4HPQA 2XC7A 5LD2C 3KP7A 4GXOA 1MJAA 2EA4A 2O8XA 5K1YA 2GOXB 3ABTA 3MKLA 3HRSA 4PJ0C 3KPHA 1TWHJ 4I01A 3S17J 4ZYEA 4C30A 4RLFA 1IF1A 2VT3A 4CICA 1JKRC 3ASNH 3BROA 3BCBA 2IVMA 2B7EA 5TGTA 1GV5A 3HZJA 3PUFA 1QHHD 5DTDA 2V79A 3S3NA 2Q2EA 4A0XA 3TDZC 3TDUC 4G8XA 4KISA 1YIOA 3JAMK 5JVGF 3V42A 5EZGA 4L9TA 3HYIA 2OU2A 3REOA 1ZG3A 3VYRB 2X6OA 5D4SA 4C3IJ 1OYIA 3BT9A 3I9V2 1CQTA 1G4DA 4NC7A 2Z9OA 1BR1A 1IRGA 1NG6A 3ZMZA 3OYDA 2RN7A 2BZTA 3IUOA 2IA2A 3K69A 4XKWA 3P9KA 4HZFA 3DPUA 3GCMA 3K2AA 4F52A 3DQVC 4BXXJ 2M0MA 3DWLE 2EA2A 2D5VA 3G2BA 2ZXIA 4IHVA 4RMNA 3QPHA 2WAQN 3LSRA 4YRVA 2VXDA 3TP0A 5D5VB 2E7WA 5DUKA 1VFCA 5LBQA 2HVSA 3S2HJ 1KQ0A 5IT9K 2Q0OA 3S1RJ 1XS9A 4XKBA 1K4TA 2FD5A 3GUDA 2GQQA 1BJAA 1YE9A 2IGKA 3OYBA 3T1BA 2P7CB 2YU3A 4IQJA 2P6TA 3HUGB 3HGYA 3ZP5A 2MH2A 3P7NA 4WF2A 1GVJA 3L7WA 5F1JA 4FCYA 1RR7A 3LQRA 2K27A 3TO6A 4XKVA 2R4GA 4BS9A 4X0GA 4FTHA 4A3IJ 4EM1A 1QU3A 3KP4A 1WWXA 5KHDA 3ZPLA 4LB5A 5IYBJ 4BYYA 5F1RA 2E1OA 4CYCB 3D5LA 4YELA 2O8KA 2CSOA 5IP6A 3M07A 3RQ4A 5A2QZ 4Y7NJ 2HKXA 4PJMA 3BTJA 1YTYA 2DOAA 4J19A 4CCKA 1NH3A 3DTIA 3CJNA 2VBYA 2IAIA 2NVQJ 1JUPA 3A03A 1Z05A 3W2WA 2DDAA 1WI9A 1R9TJ 2M4KA 4PGGA 4XRSA 1IC8A 4HYEA 3KLNA 4ZYDA 5IP7J 1LUJB 2M8GX 2M45A 1BIAA 2X1CA 2ID3A 1DP3A 3FZVA 4V2GA 3GTLJ 4MQVA 3FXLA 2VQLA 1SAXA 2XPUA 3FMRA 1F43A 1E0EA 1B72B 3SYTA 4HLYA 4NQWB 1FMVA 4GYIA 3KYDB 3OYNA 3GTGJ 2EINH 5JHUA 4UUSA 2MC4A 1ETXA 2JMWA 3EUHC 4QLCU 3H9QA 4RM3A 3S1QJ 3FK6A 3I64A 1HLVA 4A12A 2HDCA 3RQIA 1TT0A 3LSJA 4U0VA 2Z33A 1AKHA 2R7OA 4A5NA 2RGVA 4FT8A 3H9JA 2XVCA 4WK8F 2L54A 2XUBA 3CESA 2E2HJ 1K61A 1EA3A 1Y0NA 2DPUA 4KFCA 1U2WA 3K4NA 3L2WA 1IN8A 4S0HB 3F3XA 2HYJA 1Q1VA 4Y4RA 2J5OA 3DTKA 4L5JA 1Y39A 3DPTA 1VQ7I 1RKTA 2LC2A 2EFWA 2GBYA 3TQNA 4BL0B 1I39A 4EJOA 4MEXF 3C2BA 4E7IA 1MNDA 2BY0A 4LK1F 4EJUA 1R4MB 5K5QA 5J8CA 3V7SA 2XB5A 1VF9A 4XSZF 5KCMA 4OIQF 1QO0D 1X1CA 2QUFA 1KZHA 3GLXA 3EQLF 3JREA 4D7NA 1SFEA 4PZJA 4H0EA 2K4BA 4MTDA 2VKVA 3FDYA 3RYPA 4ZTFA 1O3TA 2JSCA 2JA8J 3O2PE 4JP0A 2ZNZA 3PUBA 1Z91A 1ZAOA 2NOGA 1NK2P 4D5FA 1FTTA 1XG1A 4A0YA 3WG7H 3GFLA 2JVGA 5E1WA 2HYGD 2NS7A 1S3JA 3HDDA 3R61A 2LLKA 3K4KA 3WTUC 1ZRCA 2KDOA 5HLGA 1JGGA 3RKXA 4M71A 3IKVA 1IUFA 4XLPF 1EH6A 2OA4A 3Q9VA 4Q48A 3H3ZA 2EILH 4Y52J 1Y8QB 3HTUA 4U87A 5F04A 4G6QA 2BGCA 5J4YA 1HSTA 4D5CA 2DPDA 3K7AJ 4R79A 1S72I 1PUFB 4FQGA 4E4HA 3DBLB 5J47A 4HX4A 4CH7A 1U78A 2H1LA 3SDGA 2W24A 4GGGA 1FLIA 2KLOA 4QWQA 2L7KA 3EUAA 1MIJA 2CGPA 5LGNA 2R0QC 4L9NA 4B8XA 1XDSA 2FEZA 4HNVA 3LSIA 3RTRA 3GWZA 1WGXA 2XDVA 3Q0VA 4NB5A 3BC8A 3S93A 2ISZA 3HOXJ 1Z3YA 2QYOA 2GM4A 3CUOA 1LDKB 2QSGX 2VJ4A 3WGHA 5E20A 1S7AA 1T98A 3EUHA 1O3RA 3H92A 4PCQA 3LL7A 1IAWA 3RIRA 1P92A 2IS4A 4LD5A 1O3QA 3HOTA 2DAOA 3A1YA 2IEKA 3O8HA 3BDDA 2NVYJ 1I5ZA 1XC5A 4M73A 5IPAA 3A01A 5DYMA 2LFBA 4R1HA 4ASNA 1ULYA 3FM5A 1XDUA 3FM3A 4QSHA 3SEZA 1WH7A 2XSDC 3F22A 3AL0B 3NWTA 5DS9A 2CQ7A 5EEHA 4EJWA 4XONA 1JT6A 2H6BA 1WSUA 2VOOA 4ENJA 5FFZA 1P9QC 2XGCA 3QWLA 4ZTJA 5B1AH 4LG0A 3WTWC 4FHTA 1B9NA 5BPDA 2AO9A 3OOUA 4BNCA 4P9FA 4C9YA 4M6VA 4Y33A 3PNVA 3ZQQA 3HIFA 2E36A 4ZZLA 4ZDOA 4IF4A 3VFZA 3FXUA 1WJCA 2IPQX 2WAFA 4C3JJ 3COAC 4HQMA 4MIMA 3OYFA 3F8FA 5JFRA 1VQMI 2LG4A 4KT6A 3X2QH 3TO9A 3S2DJ 4PJJA 4IPAA 5M3MJ 3DLLF 3D1NI 1SEUA 4LOCA 1KU7A 2V1NA 3JW4A 3S16J 4CCJA 2KQRA 3K9TA 2WADA 3V4GA 2NVTJ 2R3SA 2FBIA 1UMQA 4L9VA 2C6YA 1R49A 2VT2A 1FYKA 2JPCA 1QPIA 1ONVA 1NHAA 3FF5A 4M6XA 2DMUA 3BG5A 3ZGKA 1B6AA 1R4NB 2LREA 1JI8A 1LPQA 1ZN2A 4I98B 5EYRA 1AA7A 2CQXA 3BPVA 3V8JA 1LFPA 2K3PA 1D5YA 3HC7A 2YU9J 1BIBA 3H3VK 2E71A 1E2XA 3FKJA 1PUEE 1BM9A 4IZZA 3BTIA 4QPOA 1V55H 5FKLA 3GTPJ 1U5TC 2IS1A 1GUUA 4LITA 2F4OB 3B6AA 4UV8A 3ML6A 3BQZA 4AIDA 4S04A 1VQOI 1H9GA 2F5CA 4A3BJ 3H1CA 2M4GA 1F1ZA 4A3DJ 2EFPA 1FBUA 3E7LA 4HLXA 2K02A 1FBQA 1CF7A 4CCLA 2R7SA 1I1SA 2RC4A 3T5XA 3BR1A 3ZMUA 2QBYB 3RSNA 1X3UA 2WAQA 1HKSA 3SHFA 3VYTB 4KA4A 1Y8RB 3WU0A 3FMSA 2WY8Q 5BPIA 3GZ6A 2Q8KA 1R7JA 1OMIA 1W36C 3DTEA 4L5IA 2WA0A 4P96A 1W4MA 3GTJJ 2HOTA 2WV0A 1LB2A 2GIZA 1Z1DA 4AVPA 2KHMA 1R5GA 3CUQB 2FOWA 1T38A 1UHWA 4HBLA 1RETA 2TDXA 4CCNA 1JHHA 1ODDA 1WKMA 3KEOA 2JZYA 1F4KA 2O9LA 2FJ1A 2W48A 2W57A 4P9UA 4PUSA 3OIQA 2Y0SA 2DA4A 5EDNA 4HQEA 5E17F 2WTEA 2GWRA 3N05A 4J01A 1ZGWA 3LAPA 3I55I 3DKYA 1W1WE 4CCMA 1A6QA 3MEXA 3JR9A 2NRAC 1U9NA 2L4AA 5KK1A 2G9WA 3A4CA 3WTZA 2R7WA 3QOEA 3IH3A 2HVRA 2BW3B 5F27A 5DM6F 2O5RA 3C2GA 1LEBA 3LSMA 3A02A 4K2EA 1B4AA 1P4XA 2EBIA 1EF4A 4DOZA 3G73A 4B3AA 2L4MA 4XK4A 1V5EA 1ZKGA 1B8IA 1QZZA 1SVOA 4XRSG 1M1EB 2PQ8A 3D5RC 1K7AA 1R1VA 2DQRA 5HNHA 4RAFA 1WJFA 2XHKA 3CTAA 4XOPA 5CKTA 4EEFG 2P5LC 1IRZA 4N4OB 2W1OA 4ENKA 2OAZA 1ZG5A 1Z77A 1GVDA 3SEQA 1FNNA 4BACA 3SZTA 2EZIA 3OY9A 3GBGA 5F0HA 2DI3A 2XRNA 2XIGA 3JTGA 4YIRX 3DCFA 4GRIA 4UV9A 1LE8B 3V7CA 3L9FA 3U1DA 1BL0A 2FOKA 3S1NJ 2HKOA 3LFUA 5GPCA 3DBHB 2CUEA 1ACIA 3A2KA 4IO9F 1A31A 3SZPA 1D5VA 2BXZA 1POGA 2K7LA 1U5TA 3E5QA 1HSJA 4M72A 4DBRA 3J80K 4E7HA 3BJOA 5CPRB 1MDMA 3RDIA 4AD9A 3DXJF 2Z5UA 5D8KB 4RB3C 3QRFF 2EFOA 3VOEA 4CCOA 5J1YA 1R5HA 1MMGA 1H9TA 4HOBA 3ZQ7A 2XAUA 3J81K 2LBFB 2MD5A 2VASA 4UUVA 1WPKA 2NYXA 1XGMA 1JUSA 2LVSA 2BHYA 3K4MA 3ZRGA 5GADJ 5M5XJ 2KP6A 4NNJA 2O7OA 4BU2A 3LNQA 2MBFA 3KZYA 4B1RA 4BJ5C 3BQYA 3DLAA 2GA1A 1JKPC 3OS0A 1SFUA 2PMZA 4KIGA 2DBBA 2LTPA 3P5JA 4PJLA 3GTKJ 1ETQA 3KFWX 1PYVA 2EIJH 1N77A 1OCTC 4BGDA 2PMHA 2KMUA 5EF6A 1NTCA 1I27A 3GFMA 1H0MA 4W97A 4XBFA 2W82A 4I76A 5K7HA 1VQ6I 3GLLA 2CW8A 3KP3A 3H0DA 4G6TB 3N4MA 2R5ZB 3M3YJ 4HG2A 3EYIA 3QYFA 2KL4A 2F4IA 4JK1X 2IRFG 2EH3A 4V19K 1ZLJA 4HRIA 4G6DA 3QODA 1ZQ3P 1HBXG 2CQQA 5ILVA 1Z6TA 2OTLI 1ZR2A 1SD7A 2Y30A 4B44A 3HPHA 3CO6C 3H36A 2VC1A 3L2UA 2G7HA 5H2FC 3I71A 4BE0A 4A3MJ 4C2MJ 4IOCF 3PO2J 3G3ZA 2PJRB 3CMEI 2LYCA 5M5WJ 2M0CA 1QZEA 2F4MB 4BKXA 4YFKF 3CD6I 5FGMA 1JKQC 1BW5A 4DYRA 2FSWA 2EQRA 4PK4A 3S8PA 1J0RA 1YFHA 1HA8A 4WXDA 1O3SA 4G7ZF 3ASOH 4IJAA 1YX5A 1Z7LA 5HS9A 1FTZA 5BS6A 3ZN1A 1WJBA 5DDGA 1MBFA 3MKWB 3GTMJ 4AIHA 3HTSB 3MAJA 1MBEA 3NQOA 4BJ6C 2E2JJ 5BNGA 1V4RA 1YRNB 3W3CA 2LNBA 2VE9A 2ME0A 3V7RA 4G7HF 4A3EJ 2UXXA 1ORKA 4QIWN 1FC3A 2E60A 2K3FA 1V54H 2IJLA 1JGSA 2QGUA 5JLXA 1GXPA 1MSFC 2BOLA 2G0EA 2IW5A 1RUOA 2ZMEA 2BBYA 3G71I 3CCMI 4KDPA 4XKCA 3BR6A 3I56I 3WHBA 3Q9SA 1YITI 4XLNF 1TWAJ 1SFOJ 3ERED 4IHTA 1AOYA 2FQ3A 1B72A 4UXNA 5EJCA 3V8KA 3E5UA 1BW6A 1U3EM 1LNWA 2L01A 2HOEA 1VQ5I 3VEPA 3CMAI 1QQIA 1IV8A 4I2OA 4FISA 1NG7A 2EB7A 2ZKZA 4BBRJ 1F5TA 3BJ6A 2OCEA 3HKZA 3IL2A 4UB6C 2BXYA 2MABA 1S7EA 2P8TA 3GXOA 1LEAA 1Z0XA 4DZPA 5GTHC 1SC7A 2GIVA 4G9YA 1FJLA 3WTVC 3ZMSA 4L18B 2K86A 4KJZA 1DPUA 1YLFA 1ZGAA 3VYUB 3CDIA 3F0CA 4II2A 3C2HA 3I4PA 4RA2A 1OR7C 1O4XA 4GDFA 3PIPF 5C4XJ 2UXNA 3I59B 1ENHA 5FKOA 4F93B 2CWEA 5DV5A 2PFBA 4AC0A 2B63J 4LLGF 2Y31A 1MH3A 4KICA 4XLFA 4YFNF 2V1UA 5C3EJ 2EV5A 1CGPA 3AG3H 5BOXA 1D1CA 1BC7C 1FSHA 2NXNB 1JTYA 4BJTA 1WH5A 3JRHA 4MTEA 2QZ8A 2DDBA 5LGTA 4I0AA 4XSXF 2QSHX 4UNOA 1RZ4A 3H35A 5L3GA 4IVNA 5LRRA 2A6TA 4A93J 2F5DA 2A5YB 3R4KA 3ZQIA 4HF2A 1QBJA 3FXMA 4EV0A 1RPWA 2O61A 1SD4A 3IV5A 4IKFA 3BJAA 1IJWC 3CCYA 4EM0B 1GV2A 2OPTA 2A05A 1MMSA 2BHZA 4FE7A 4CHUA 1X58A 1MMAA 9ANTA 3CDHA 1YJNI 2BY1A 2O6GE 3H5AA 4M3EA 2K9SA 2AHQA 2DFHA 1Y56A 4DJAA 1J59A 1T56A 5D6FA 5E3NA 3JRBA 1U8BA 1BC8C 4BBSJ 1OCZH 4JQFA 1VQPI 1FIPA 3I53A 4M9SA 1UB9A 5HOOA 2VOPA 3ISPA 2VKDA 4IHYA 4JOMA 5FD5A 1HW5A 2RDPA 5EGOA 3OYCA 1J2XA 2LOOA 4M74A 3Q5FA 2HPMA 5GAEJ 2GLOA 2Z1DA 2VIXA 1E3OC 2L9VA 3RYRA 1LKXA 2RREA 2XAQA 1F9NA 3BZCA 4ABZA 3FMQA 5J1UA 2P6SA 1G8XA 3ECHA 1R58A 5HS7A 4I0BA 1XGSA 2DOEA 2MA3A 5BMZA 1TP4A 3PSIA 5LGUA 2ETHA 2N8GA 2E5ZA 1X1AA 3BPXA 4KIFA 4MFEA 1A35A 3B73A 3DV8A 5D5WB 4FE4A 3TL4X 2DODA 2OBPA 4MGRA 4YFXF 2DFFA 2HDDA 3RPQA 5J1RA 4Z2YA 4PSXA 5E8IA 1YQAA 1FSEA 1MGTA 4O6JA 4KN4X 2OQGA 2QEXI 1OR7A 2V1DA 1QGPA 3JTHA 3WU2C 3WU1B 3ECOA 2DTRA 3MZYA 2EZHA 3HSFA 5KAFC 1OISA 4ENMA 3MCZA 1KGSA 4LJZF 4AU7A 1BN5A 1XD7A 2A6HF 2H09A 4DNCA 5HDNA 4BAYA 1OKRA 3KP5A 4XLAA 1YW7A 3PSFA 3HB9A 4IRIA 4O5VA 5L3EA 2Q2EB 5EEAA 2GA2A 4WX9A 1SANA 2QF7A 1XGOA 2Y69H 2IGNA 4BDYA 1XB4A 4PDKA 4BH9A 4IOAF 3IAM2 3HBLA 3BOQA 3TGNA 1HW2A 1OPCA 1Z67A 4IRHA 2JUGA 2FMYA 2WV1A 4MHGA 3OYMA 4OU0A 1YO5C 1ZYRF 3QYEA 1IV6A 3QPSA 5KAIC 1APLC 1EJ9A 4YIIA 1K78B 1JHFA 2XASA 5D4RA 3JSPA 1K4SA 4Y17A 4P1WA 1N25A 1JT0A 1W7PB 4HA8A 4OOIA 1KU9A 3EUKL 2DK8A 2XGXA 3MVPA 2WB1N 3FISA 4KNYA 1PVEA 2CUFA 3IWZA 4E7JA 3CCUI 2B9SA 4I7HA 3KP6A 5LFAA 3RI4A 1FZPB 3OR1C 1X3WB 1GT0C 1GHCA 3ZQGA 1X2MA 3PFYA 3OIOA 1LDDA 2P81A 3RKWA 2ID6A 4RS8A 1IGNA 4AM3A 2ZB9A 4LB6B 4CSWA 1OCOH 1WQ2A 1Z7UA 4NC8A 5FKNA 3WGIA 2KIMA 3ZQFA 3A0BC 3LSPA 1IN4A 1D0ZA 2O03A 2HQRA 4NBQA 1ON1A 2EK5A 4UUTA 5FRMA 5H6QA 3PIOF 4EATA 1J9IA 4BQAA 2KRFA 5GAHJ 1P6RA 2I10A 2NS0A 1IN7A 2XKOA 3AFHA 3MD2A 4P55A 2V9VA 4RB0A 1ZGJA 4XLHA 1UG2A 4D0PA 2QQAA 1B9MA 2DJNA 3E6MA 3GVAA 1XMKA 1DGRM 3S2WA 3UNGC 2R7UA 3M8JA 4XICA 4RB2C 1BI2A 4A2UA 3HOSA 2AS5F 2PBIA 2LY9A 3E3VA 3OIPA 5CVIA 4KIBA 2CV0A 2L7ZA 2PX9A 3DKWA 1VQ8I 2HTJA 2UWMA 4YG2F 4DQ2A 2BVLA 2JTVA 3BG6A 4HAMA 2W4SA 5TRDA 3L2QA 2CFOA 3ROUA 4YIFA 2OZUA 5E1ZB 2X1DA 1USTA 4ZH4F 2HZDA 3B6CA 4DIQA 4RGRA 3IAS2 1HKTA 4CO8A 2K9LA 2X85A 2Y2ZA 4KMUX 2D1HA 4HNTA 1UAAA 5DCMB 3GMEA 3E5XA 4JX6A 2V26A 3JCUC 4HNUA 2O0YA 1UG0A 2L5QA 3S3MA 1SD5A 3BCAA 2OD5A 3FXRA 1XPXA 2K4JA 4EM2A 3MWMA 5J4VA 4UUSB 2DA1A 3ABMH 3F6OA 3FXOA 1R1UA 1XGNA 1K79A 1TQMA 3OR2C 4CA0A 4B48A 2XKPA 1AKHB 4I02A 1QRYA 4F3QA 5AIPA 5L3BA 2LKPA 1K83J 2IBDA 2Z3YA 4ON0A 4Y13A 3FBIB 2R7ZJ 3BLYA 1XSXA 3E6DA 2ELKA 3FK7A 5FKMA 5E3OA 3BR0A 2OTJI 4E7LA 1S6LA 3MFKA 2I8DA 4HV6A 3G4SI 3PO3J 1AU7A 2JA6J 3J7ZI 1YS7A 1O7FA 1JUMA 2L3DA 2BE5F 1FOWA 1W5TA 2UUZA 2DFIA 1IUYA 3ONQA 2QQ8A 1LDJA 3VPRA 2R5YB 5K7ZA 2ZO4A 3HHHA 5AONA 3KX2A 2CG4A 4ETSA 1SMTA 1XX5A 4A3FJ 1MH4A 4BQQA 3IC7A 2XF5A 2E19A 4AUXA 3WTXC 3UKGA 1P4WA 4X1EA 2HZTA 1JTXA 2XF6A 4EJTA 1KQ8A 1DQUA 1T08B 1G3YA 1XMXA 1GLNA 2MSYA 1G6NA 1STZA 3KETA 2FBKA 2F6CA 5EG0A 4FETA 3QOPA 1OQYA 1XN7A 2FX0A 3CJTB 3LWFA 2E7XA 3M1CA 3AKZA 2QQBA 2LBFA 2VB6A 1HW1A 1T8IA 3WGGA 3M8FA 3SFIA 4B47A 5ILUA 4HDVA 2STTA 5ILSA 1RUNA 5CQGA 5C4JJ 4CDGA 4A3CJ 2VI6A 1X4PA 5ERIA 3IH2A 3VB2A 4L0ZB 3P9CA 1X4OA 1WFXA 4U0WA 4HV5A 3TO7A 1ETWA 1X2NA 5HDGA 1D8JA 3GEZA 4XLCA 1Q1HA 2IS6A 1N78A 2CJJA 2ZJPF 1R23A 1SFKA 4A5MA 2XROA 1MMNA 1YG2A 4QTRA 3K1PA 3K1MA 2ZSIB 2V7FA 1TW2A 3QPTA 3OYIA 5LLQA 2FF4A 3ERMA 1DUXC 3UR3C 2HQ5A 1JJ8C 1OLTA 3M4OJ 2VONA 1RR8C 3HOYJ 3TOAA 2Y9ZA 2H8RA 3TP3A 3F8CA 3TW6A 3DEUA 1MJBA 3J80Z 2V9PA 5EEGA 4N9IA 1VNDA 4OMYA 2F5FA 3ESWB 2CO5A 1LQ1A 1D0YA 1O57A 3ZQHA 3J81Z 4NC6A 1QHGA 2P7VB 1WJDA
chains in the Genus database with same CATH topology
2L9RA 1MBFA 3A01B 5FLVA 3GTMJ 1MBGA 4XRSA 1IC8A 2CRGA 1ETKA 1MBEA 1OCPA 3G1OA 5E3LA 3SJMA 5FKKA 2LD5A 2E2JJ 3BTLA 5BNGA 1YRNB 5IP7J 2M8GX 2NVXJ 2K9NA 2ID3A 2ME0A 4V2GA 3GTLJ 3Q0WA 4A3EJ 4QIWN 1ORKA 4XIDA 4XRMA 1F43A 2XPUA 5JLXA 1ETVA 1B72B 1MSFC 3LOCA 2G0EA 4X6AJ 3IH4A 3I4NJ 3GTGJ 4UUSA 2ECCA 1ETXA 2KT0A 2LK2A 2HXIA 3BR6A 2JMWA 3W6VA 1MBKA 2COBA 2R93J 3S1QJ 4RBOA 3WHBA 1ZTRA 3FK6A 3QQAA 1TWAJ 1SFOJ 1HLVA 1ZK8A 3RQIA 1B72A 3LSJA 5GPAA 1BW6A 1AKHA 2M9HA 1TWFJ 2E2HJ 3HKZN 4M3BA 4FISA 1K61A 4BBRJ 3S14J 3ZOBA 2K9QA 4S0HB 2HYJA 1Q1VA 3HOZJ 3RZOJ 1WCMJ 1RKTA 2GBYA 1BJZA 5GP9A 1S7EA 1LE8A 3ZQCA 1TC3C 4DZPA 1Z0XA 2QCOA 1FJLA 3C2BA 2XB5A 3F0CA 1VF9A 1O4XA 2DMPA 5C4XJ 1UHSA 3JREA 4D7NA 2VPRA 1ENHA 5FKOA 2VKVA 2B63J 3GTOJ 4AC0A 2JA8J 4JP0A 2Y31A 2XPVA 1MH3A 5IYCJ 2NOGA 1NK2P 2DA5A 5C3EJ 4D5FA 1FTTA 1XG1A 3MN2A 5F08A 1JTYA 1WH5A 5IOZA 3JRHA 2NS7A 3RZDJ 3HDDA 2LLKA 2JWTA 3PM1A 2NS8A 1JGGA 1MBJA 3JRDA 1IUFA 5JLWA 4Y52J 2JA7J 4A93J 2HOSA 4IHXA 1ETYA 3O8GA 4GFBA 2DTZA 3ZQIA 5F04A 4W1UA 3HOWJ 1BA5A 1RPWA 3HOUJ 3IV5A 4D5CA 2TRTA 3K7AJ 3TW7A 1IJWC 1PUFB 3CCYA 2XGDA 1RKWA 2VKEA 1GV2A 4A69C 2OPTA 2R5ZA 1U78A 1HF0A 4DW6A 3HEFA 4FE7A 3SDGA 1X58A 2EZLA 9ANTA 1AHDP 3RKQA 4M3EA 2K9SA 2AHQA 4MLOA 3HOVJ 4MFDA 2CU7A 2R0QC 1H89C 1T56A 1P7IA 5E3NA 3JRBA 1U8BA 4NDLA 2HI3A 1U9OA 4HNVA 4BBSJ 1WGXA 3Q0VA 1FIPA 3OSFA 3BTCA 3HOXJ 4IHYA 2GM4A 3OSGA 2LR8A 4G12A 5EGOA 4CYCA 5F0CA 2GLOA 1E3OC 2L7MP 2X9DA 4ABZA 2EZKA 5J1UA 1Y1WJ 2DMQA 2IEKA 3O8HA 2NVYJ 2ME6A 4I6ZA 1XC5A 2N8GA 5IPAA 3A01A 1TWCJ 4MFEA 2DA6A 5HODA 1B8IB 4AYBN 2LFBA 2M2EA 4FE4A 1YRNA 4QSHA 1WH7A 2XSDC 1LFUP 3H0GJ 2HDDA 2K40A 4L5EA 3BR2A 5DS9A 5J1RA 2LP0A 5C44J 1JT6A 1IG7A 2XGCA 5E3MA 1H8AC 2R92J 2AO9A 3FKIJ 2Y9YA 2MW8A 3OOUA 2EZHA 2JJ7A 4M6VA 3NAUA 3I4MJ 2FQ4A 3GTQJ 1DU6A 4DYCA 1I3QJ 4C3JJ 2VUMJ 4MIMA 1MSEC 2JN6A 2XPWA 3HB9A 1I50J 3S2DJ 5EEAA 5J3LA 1A5JA 1SANA 2DMTA 1T33A 2QF7A 5M3MJ 2LKXA 1MNMC 3D1NI 3HBLA 4LOCA 5M3FJ 3S16J 1Y1VJ 2WV1A 2NVTJ 5EG0B 1UMQA 1HCRA 3QPLA 1IV6A 4DYQA 4RDUA 3QPSA 1DU0A 1QPIA 1APLC 2DA3A 1JT0A 2DMUA 3BG5A 1ITYA 5EZHA 5EYRA 3MVPA 2CQXA 4BY1J 2WB1N 3FISA 1D5YA 2YU9J 2CUFA 2DA2A 3H3VK 1I6HJ 1FIAA 1GT0C 3BTIA 1G2HA 3ZQGA 1X2MA 5FKLA 1QVUA 3G1LA 1GUUA 2JA5J 3GTPJ 3BR5A 3B6AA 5IYDJ 1ETOA 3BQZA 3OIOA 2P81A 2ID6A 5IP9J 2ECBA 2DN0A 3BR3A 1IGNA 2ZB9A 2JK3A 2L7FP 5IOYA 4A3BJ 4A3GJ 5FKNA 3ZQFA 4A3DJ 3E7LA 3LSPA 4IEJA 3BR1A 4A3KJ 1W0UA 4B4CA 1JJ6C 1IDYA 4UUTA 3CDLA 2TCTA 2I10A 2DMNA 1H88C 2L0KA 1ZR4A 1UG2A 3FIWA 1PUFA 2DJNA 4JYKA 3S15J 1RESA 4XICA 3GTJJ 2HOTA 2RAEA 3JRAA 3JRIA 3CMYA 4V2FA 5K7FA 2LY9A 5M5YJ 2M34A 2L7ZA 3HGGA 1RETA 3DEWA 2E2IJ 4M3DA 4JX5A 2Y0SN 3JRGA 4C3HJ 2O9LA 2FJ1A 2W48A 3NARA 3B6CA 3S1MJ 3LSGA 2Y2ZA 5EDNA 2DA4A 1ZGWA 3Q0UA 1HOMA 2OF7A 1FEXA 3JR9A 4JX6A 1W0TA 1U9NA 3IH3A 5F27A 3A02A 3ZQLA 1MBHA 2KDZA 4UUSB 1EF4A 2EBIA 3G1MA 1HDDC 2DA1A 4B3AA 4XK4A 2DA7A 1F36A 1ZKGA 1B8IA 4IHWA 4XRSG 1OFCX 3BG3A 1LFBA 1AKHB 1QRYA 4MO7A 5FJ8J 1K83J 2IBDA 2YUSA 4EEFG 1IRZA 3CQZJ 2R7ZJ 1TWGJ 5FKMA 2ELKA 3FK7A 2X48A 5E3OA 1Z77A 1GVDA 3BR0A 2EZIA 3GBGA 5F0HA 1NK3P 3PO3J 1AU7A 2JA6J 3DCFA 2H1KA 3MKLA 1LE8B 1JUMA 1BL0A 1TWHJ 3S17J 1JKOC 3S1NJ 5GPCA 2CUEA 3VPRA 2R5YB 5K7ZA 1JKRC 1POGA 1QVTA 4A3FJ 4D7MA 1MH4A 5F0FA 1GV5A 2E19A 5DTDA 4AUXA 3UKGA 4X1EA 5J1YA 1JTXA 4JX4A 2HXOA 4M3FA 1P7JA 2YS9A 4DZJA 4M3GA 3TEDA 2R5YA 1WPKA 2MSYA 5EZGA 2MGQA 1GDTA 3BG9A 1JUSA 1OJLA 2LVSA 5M5XJ 2O7OA 5EG0A 3LNQA 2X6OA 4C3IJ 2XGEA 2PMZN 3BT9A 1CQTA 4B1RA 2MG4A 2XRLA 3BQYA 2FX0A 1JKPC 3K2AA 2LTPA 3GTKJ 4A3LJ 4BXXJ 1ETQA 1OCTC 2D5VA 1HDPA 4IHVA 5EF6A 2WAQN 3LSRA 3SFIA 1NTCA 1WI3A 4W97A 3TP0A 1VI0A 4I76A 5C4JJ 5K7HA 1VFCA 4A3CJ 2VI6A 1IDZA 3S2HJ 3S1RJ 2R5ZB 1XS9A 3M3YJ 3IH2A 2EH3A 2FD5A 1ZQ3P 2CQQA 3Q3SA 2HOAA 1ETWA 1X2NA 2CJJA 3HGYA 1ZR2A 4QTRA 2Y30A 5F1JA 4FCYA 1RR7A 3HM5A 2HQ5A 1JJ8C 3WHCA 3M4OJ 4BY7J 3HOYJ 4FTHA 4A3IJ 4C2MJ 4A3MJ 3PO2J 1A6IA 2Y9ZA 2H8RA 3TP3A 5M5WJ 2M0CA 5IYBJ 2E1OA 4CYCB 5EGOB 4BKXA 2O8KA 3TW6A 5IP6A 3JRFA 1JKQC 1BW5A 5FLMJ 4DYRA 4Y7NJ 2EQRA 1VNDA 3BTJA 4J19A 3L1PA 2IAIA 3JRCA 1JUPA 3A03A 3ZQHA 2NVQJ 1FTZA 4A3JJ 2XB0X 1R9TJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9R A;  1MBF A;  3A01 B;  5FLV A;  3GTM J;  1MBG A;  4XRS A;  1IC8 A;  2CRG A;  1ETK A;  1MBE A;  1OCP A;  3G1O A;  5E3L A;  3SJM A;  5FKK A;  2LD5 A;  2E2J J;  3BTL A;  5BNG A;  1YRN B;  5IP7 J;  2M8G X;  2NVX J;  2K9N A;  2ID3 A;  2ME0 A;  4V2G A;  3GTL J;  3Q0W A;  4A3E J;  4QIW N;  1ORK A;  4XID A;  4XRM A;  1F43 A;  2XPU A;  5JLX A;  1ETV A;  1B72 B;  1MSF C;  3LOC A;  2G0E A;  4X6A J;  3IH4 A;  3I4N J;  3GTG J;  4UUS A;  2ECC A;  1ETX A;  2KT0 A;  2LK2 A;  2HXI A;  3BR6 A;  2JMW A;  3W6V A;  1MBK A;  2COB A;  2R93 J;  3S1Q J;  4RBO A;  3WHB A;  1ZTR A;  3FK6 A;  3QQA A;  1TWA J;  1SFO J;  1HLV A;  1ZK8 A;  3RQI A;  1B72 A;  3LSJ A;  5GPA A;  1BW6 A;  1AKH A;  2M9H A;  1TWF J;  2E2H J;  3HKZ N;  4M3B A;  4FIS A;  1K61 A;  4BBR J;  3S14 J;  3ZOB A;  2K9Q A;  4S0H B;  2HYJ A;  1Q1V A;  3HOZ J;  3RZO J;  1WCM J;  1RKT A;  2GBY A;  1BJZ A;  5GP9 A;  1S7E A;  1LE8 A;  3ZQC A;  1TC3 C;  4DZP A;  1Z0X A;  2QCO A;  1FJL A;  3C2B A;  2XB5 A;  3F0C A;  1VF9 A;  1O4X A;  2DMP A;  5C4X J;  1UHS A;  3JRE A;  4D7N A;  2VPR A;  1ENH A;  5FKO A;  2VKV A;  2B63 J;  3GTO J;  4AC0 A;  2JA8 J;  4JP0 A;  2Y31 A;  2XPV A;  1MH3 A;  5IYC J;  2NOG A;  1NK2 P;  2DA5 A;  5C3E J;  4D5F A;  1FTT A;  1XG1 A;  3MN2 A;  5F08 A;  1JTY A;  1WH5 A;  5IOZ A;  3JRH A;  2NS7 A;  3RZD J;  3HDD A;  2LLK A;  2JWT A;  3PM1 A;  2NS8 A;  1JGG A;  1MBJ A;  3JRD A;  1IUF A;  5JLW A;  4Y52 J;  2JA7 J;  4A93 J;  2HOS A;  4IHX A;  1ETY A;  3O8G A;  4GFB A;  2DTZ A;  3ZQI A;  5F04 A;  4W1U A;  3HOW J;  1BA5 A;  1RPW A;  3HOU J;  3IV5 A;  4D5C A;  2TRT A;  3K7A J;  3TW7 A;  1IJW C;  1PUF B;  3CCY A;  2XGD A;  1RKW A;  2VKE A;  1GV2 A;  4A69 C;  2OPT A;  2R5Z A;  1U78 A;  1HF0 A;  4DW6 A;  3HEF A;  4FE7 A;  3SDG A;  1X58 A;  2EZL A;  9ANT A;  1AHD P;  3RKQ A;  4M3E A;  2K9S A;  2AHQ A;  4MLO A;  3HOV J;  4MFD A;  2CU7 A;  2R0Q C;  1H89 C;  1T56 A;  1P7I A;  5E3N A;  3JRB A;  1U8B A;  4NDL A;  2HI3 A;  1U9O A;  4HNV A;  4BBS J;  1WGX A;  3Q0V A;  1FIP A;  3OSF A;  3BTC A;  3HOX J;  4IHY A;  2GM4 A;  3OSG A;  2LR8 A;  4G12 A;  5EGO A;  4CYC A;  5F0C A;  2GLO A;  1E3O C;  2L7M P;  2X9D A;  4ABZ A;  2EZK A;  5J1U A;  1Y1W J;  2DMQ A;  2IEK A;  3O8H A;  2NVY J;  2ME6 A;  4I6Z A;  1XC5 A;  2N8G A;  5IPA A;  3A01 A;  1TWC J;  4MFE A;  2DA6 A;  5HOD A;  1B8I B;  4AYB N;  2LFB A;  2M2E A;  4FE4 A;  1YRN A;  4QSH A;  1WH7 A;  2XSD C;  1LFU P;  3H0G J;  2HDD A;  2K40 A;  4L5E A;  3BR2 A;  5DS9 A;  5J1R A;  2LP0 A;  5C44 J;  1JT6 A;  1IG7 A;  2XGC A;  5E3M A;  1H8A C;  2R92 J;  2AO9 A;  3FKI J;  2Y9Y A;  2MW8 A;  3OOU A;  2EZH A;  2JJ7 A;  4M6V A;  3NAU A;  3I4M J;  2FQ4 A;  3GTQ J;  1DU6 A;  4DYC A;  1I3Q J;  4C3J J;  2VUM J;  4MIM A;  1MSE C;  2JN6 A;  2XPW A;  3HB9 A;  1I50 J;  3S2D J;  5EEA A;  5J3L A;  1A5J A;  1SAN A;  2DMT A;  1T33 A;  2QF7 A;  5M3M J;  2LKX A;  1MNM C;  3D1N I;  3HBL A;  4LOC A;  5M3F J;  3S16 J;  1Y1V J;  2WV1 A;  2NVT J;  5EG0 B;  1UMQ A;  1HCR A;  3QPL A;  1IV6 A;  4DYQ A;  4RDU A;  3QPS A;  1DU0 A;  1QPI A;  1APL C;  2DA3 A;  1JT0 A;  2DMU A;  3BG5 A;  1ITY A;  5EZH A;  5EYR A;  3MVP A;  2CQX A;  4BY1 J;  2WB1 N;  3FIS A;  1D5Y A;  2YU9 J;  2CUF A;  2DA2 A;  3H3V K;  1I6H J;  1FIA A;  1GT0 C;  3BTI A;  1G2H A;  3ZQG A;  1X2M A;  5FKL A;  1QVU A;  3G1L A;  1GUU A;  2JA5 J;  3GTP J;  3BR5 A;  3B6A A;  5IYD J;  1ETO A;  3BQZ A;  3OIO A;  2P81 A;  2ID6 A;  5IP9 J;  2ECB A;  2DN0 A;  3BR3 A;  1IGN A;  2ZB9 A;  2JK3 A;  2L7F P;  5IOY A;  4A3B J;  4A3G J;  5FKN A;  3ZQF A;  4A3D J;  3E7L A;  3LSP A;  4IEJ A;  3BR1 A;  4A3K J;  1W0U A;  4B4C A;  1JJ6 C;  1IDY A;  4UUT A;  3CDL A;  2TCT A;  2I10 A;  2DMN A;  1H88 C;  2L0K A;  1ZR4 A;  1UG2 A;  3FIW A;  1PUF A;  2DJN A;  4JYK A;  3S15 J;  1RES A;  4XIC A;  3GTJ J;  2HOT A;  2RAE A;  3JRA A;  3JRI A;  3CMY A;  4V2F A;  5K7F A;  2LY9 A;  5M5Y J;  2M34 A;  2L7Z A;  3HGG A;  1RET A;  3DEW A;  2E2I J;  4M3D A;  4JX5 A;  2Y0S N;  3JRG A;  4C3H J;  2O9L A;  2FJ1 A;  2W48 A;  3NAR A;  3B6C A;  3S1M J;  3LSG A;  2Y2Z A;  5EDN A;  2DA4 A;  1ZGW A;  3Q0U A;  1HOM A;  2OF7 A;  1FEX A;  3JR9 A;  4JX6 A;  1W0T A;  1U9N A;  3IH3 A;  5F27 A;  3A02 A;  3ZQL A;  1MBH A;  2KDZ A;  4UUS B;  1EF4 A;  2EBI A;  3G1M A;  1HDD C;  2DA1 A;  4B3A A;  4XK4 A;  2DA7 A;  1F36 A;  1ZKG A;  1B8I A;  4IHW A;  4XRS G;  1OFC X;  3BG3 A;  1LFB A;  1AKH B;  1QRY A;  4MO7 A;  5FJ8 J;  1K83 J;  2IBD A;  2YUS A;  4EEF G;  1IRZ A;  3CQZ J;  2R7Z J;  1TWG J;  5FKM A;  2ELK A;  3FK7 A;  2X48 A;  5E3O A;  1Z77 A;  1GVD A;  3BR0 A;  2EZI A;  3GBG A;  5F0H A;  1NK3 P;  3PO3 J;  1AU7 A;  2JA6 J;  3DCF A;  2H1K A;  3MKL A;  1LE8 B;  1JUM A;  1BL0 A;  1TWH J;  3S17 J;  1JKO C;  3S1N J;  5GPC A;  2CUE A;  3VPR A;  2R5Y B;  5K7Z A;  1JKR C;  1POG A;  1QVT A;  4A3F J;  4D7M A;  1MH4 A;  5F0F A;  1GV5 A;  2E19 A;  5DTD A;  4AUX A;  3UKG A;  4X1E A;  5J1Y A;  1JTX A;  4JX4 A;  2HXO A;  4M3F A;  1P7J A;  2YS9 A;  4DZJ A;  4M3G A;  3TED A;  2R5Y A;  1WPK A;  2MSY A;  5EZG A;  2MGQ A;  1GDT A;  3BG9 A;  1JUS A;  1OJL A;  2LVS A;  5M5X J;  2O7O A;  5EG0 A;  3LNQ A;  2X6O A;  4C3I J;  2XGE A;  2PMZ N;  3BT9 A;  1CQT A;  4B1R A;  2MG4 A;  2XRL A;  3BQY A;  2FX0 A;  1JKP C;  3K2A A;  2LTP A;  3GTK J;  4A3L J;  4BXX J;  1ETQ A;  1OCT C;  2D5V A;  1HDP A;  4IHV A;  5EF6 A;  2WAQ N;  3LSR A;  3SFI A;  1NTC A;  1WI3 A;  4W97 A;  3TP0 A;  1VI0 A;  4I76 A;  5C4J J;  5K7H A;  1VFC A;  4A3C J;  2VI6 A;  1IDZ A;  3S2H J;  3S1R J;  2R5Z B;  1XS9 A;  3M3Y J;  3IH2 A;  2EH3 A;  2FD5 A;  1ZQ3 P;  2CQQ A;  3Q3S A;  2HOA A;  1ETW A;  1X2N A;  2CJJ A;  3HGY A;  1ZR2 A;  4QTR A;  2Y30 A;  5F1J A;  4FCY A;  1RR7 A;  3HM5 A;  2HQ5 A;  1JJ8 C;  3WHC A;  3M4O J;  4BY7 J;  3HOY J;  4FTH A;  4A3I J;  4C2M J;  4A3M J;  3PO2 J;  1A6I A;  2Y9Z A;  2H8R A;  3TP3 A;  5M5W J;  2M0C A;  5IYB J;  2E1O A;  4CYC B;  5EGO B;  4BKX A;  2O8K A;  3TW6 A;  5IP6 A;  3JRF A;  1JKQ C;  1BW5 A;  5FLM J;  4DYR A;  4Y7N J;  2EQR A;  1VND A;  3BTJ A;  4J19 A;  3L1P A;  2IAI A;  3JRC A;  1JUP A;  3A03 A;  3ZQH A;  2NVQ J;  1FTZ A;  4A3J J;  2XB0 X;  1R9T J; 
#chains in the Genus database with same CATH topology
 2L9R A;  3A01 B;  1A04 A;  2LSO A;  3FHN A;  3G1O A;  1ETK A;  3GYH X;  1OCP A;  2DT6 A;  5E3L A;  3SJM A;  2LD5 A;  4S05 A;  1ZAR A;  3CLQ A;  1ZRD A;  2NVX J;  2K9N A;  1W36 D;  2LMD A;  1MJ9 A;  3E6B A;  4BEH B;  4KN7 X;  2KIF A;  2LH9 A;  4IRG A;  3L00 A;  3BWG A;  2ZSH B;  1ETV A;  2VQC A;  1REP C;  3VSK A;  2BVM A;  4UVC A;  4X6A J;  1B59 A;  3C3W A;  4XOT A;  2GAU A;  3LQQ A;  1N75 A;  4RM2 A;  3SFZ A;  2KT0 A;  2LK2 A;  1Z3X A;  5DD4 A;  5LHG A;  2FE3 A;  1MBK A;  4PJN A;  4ZYH A;  1ZRF A;  2R93 J;  1P2F A;  3GO5 A;  3I0T A;  3LA7 A;  1I6X A;  3CCR I;  1ZK8 A;  3OYE A;  2CV2 A;  5D8L B;  3DU6 A;  5GPA A;  1D8K A;  2M9H A;  3M8E A;  3MZH A;  2L9S A;  2DK5 A;  1TWF J;  4FX0 A;  4CYD A;  2M8E A;  3PNY A;  2IXS A;  3GFJ A;  3SZG A;  4BE2 A;  5LEK A;  4BXF A;  1D1A A;  2CUZ A;  3WTS C;  3S14 J;  5DCF A;  3ZOB A;  2K9Q A;  4RLQ A;  1R1T A;  5B66 C;  2I5U A;  2K85 A;  4F55 A;  1WCM J;  3K2Z A;  2R7X A;  1T39 A;  1BJZ A;  3MMY B;  5GP9 A;  4E7Z A;  1IXS B;  1OYW A;  2JA2 A;  2LF8 A;  1TC3 C;  3I58 A;  2KRC A;  2ZNY A;  3EET A;  1JXS A;  2BV6 A;  3SQN A;  2DMP A;  1UHS A;  1ZHF A;  3FBN B;  1BBY A;  1ZH5 A;  2YSR A;  3GTO J;  5IY5 H;  3AAF A;  1DP7 P;  2JPB A;  4OAY A;  5J40 A;  5IYC J;  5B1B H;  5ICE A;  2KZV A;  3HJE A;  3F6V A;  4C2T A;  4XR6 A;  5E8G A;  3OYH A;  3MN2 A;  4LK0 F;  2G7U A;  3H5N A;  2VBX A;  5IOZ A;  1OYY A;  3AG4 H;  5JI6 A;  3IHU A;  2PI0 A;  3F21 A;  1KQ9 A;  1XCV A;  2H94 A;  2NS8 A;  1MMD A;  3JRD A;  3K4J A;  2ZC2 A;  4ZYG A;  1R5I D;  2LDU A;  1A36 A;  2PJP A;  3D5S C;  1XCB A;  1ETY A;  1SVL A;  4GFB A;  2DTZ A;  5FLX Z;  3HOW J;  4W1U A;  1BA5 A;  1YJW I;  2KPM A;  4XN3 A;  2P5K A;  5AIQ A;  2R7T A;  2R7R A;  1FWZ A;  1D0X A;  4B3X A;  1MZB A;  1T6S A;  1X1B A;  2TRT A;  4EJV A;  5GAG J;  4J00 A;  2GXG A;  2VKE A;  4BHP A;  2PG4 A;  3A0H C;  2HEO A;  4DW6 A;  3HEF A;  1QZY A;  1RI7 A;  1XMA A;  2EZL A;  1AHD P;  1SD6 A;  3W2V A;  5KNL A;  4MLO A;  2UZK A;  4QPQ A;  2JRT A;  4KT5 C;  4BHB A;  2E35 A;  4MFD A;  4G94 A;  3HUG A;  3ZMV A;  1WVR A;  2MD0 A;  1H89 C;  5CJ9 A;  4NDL A;  4BQN A;  4AVZ A;  2DLL A;  4ZJZ A;  1FY7 A;  3BZ6 A;  5ICF A;  3ABU A;  1BI0 A;  2ZJ2 A;  3ZMD A;  3OSF A;  1DPR A;  3E97 A;  1ZLK A;  4LFU A;  4Q5S F;  4LMY A;  4HF1 A;  1VQN I;  4M9Z A;  1TT5 B;  3OSG A;  3VDX A;  2LR8 A;  4U7D A;  3CCV I;  4G12 A;  4CYC A;  1G3T A;  2HS5 A;  2RQP A;  3CP8 A;  3K4B A;  3J7Y J;  3GF2 A;  1SVM A;  4CZC A;  2W84 A;  4MQ9 F;  4EMS A;  2L7M P;  2X9D A;  2EZK A;  1YW8 A;  2DMQ A;  1SFX A;  3TBI A;  1XSD A;  4ZC3 A;  4KYW A;  2ME6 A;  2OQR A;  2M5W A;  3OYJ A;  2ZXJ A;  5HOD A;  2DA6 A;  1B8I B;  5E1X A;  4AYB N;  1HKQ A;  3U21 A;  1PP8 F;  2F2E A;  5FLX K;  3OL3 A;  3RPU A;  3HRU A;  4Y15 A;  1LFU P;  3H0G J;  4L0Y B;  3HSR A;  3HL2 A;  4EQQ A;  5LEJ A;  2LP0 A;  2W00 A;  3VYS B;  5C44 J;  3E1S A;  3OYG A;  4GYG A;  2HQN A;  3IWF A;  1V3F A;  1P4A A;  1YHQ I;  4NQW A;  5E3M A;  1H8A C;  2L2O A;  1Z9C A;  4Y3O A;  3FKI J;  2MW8 A;  4XRF A;  2UV1 A;  4A0Z A;  2XAG A;  3RKY A;  4MEY F;  1VQ9 I;  3T0Y A;  4NHJ A;  2FQ4 A;  2MH9 A;  1DU6 A;  2ISY A;  4DYC A;  1I3Q J;  3DEE A;  3W6K B;  3OS2 A;  1U5T B;  4AIJ A;  2VUM J;  2FRH A;  4NUB A;  1MSE C;  2JN6 A;  1MDM B;  4U0Y A;  2CFX A;  1I50 J;  2VN2 A;  3BG7 A;  2DQL A;  1A5J A;  1T33 A;  1X3Z B;  4JBA A;  2LKX A;  2J5P A;  1S7O A;  3ZCO A;  1MNM C;  1FX7 A;  2HPI A;  2ZJR F;  5M3F J;  4O3M A;  1I1G A;  2QVO A;  1XTA A;  2XAJ A;  4E7K A;  2QA4 I;  1SMY F;  3AL0 C;  6PAX A;  2HWV A;  3ZN0 A;  3QPL A;  3NRV A;  2GXB A;  1RRJ A;  4DYQ A;  3PJR A;  1DU0 A;  2VJI A;  1JE8 A;  1G59 A;  1MD0 A;  5LHH A;  5K5R A;  4PFP A;  4XOR A;  2Y48 A;  5DD8 A;  2VKH A;  2RNJ A;  2W85 A;  4BY1 J;  1UJ8 A;  1E3P A;  4N9H A;  2DT5 A;  1FIA A;  3CC4 I;  5JHF A;  2RV8 A;  2R7F A;  5IYD J;  1K78 A;  2JA5 J;  3BR5 A;  2KKO A;  1ETO A;  3U9G A;  3AG2 H;  1W7P A;  3MZ8 A;  1WJA A;  2XAF A;  1R71 A;  2VC0 A;  1UEL B;  3EDP A;  4HSR A;  2L7F P;  5FO5 A;  3HPG A;  1FP2 A;  1IRF A;  3F8B A;  2XF7 A;  4IEJ A;  4XLE A;  2EFN A;  4A3K J;  5K5O A;  1W0U A;  4WXH A;  4B4C A;  2QWW A;  3KYC B;  1HQC A;  1BR4 A;  1B1B A;  2AQE A;  2RVC A;  4OWR B;  2BEO A;  2TCT A;  4HX7 A;  5CQE A;  2DU9 A;  1ZR4 A;  3EPZ A;  5L3D A;  1PUF A;  1FBS A;  3VWB A;  4JYK A;  3CP2 A;  3LSK A;  4A6E A;  1UZC A;  4IX7 A;  2HNH A;  3S15 J;  1RES A;  1S8N A;  4M9X A;  3L2V A;  3JRA A;  3KYL A;  4WXC A;  3CMY A;  3PNT A;  2LRD A;  5M5Y J;  4XL9 A;  2M34 A;  2VL8 A;  2L9N A;  2EV0 A;  3K0L A;  3QYB A;  4JX5 A;  3ZR8 X;  2Y0S N;  1R00 A;  4C3H J;  1TQI A;  3NAR A;  4CXF A;  3TOB A;  3KEY A;  1EH8 A;  3LSG A;  3OOP A;  2V9K A;  3CC7 I;  4M6Y A;  4XN0 A;  2V6C A;  3R0A A;  2VJJ A;  5H20 A;  3LSH A;  1FEX A;  1I3A A;  3KZZ A;  4LGW A;  5D5X B;  2MLG A;  1ZRE A;  5HLT A;  5HNF A;  2QSF X;  2OC6 A;  3IRR A;  2Y0M A;  5B3S H;  4E7S A;  2ZME B;  5CVV A;  2HTS A;  2KDZ A;  1FOY A;  1FT9 A;  3G1M A;  1HDD C;  3I5U A;  1LVK A;  3IKT A;  4FAS D;  2DA7 A;  5CYV A;  5B5E C;  2OV7 A;  5DCM A;  3M7G A;  1XSV A;  3C18 A;  3NWS A;  3OS1 A;  2M7A A;  3BG3 A;  2PN6 A;  4MO7 A;  1Y0U A;  2D2W A;  2AQF A;  1ZEL A;  3CUQ C;  2GZW A;  2V4J C;  1X1D A;  1TL8 A;  5HDK A;  1S5L C;  3CQZ J;  4F92 B;  5J8F A;  2X48 A;  2JT1 A;  1TLH B;  2Z2S B;  1ZG1 A;  4XQF A;  1NK3 P;  1V5G A;  2LY2 A;  1UFM A;  2H1K A;  3CCQ I;  2QEN A;  4LLL A;  2VLA A;  4XNF A;  2Z99 A;  4ESB A;  5KVR A;  1JKO C;  4YEJ A;  2NNY A;  4HW0 A;  4I09 A;  4R8H A;  3LFK A;  1G3W A;  5A2Q K;  2WBM A;  1QVT A;  4D7M A;  3KLO A;  2H6C A;  1X19 A;  5F0F A;  3R60 A;  3TMO A;  2HQA A;  4F7Z A;  1LVA A;  1S9H A;  4BXU A;  4JX4 A;  1IRX A;  4N4N B;  2DOF A;  2HXO A;  2CMP A;  4M3F A;  1P7J A;  2YS9 A;  2K5C A;  4IQ4 A;  4M3G A;  3QP5 A;  4DZJ A;  2DYS H;  2R5Y A;  1KU2 A;  3TED A;  1J7K A;  2GOM A;  2MGQ A;  1GDT A;  3BG9 A;  1OJL A;  3HXL A;  2X4H A;  3KZI C;  2QKL B;  2OJE D;  2XGE A;  2PMZ N;  3IRQ A;  1EH7 A;  2MYS A;  3H3U A;  1TNT A;  2ELJ A;  2MG4 A;  2XRL A;  2CH0 A;  3HHG A;  4XMY A;  3RJP A;  3K6G A;  4UY8 I;  4A3L J;  3J7A O;  3WOD F;  2WY7 Q;  1KYW A;  1WZ2 A;  3T8R A;  1Y6I A;  1FYL A;  2HR3 A;  1HDP A;  3L09 A;  2DYR H;  1WI3 A;  5L3C A;  1VI0 A;  1MW7 A;  2EIK H;  3F72 A;  2OCC H;  4ITV A;  2B0L A;  2VXZ A;  1SAU A;  2HVQ A;  2RKH A;  2KIU A;  5ED4 A;  1IDZ A;  1TNS A;  2EV6 A;  5D5U B;  2E1M B;  1W5C C;  3R0J A;  1IXC A;  2OUM A;  2HOA A;  1E3H A;  3OV8 A;  3Q3S A;  2AXT C;  3LA2 A;  3CMM A;  2ESH A;  1ERD A;  1BR2 A;  2QBY A;  3HM5 A;  1OCR H;  1YX3 A;  2DO7 A;  3PL8 A;  3WHC A;  2VOD A;  4BY7 J;  4BUP A;  3P9I A;  2IGM A;  5CLS A;  2ZFW A;  3EYY A;  1D1B A;  2XAH A;  4BHC A;  3MKY B;  1A6I A;  2JVH A;  2VBZ A;  2DT7 B;  4H4K C;  2DFE A;  3S3O A;  5EGO B;  3OYA A;  3V8L A;  3JRF A;  2ZCW A;  5FLM J;  3KEQ A;  4Q4Z F;  4B43 A;  2EJR A;  1IN5 A;  3H9G A;  1WJ5 A;  2A68 F;  3ABK H;  1L0O C;  3L1P A;  3SXY A;  3CUQ A;  3JRC A;  4E6K G;  4RAZ A;  4A3J J;  3DP7 A;  2FNA A;  2XB0 X;  4C2U A;  4RB1 A;  5FLV A;  2A07 F;  1MBG A;  2CRG A;  5FKK A;  1TBX A;  3W6J B;  3BTL A;  3VOD A;  1E17 A;  3M1E A;  3FWE A;  2OZ6 A;  4KUM A;  3O6B B;  4HDU A;  3Q0W A;  4XID A;  4BDZ A;  4XRM A;  2P5V A;  5H6R A;  2A3S A;  4EGY A;  3O3K A;  3QAH A;  1BI3 A;  3LOC A;  2ZBK A;  2BW3 A;  3IH4 A;  2IGO A;  4ZYA A;  3B02 A;  4DBQ A;  3I4N J;  2Z16 A;  3GZ5 A;  3HSE A;  3ELK A;  2VQG A;  2ECC A;  4IXA A;  2ADU A;  2KRH A;  2HXI A;  3WE3 A;  3W6V A;  4LG3 A;  4IL6 C;  2COB A;  4AYB A;  4BEH A;  2E1N A;  2NAZ A;  4RBO A;  2KIS A;  2JSP A;  1TQP A;  1ZTR A;  1IW7 F;  3QQA A;  5GTI C;  1WHU A;  1WJE A;  1KA8 A;  2HYF A;  2IT0 A;  2A61 A;  4U88 A;  2A69 F;  2ZFU A;  2JUC A;  3HRT A;  3W2A A;  2LF7 A;  2K9M A;  3HKZ N;  4M3B A;  2E34 A;  1U6G A;  3I3L A;  4A6D A;  1RIO H;  1FP1 D;  2Y75 A;  2NNN A;  2QM3 A;  3PQK A;  1FMW A;  5ICC A;  4G7O F;  3AG1 H;  2Q1Z B;  3HOZ J;  3CCL I;  3RZO J;  1YYV A;  2R7V A;  4OIO F;  2A5W A;  1LE8 A;  3ZQC A;  1YI2 I;  4GCV A;  2IP2 A;  2QCO A;  4UVB A;  2M7B A;  3GZN B;  2X51 A;  5LHI A;  1IN6 A;  5FB2 A;  2P0W A;  3DFG A;  2FNP A;  2VPR A;  4RGX A;  1MNE A;  4BE1 A;  4HF0 A;  2CQN A;  4Q47 A;  1Z6R A;  2XPV A;  1QPM A;  2FXA A;  5E18 F;  2DA5 A;  3CZ6 A;  4WWC A;  3K4L A;  3QU6 A;  5F08 A;  5HLI A;  2WWY A;  5TIS C;  4XM3 A;  2DJI A;  3RZD J;  2JWT A;  3PM1 A;  3G6E I;  2EWN A;  4WCG A;  2VE8 A;  1MBJ A;  2YX7 A;  3BY6 A;  3D0S A;  5FFX A;  3CCE I;  3FHZ A;  3DF8 A;  1U8R A;  3SDB A;  4PFO A;  2WC2 A;  5E79 C;  5JLW A;  2JA7 J;  2HOS A;  4IHX A;  3O8G A;  3FX3 A;  2BYV E;  1YW9 A;  2PLY A;  2XV4 S;  3HOU J;  2M30 A;  1TTY A;  2JQ7 A;  2VBW A;  2FBH A;  3TW7 A;  3MKZ A;  3CF2 A;  4Z6Y A;  1FYM A;  2XGD A;  1RKW A;  4B09 A;  3CF5 F;  3CJQ B;  3PQJ A;  2KJC A;  4DGW B;  2BY2 A;  5HVQ C;  2NVU B;  4A69 C;  2R5Z A;  4ZDP A;  1T0F C;  3K70 C;  1HF0 A;  3C1D A;  3PFI A;  1YOV B;  2L02 A;  1FOX A;  2PMU A;  4OMZ A;  3RKQ A;  4RAG A;  2CW0 F;  2R7D A;  3RCO A;  2ZXH A;  3HOV J;  3H5R A;  2CU7 A;  2KIQ A;  3BP8 A;  3IP4 B;  1P7I A;  2CW7 A;  1WRJ A;  2HI3 A;  1U9O A;  1ON2 A;  2RQQ A;  2STW A;  5TJJ A;  1RNL A;  2BY3 A;  1G3S A;  1FOK A;  3BTC A;  2X6X A;  3QU3 A;  5CVU A;  1IZ1 A;  3CCJ I;  2PJR A;  2M1B A;  1D3Y A;  1K6O A;  5CVR A;  5F0C A;  1VQL I;  3CC2 I;  2X6W A;  2EPF A;  4F91 B;  1USS A;  2W7N A;  1T2K A;  3F9K A;  2D45 A;  1Y1W J;  2IS2 A;  4EGZ A;  2LY1 A;  2HFH A;  3I54 A;  5F64 A;  1QA6 A;  3E6C C;  4N0B A;  2CS3 A;  2IA1 A;  4I6Z A;  3K70 D;  4IHS A;  1TWC J;  2EFQ A;  1V5F A;  2ZXW H;  5DEQ A;  2AXL A;  3DKX A;  4LG0 B;  2HGC A;  2M2E A;  1YRN A;  2P4W A;  4II3 A;  1GXQ A;  1IXR C;  2K40 A;  4L5E A;  3BR2 A;  3WG9 A;  4HST A;  5DUI A;  5CVJ A;  2EIM H;  3ABL H;  3C7J A;  3CLO A;  2FA5 A;  4L9J A;  1HXD A;  4E70 A;  1IG7 A;  3K1N A;  3OYL A;  2F48 A;  3DBR B;  2RNG A;  3ZMT A;  4OIP F;  2R92 J;  1UCR A;  2Y9Y A;  2JJ7 A;  1PP7 U;  2QLZ A;  1VTN C;  1YS6 A;  5F6F A;  1TW3 A;  3S32 A;  2MFZ A;  3NAU A;  2QKM B;  3I4M J;  3HG9 A;  5BQT A;  3GTQ J;  2ACJ A;  3R6S A;  2KZG A;  1YIJ I;  2PEX A;  3L2C A;  1EKE A;  1OCC H;  1X1P A;  2F5V A;  2M3A A;  4GO1 A;  2R7Q A;  2XPW A;  3U1K A;  2XSJ C;  3QP6 A;  5J3L A;  2V1X A;  2DMT A;  1HC8 A;  2H8W A;  3FXJ A;  2ESN A;  2NOJ B;  3WE2 A;  3CJR B;  3MQ0 A;  4CUG A;  2ICW G;  4ANJ A;  2E5N A;  2H27 A;  3U2R A;  2CQK A;  5FRN A;  2KJB A;  3T8T A;  1Y1V J;  2ZME C;  3LAJ A;  4AWX B;  3GX4 X;  4CZZ A;  5EG0 B;  1KYZ A;  3ZXS A;  1HCR A;  2ZJQ F;  1C0W A;  5DM7 F;  2YR2 A;  4RDU A;  2DA3 A;  2FML A;  4P5O A;  1ITY A;  1KON A;  5EZH A;  3LMM A;  3I59 A;  2CYY A;  1T0F A;  5HS8 A;  2E1C A;  4MNU A;  3F23 A;  5HLH A;  2MC3 A;  2D1V A;  1TZL A;  2DA2 A;  5ICG A;  1S29 A;  3FXQ A;  1I6H J;  3K10 A;  4HX8 A;  1CF7 B;  3N97 A;  2WB1 A;  3KIO A;  1Z21 A;  1G2H A;  2COM A;  3M9A A;  1J75 A;  1QVU A;  3G1L A;  3RPU D;  3WTY C;  5FD6 A;  2LKS A;  2VQH A;  2V6E A;  4HEA 2;  5IP9 J;  2ECB A;  2X1E A;  4AIK A;  3BR3 A;  2DN0 A;  1DGW Y;  3LST A;  2JK3 A;  4OAZ A;  4ENN A;  5IOY A;  4A3G J;  1VQ4 I;  3WTT C;  2HDW A;  4BQO A;  4CGZ A;  1UHM A;  2A6E F;  1IO2 A;  3DU5 A;  2DCE A;  4KIT B;  4UB8 C;  1JJ6 C;  1IDY A;  3KCC A;  2YX4 A;  2HU9 A;  1DDN A;  3CDL A;  2ELH A;  2DMN A;  1H88 C;  2L0K A;  2W25 A;  1VQK I;  3FIW A;  4ZDL A;  3F8N A;  4I99 C;  3OMY A;  1W5S A;  2RAE A;  4TV7 A;  2F5E A;  4LIU A;  3OWT A;  5L3F A;  3JRI A;  3BZK A;  4LLN A;  4FX4 A;  2MLK A;  4V2F A;  5K7F A;  1FPQ A;  2FUG 2;  3GW2 A;  4LIV A;  3HGG A;  3KP2 A;  3VSL A;  2FU4 A;  5JR3 A;  2X6Y A;  3LA3 A;  2JRM A;  3DEW A;  4RGU A;  4M3D A;  1AWC A;  3E0J B;  2E2I J;  2GXA A;  2CV1 A;  1R6R A;  2VJ5 A;  3JRG A;  2CUJ A;  1KU3 A;  3L2R A;  1EV7 A;  3GFI A;  3KE2 A;  2IA0 A;  2YPR A;  3OYK A;  3S1M J;  3CO7 C;  4ESJ A;  2X0L A;  2WAE A;  2DW4 A;  3F8M A;  4ZZD A;  1BI1 A;  1LJ9 A;  2M87 A;  3K4C A;  1PDN C;  1BOA A;  1PJR A;  3Q0U A;  1HOM A;  1U0J A;  2OF7 A;  5D6E A;  1VZ0 A;  1W0T A;  4UHT A;  4EVI A;  2QQ9 A;  3DPL C;  1YJ9 I;  3JAM Z;  2E1M C;  1K6Y A;  1T95 A;  3TKY A;  1R22 A;  4D9J A;  2DXI A;  3ZQL A;  5JVT A;  1J09 A;  1MBH A;  4RGS A;  5LRS A;  1R36 A;  3HRM A;  1W7P D;  3J7A Y;  4KMF A;  2VPL A;  1F36 A;  4RAY A;  4UVA A;  1O7L A;  5IT3 A;  2KFD A;  4PGH A;  4IHW A;  1OFC X;  1BOB A;  4OIR F;  1LFB A;  3NEU A;  3CCS I;  5FJ8 J;  3JSO A;  2YUS A;  4D1Q A;  2O3F A;  1J5Y A;  1RC9 A;  4OIN F;  3OL4 A;  1TWG J;  4ESF A;  4PSW A;  1MKM A;  5J6X A;  3FXK A;  1QNT A;  1L3L A;  5IT9 Z;  4U7B A;  5FRO A;  3ULQ B;  4HPQ A;  2XC7 A;  5LD2 C;  3KP7 A;  4GXO A;  1MJA A;  2EA4 A;  2O8X A;  5K1Y A;  2GOX B;  3ABT A;  3MKL A;  3HRS A;  4PJ0 C;  3KPH A;  1TWH J;  4I01 A;  3S17 J;  4ZYE A;  4C30 A;  4RLF A;  1IF1 A;  2VT3 A;  4CIC A;  1JKR C;  3ASN H;  3BRO A;  3BCB A;  2IVM A;  2B7E A;  5TGT A;  1GV5 A;  3HZJ A;  3PUF A;  1QHH D;  5DTD A;  2V79 A;  3S3N A;  2Q2E A;  4A0X A;  3TDZ C;  3TDU C;  4G8X A;  4KIS A;  1YIO A;  3JAM K;  5JVG F;  3V42 A;  5EZG A;  4L9T A;  3HYI A;  2OU2 A;  3REO A;  1ZG3 A;  3VYR B;  2X6O A;  5D4S A;  4C3I J;  1OYI A;  3BT9 A;  3I9V 2;  1CQT A;  1G4D A;  4NC7 A;  2Z9O A;  1BR1 A;  1IRG A;  1NG6 A;  3ZMZ A;  3OYD A;  2RN7 A;  2BZT A;  3IUO A;  2IA2 A;  3K69 A;  4XKW A;  3P9K A;  4HZF A;  3DPU A;  3GCM A;  3K2A A;  4F52 A;  3DQV C;  4BXX J;  2M0M A;  3DWL E;  2EA2 A;  2D5V A;  3G2B A;  2ZXI A;  4IHV A;  4RMN A;  3QPH A;  2WAQ N;  3LSR A;  4YRV A;  2VXD A;  3TP0 A;  5D5V B;  2E7W A;  5DUK A;  1VFC A;  5LBQ A;  2HVS A;  3S2H J;  1KQ0 A;  5IT9 K;  2Q0O A;  3S1R J;  1XS9 A;  4XKB A;  1K4T A;  2FD5 A;  3GUD A;  2GQQ A;  1BJA A;  1YE9 A;  2IGK A;  3OYB A;  3T1B A;  2P7C B;  2YU3 A;  4IQJ A;  2P6T A;  3HUG B;  3HGY A;  3ZP5 A;  2MH2 A;  3P7N A;  4WF2 A;  1GVJ A;  3L7W A;  5F1J A;  4FCY A;  1RR7 A;  3LQR A;  2K27 A;  3TO6 A;  4XKV A;  2R4G A;  4BS9 A;  4X0G A;  4FTH A;  4A3I J;  4EM1 A;  1QU3 A;  3KP4 A;  1WWX A;  5KHD A;  3ZPL A;  4LB5 A;  5IYB J;  4BYY A;  5F1R A;  2E1O A;  4CYC B;  3D5L A;  4YEL A;  2O8K A;  2CSO A;  5IP6 A;  3M07 A;  3RQ4 A;  5A2Q Z;  4Y7N J;  2HKX A;  4PJM A;  3BTJ A;  1YTY A;  2DOA A;  4J19 A;  4CCK A;  1NH3 A;  3DTI A;  3CJN A;  2VBY A;  2IAI A;  2NVQ J;  1JUP A;  3A03 A;  1Z05 A;  3W2W A;  2DDA A;  1WI9 A;  1R9T J;  2M4K A;  4PGG A;  4XRS A;  1IC8 A;  4HYE A;  3KLN A;  4ZYD A;  5IP7 J;  1LUJ B;  2M8G X;  2M45 A;  1BIA A;  2X1C A;  2ID3 A;  1DP3 A;  3FZV A;  4V2G A;  3GTL J;  4MQV A;  3FXL A;  2VQL A;  1SAX A;  2XPU A;  3FMR A;  1F43 A;  1E0E A;  1B72 B;  3SYT A;  4HLY A;  4NQW B;  1FMV A;  4GYI A;  3KYD B;  3OYN A;  3GTG J;  2EIN H;  5JHU A;  4UUS A;  2MC4 A;  1ETX A;  2JMW A;  3EUH C;  4QLC U;  3H9Q A;  4RM3 A;  3S1Q J;  3FK6 A;  3I64 A;  1HLV A;  4A12 A;  2HDC A;  3RQI A;  1TT0 A;  3LSJ A;  4U0V A;  2Z33 A;  1AKH A;  2R7O A;  4A5N A;  2RGV A;  4FT8 A;  3H9J A;  2XVC A;  4WK8 F;  2L54 A;  2XUB A;  3CES A;  2E2H J;  1K61 A;  1EA3 A;  1Y0N A;  2DPU A;  4KFC A;  1U2W A;  3K4N A;  3L2W A;  1IN8 A;  4S0H B;  3F3X A;  2HYJ A;  1Q1V A;  4Y4R A;  2J5O A;  3DTK A;  4L5J A;  1Y39 A;  3DPT A;  1VQ7 I;  1RKT A;  2LC2 A;  2EFW A;  2GBY A;  3TQN A;  4BL0 B;  1I39 A;  4EJO A;  4MEX F;  3C2B A;  4E7I A;  1MND A;  2BY0 A;  4LK1 F;  4EJU A;  1R4M B;  5K5Q A;  5J8C A;  3V7S A;  2XB5 A;  1VF9 A;  4XSZ F;  5KCM A;  4OIQ F;  1QO0 D;  1X1C A;  2QUF A;  1KZH A;  3GLX A;  3EQL F;  3JRE A;  4D7N A;  1SFE A;  4PZJ A;  4H0E A;  2K4B A;  4MTD A;  2VKV A;  3FDY A;  3RYP A;  4ZTF A;  1O3T A;  2JSC A;  2JA8 J;  3O2P E;  4JP0 A;  2ZNZ A;  3PUB A;  1Z91 A;  1ZAO A;  2NOG A;  1NK2 P;  4D5F A;  1FTT A;  1XG1 A;  4A0Y A;  3WG7 H;  3GFL A;  2JVG A;  5E1W A;  2HYG D;  2NS7 A;  1S3J A;  3HDD A;  3R61 A;  2LLK A;  3K4K A;  3WTU C;  1ZRC A;  2KDO A;  5HLG A;  1JGG A;  3RKX A;  4M71 A;  3IKV A;  1IUF A;  4XLP F;  1EH6 A;  2OA4 A;  3Q9V A;  4Q48 A;  3H3Z A;  2EIL H;  4Y52 J;  1Y8Q B;  3HTU A;  4U87 A;  5F04 A;  4G6Q A;  2BGC A;  5J4Y A;  1HST A;  4D5C A;  2DPD A;  3K7A J;  4R79 A;  1S72 I;  1PUF B;  4FQG A;  4E4H A;  3DBL B;  5J47 A;  4HX4 A;  4CH7 A;  1U78 A;  2H1L A;  3SDG A;  2W24 A;  4GGG A;  1FLI A;  2KLO A;  4QWQ A;  2L7K A;  3EUA A;  1MIJ A;  2CGP A;  5LGN A;  2R0Q C;  4L9N A;  4B8X A;  1XDS A;  2FEZ A;  4HNV A;  3LSI A;  3RTR A;  3GWZ A;  1WGX A;  2XDV A;  3Q0V A;  4NB5 A;  3BC8 A;  3S93 A;  2ISZ A;  3HOX J;  1Z3Y A;  2QYO A;  2GM4 A;  3CUO A;  1LDK B;  2QSG X;  2VJ4 A;  3WGH A;  5E20 A;  1S7A A;  1T98 A;  3EUH A;  1O3R A;  3H92 A;  4PCQ A;  3LL7 A;  1IAW A;  3RIR A;  1P92 A;  2IS4 A;  4LD5 A;  1O3Q A;  3HOT A;  2DAO A;  3A1Y A;  2IEK A;  3O8H A;  3BDD A;  2NVY J;  1I5Z A;  1XC5 A;  4M73 A;  5IPA A;  3A01 A;  5DYM A;  2LFB A;  4R1H A;  4ASN A;  1ULY A;  3FM5 A;  1XDU A;  3FM3 A;  4QSH A;  3SEZ A;  1WH7 A;  2XSD C;  3F22 A;  3AL0 B;  3NWT A;  5DS9 A;  2CQ7 A;  5EEH A;  4EJW A;  4XON A;  1JT6 A;  2H6B A;  1WSU A;  2VOO A;  4ENJ A;  5FFZ A;  1P9Q C;  2XGC A;  3QWL A;  4ZTJ A;  5B1A H;  4LG0 A;  3WTW C;  4FHT A;  1B9N A;  5BPD A;  2AO9 A;  3OOU A;  4BNC A;  4P9F A;  4C9Y A;  4M6V A;  4Y33 A;  3PNV A;  3ZQQ A;  3HIF A;  2E36 A;  4ZZL A;  4ZDO A;  4IF4 A;  3VFZ A;  3FXU A;  1WJC A;  2IPQ X;  2WAF A;  4C3J J;  3COA C;  4HQM A;  4MIM A;  3OYF A;  3F8F A;  5JFR A;  1VQM I;  2LG4 A;  4KT6 A;  3X2Q H;  3TO9 A;  3S2D J;  4PJJ A;  4IPA A;  5M3M J;  3DLL F;  3D1N I;  1SEU A;  4LOC A;  1KU7 A;  2V1N A;  3JW4 A;  3S16 J;  4CCJ A;  2KQR A;  3K9T A;  2WAD A;  3V4G A;  2NVT J;  2R3S A;  2FBI A;  1UMQ A;  4L9V A;  2C6Y A;  1R49 A;  2VT2 A;  1FYK A;  2JPC A;  1QPI A;  1ONV A;  1NHA A;  3FF5 A;  4M6X A;  2DMU A;  3BG5 A;  3ZGK A;  1B6A A;  1R4N B;  2LRE A;  1JI8 A;  1LPQ A;  1ZN2 A;  4I98 B;  5EYR A;  1AA7 A;  2CQX A;  3BPV A;  3V8J A;  1LFP A;  2K3P A;  1D5Y A;  3HC7 A;  2YU9 J;  1BIB A;  3H3V K;  2E71 A;  1E2X A;  3FKJ A;  1PUE E;  1BM9 A;  4IZZ A;  3BTI A;  4QPO A;  1V55 H;  5FKL A;  3GTP J;  1U5T C;  2IS1 A;  1GUU A;  4LIT A;  2F4O B;  3B6A A;  4UV8 A;  3ML6 A;  3BQZ A;  4AID A;  4S04 A;  1VQO I;  1H9G A;  2F5C A;  4A3B J;  3H1C A;  2M4G A;  1F1Z A;  4A3D J;  2EFP A;  1FBU A;  3E7L A;  4HLX A;  2K02 A;  1FBQ A;  1CF7 A;  4CCL A;  2R7S A;  1I1S A;  2RC4 A;  3T5X A;  3BR1 A;  3ZMU A;  2QBY B;  3RSN A;  1X3U A;  2WAQ A;  1HKS A;  3SHF A;  3VYT B;  4KA4 A;  1Y8R B;  3WU0 A;  3FMS A;  2WY8 Q;  5BPI A;  3GZ6 A;  2Q8K A;  1R7J A;  1OMI A;  1W36 C;  3DTE A;  4L5I A;  2WA0 A;  4P96 A;  1W4M A;  3GTJ J;  2HOT A;  2WV0 A;  1LB2 A;  2GIZ A;  1Z1D A;  4AVP A;  2KHM A;  1R5G A;  3CUQ B;  2FOW A;  1T38 A;  1UHW A;  4HBL A;  1RET A;  2TDX A;  4CCN A;  1JHH A;  1ODD A;  1WKM A;  3KEO A;  2JZY A;  1F4K A;  2O9L A;  2FJ1 A;  2W48 A;  2W57 A;  4P9U A;  4PUS A;  3OIQ A;  2Y0S A;  2DA4 A;  5EDN A;  4HQE A;  5E17 F;  2WTE A;  2GWR A;  3N05 A;  4J01 A;  1ZGW A;  3LAP A;  3I55 I;  3DKY A;  1W1W E;  4CCM A;  1A6Q A;  3MEX A;  3JR9 A;  2NRA C;  1U9N A;  2L4A A;  5KK1 A;  2G9W A;  3A4C A;  3WTZ A;  2R7W A;  3QOE A;  3IH3 A;  2HVR A;  2BW3 B;  5F27 A;  5DM6 F;  2O5R A;  3C2G A;  1LEB A;  3LSM A;  3A02 A;  4K2E A;  1B4A A;  1P4X A;  2EBI A;  1EF4 A;  4DOZ A;  3G73 A;  4B3A A;  2L4M A;  4XK4 A;  1V5E A;  1ZKG A;  1B8I A;  1QZZ A;  1SVO A;  4XRS G;  1M1E B;  2PQ8 A;  3D5R C;  1K7A A;  1R1V A;  2DQR A;  5HNH A;  4RAF A;  1WJF A;  2XHK A;  3CTA A;  4XOP A;  5CKT A;  4EEF G;  2P5L C;  1IRZ A;  4N4O B;  2W1O A;  4ENK A;  2OAZ A;  1ZG5 A;  1Z77 A;  1GVD A;  3SEQ A;  1FNN A;  4BAC A;  3SZT A;  2EZI A;  3OY9 A;  3GBG A;  5F0H A;  2DI3 A;  2XRN A;  2XIG A;  3JTG A;  4YIR X;  3DCF A;  4GRI A;  4UV9 A;  1LE8 B;  3V7C A;  3L9F A;  3U1D A;  1BL0 A;  2FOK A;  3S1N J;  2HKO A;  3LFU A;  5GPC A;  3DBH B;  2CUE A;  1ACI A;  3A2K A;  4IO9 F;  1A31 A;  3SZP A;  1D5V A;  2BXZ A;  1POG A;  2K7L A;  1U5T A;  3E5Q A;  1HSJ A;  4M72 A;  4DBR A;  3J80 K;  4E7H A;  3BJO A;  5CPR B;  1MDM A;  3RDI A;  4AD9 A;  3DXJ F;  2Z5U A;  5D8K B;  4RB3 C;  3QRF F;  2EFO A;  3VOE A;  4CCO A;  5J1Y A;  1R5H A;  1MMG A;  1H9T A;  4HOB A;  3ZQ7 A;  2XAU A;  3J81 K;  2LBF B;  2MD5 A;  2VAS A;  4UUV A;  1WPK A;  2NYX A;  1XGM A;  1JUS A;  2LVS A;  2BHY A;  3K4M A;  3ZRG A;  5GAD J;  5M5X J;  2KP6 A;  4NNJ A;  2O7O A;  4BU2 A;  3LNQ A;  2MBF A;  3KZY A;  4B1R A;  4BJ5 C;  3BQY A;  3DLA A;  2GA1 A;  1JKP C;  3OS0 A;  1SFU A;  2PMZ A;  4KIG A;  2DBB A;  2LTP A;  3P5J A;  4PJL A;  3GTK J;  1ETQ A;  3KFW X;  1PYV A;  2EIJ H;  1N77 A;  1OCT C;  4BGD A;  2PMH A;  2KMU A;  5EF6 A;  1NTC A;  1I27 A;  3GFM A;  1H0M A;  4W97 A;  4XBF A;  2W82 A;  4I76 A;  5K7H A;  1VQ6 I;  3GLL A;  2CW8 A;  3KP3 A;  3H0D A;  4G6T B;  3N4M A;  2R5Z B;  3M3Y J;  4HG2 A;  3EYI A;  3QYF A;  2KL4 A;  2F4I A;  4JK1 X;  2IRF G;  2EH3 A;  4V19 K;  1ZLJ A;  4HRI A;  4G6D A;  3QOD A;  1ZQ3 P;  1HBX G;  2CQQ A;  5ILV A;  1Z6T A;  2OTL I;  1ZR2 A;  1SD7 A;  2Y30 A;  4B44 A;  3HPH A;  3CO6 C;  3H36 A;  2VC1 A;  3L2U A;  2G7H A;  5H2F C;  3I71 A;  4BE0 A;  4A3M J;  4C2M J;  4IOC F;  3PO2 J;  3G3Z A;  2PJR B;  3CME I;  2LYC A;  5M5W J;  2M0C A;  1QZE A;  2F4M B;  4BKX A;  4YFK F;  3CD6 I;  5FGM A;  1JKQ C;  1BW5 A;  4DYR A;  2FSW A;  2EQR A;  4PK4 A;  3S8P A;  1J0R A;  1YFH A;  1HA8 A;  4WXD A;  1O3S A;  4G7Z F;  3ASO H;  4IJA A;  1YX5 A;  1Z7L A;  5HS9 A;  1FTZ A;  5BS6 A;  3ZN1 A;  1WJB A;  5DDG A;  1MBF A;  3MKW B;  3GTM J;  4AIH A;  3HTS B;  3MAJ A;  1MBE A;  3NQO A;  4BJ6 C;  2E2J J;  5BNG A;  1V4R A;  1YRN B;  3W3C A;  2LNB A;  2VE9 A;  2ME0 A;  3V7R A;  4G7H F;  4A3E J;  2UXX A;  1ORK A;  4QIW N;  1FC3 A;  2E60 A;  2K3F A;  1V54 H;  2IJL A;  1JGS A;  2QGU A;  5JLX A;  1GXP A;  1MSF C;  2BOL A;  2G0E A;  2IW5 A;  1RUO A;  2ZME A;  2BBY A;  3G71 I;  3CCM I;  4KDP A;  4XKC A;  3BR6 A;  3I56 I;  3WHB A;  3Q9S A;  1YIT I;  4XLN F;  1TWA J;  1SFO J;  3ERE D;  4IHT A;  1AOY A;  2FQ3 A;  1B72 A;  4UXN A;  5EJC A;  3V8K A;  3E5U A;  1BW6 A;  1U3E M;  1LNW A;  2L01 A;  2HOE A;  1VQ5 I;  3VEP A;  3CMA I;  1QQI A;  1IV8 A;  4I2O A;  4FIS A;  1NG7 A;  2EB7 A;  2ZKZ A;  4BBR J;  1F5T A;  3BJ6 A;  2OCE A;  3HKZ A;  3IL2 A;  4UB6 C;  2BXY A;  2MAB A;  1S7E A;  2P8T A;  3GXO A;  1LEA A;  1Z0X A;  4DZP A;  5GTH C;  1SC7 A;  2GIV A;  4G9Y A;  1FJL A;  3WTV C;  3ZMS A;  4L18 B;  2K86 A;  4KJZ A;  1DPU A;  1YLF A;  1ZGA A;  3VYU B;  3CDI A;  3F0C A;  4II2 A;  3C2H A;  3I4P A;  4RA2 A;  1OR7 C;  1O4X A;  4GDF A;  3PIP F;  5C4X J;  2UXN A;  3I59 B;  1ENH A;  5FKO A;  4F93 B;  2CWE A;  5DV5 A;  2PFB A;  4AC0 A;  2B63 J;  4LLG F;  2Y31 A;  1MH3 A;  4KIC A;  4XLF A;  4YFN F;  2V1U A;  5C3E J;  2EV5 A;  1CGP A;  3AG3 H;  5BOX A;  1D1C A;  1BC7 C;  1FSH A;  2NXN B;  1JTY A;  4BJT A;  1WH5 A;  3JRH A;  4MTE A;  2QZ8 A;  2DDB A;  5LGT A;  4I0A A;  4XSX F;  2QSH X;  4UNO A;  1RZ4 A;  3H35 A;  5L3G A;  4IVN A;  5LRR A;  2A6T A;  4A93 J;  2F5D A;  2A5Y B;  3R4K A;  3ZQI A;  4HF2 A;  1QBJ A;  3FXM A;  4EV0 A;  1RPW A;  2O61 A;  1SD4 A;  3IV5 A;  4IKF A;  3BJA A;  1IJW C;  3CCY A;  4EM0 B;  1GV2 A;  2OPT A;  2A05 A;  1MMS A;  2BHZ A;  4FE7 A;  4CHU A;  1X58 A;  1MMA A;  9ANT A;  3CDH A;  1YJN I;  2BY1 A;  2O6G E;  3H5A A;  4M3E A;  2K9S A;  2AHQ A;  2DFH A;  1Y56 A;  4DJA A;  1J59 A;  1T56 A;  5D6F A;  5E3N A;  3JRB A;  1U8B A;  1BC8 C;  4BBS J;  1OCZ H;  4JQF A;  1VQP I;  1FIP A;  3I53 A;  4M9S A;  1UB9 A;  5HOO A;  2VOP A;  3ISP A;  2VKD A;  4IHY A;  4JOM A;  5FD5 A;  1HW5 A;  2RDP A;  5EGO A;  3OYC A;  1J2X A;  2LOO A;  4M74 A;  3Q5F A;  2HPM A;  5GAE J;  2GLO A;  2Z1D A;  2VIX A;  1E3O C;  2L9V A;  3RYR A;  1LKX A;  2RRE A;  2XAQ A;  1F9N A;  3BZC A;  4ABZ A;  3FMQ A;  5J1U A;  2P6S A;  1G8X A;  3ECH A;  1R58 A;  5HS7 A;  4I0B A;  1XGS A;  2DOE A;  2MA3 A;  5BMZ A;  1TP4 A;  3PSI A;  5LGU A;  2ETH A;  2N8G A;  2E5Z A;  1X1A A;  3BPX A;  4KIF A;  4MFE A;  1A35 A;  3B73 A;  3DV8 A;  5D5W B;  4FE4 A;  3TL4 X;  2DOD A;  2OBP A;  4MGR A;  4YFX F;  2DFF A;  2HDD A;  3RPQ A;  5J1R A;  4Z2Y A;  4PSX A;  5E8I A;  1YQA A;  1FSE A;  1MGT A;  4O6J A;  4KN4 X;  2OQG A;  2QEX I;  1OR7 A;  2V1D A;  1QGP A;  3JTH A;  3WU2 C;  3WU1 B;  3ECO A;  2DTR A;  3MZY A;  2EZH A;  3HSF A;  5KAF C;  1OIS A;  4ENM A;  3MCZ A;  1KGS A;  4LJZ F;  4AU7 A;  1BN5 A;  1XD7 A;  2A6H F;  2H09 A;  4DNC A;  5HDN A;  4BAY A;  1OKR A;  3KP5 A;  4XLA A;  1YW7 A;  3PSF A;  3HB9 A;  4IRI A;  4O5V A;  5L3E A;  2Q2E B;  5EEA A;  2GA2 A;  4WX9 A;  1SAN A;  2QF7 A;  1XGO A;  2Y69 H;  2IGN A;  4BDY A;  1XB4 A;  4PDK A;  4BH9 A;  4IOA F;  3IAM 2;  3HBL A;  3BOQ A;  3TGN A;  1HW2 A;  1OPC A;  1Z67 A;  4IRH A;  2JUG A;  2FMY A;  2WV1 A;  4MHG A;  3OYM A;  4OU0 A;  1YO5 C;  1ZYR F;  3QYE A;  1IV6 A;  3QPS A;  5KAI C;  1APL C;  1EJ9 A;  4YII A;  1K78 B;  1JHF A;  2XAS A;  5D4R A;  3JSP A;  1K4S A;  4Y17 A;  4P1W A;  1N25 A;  1JT0 A;  1W7P B;  4HA8 A;  4OOI A;  1KU9 A;  3EUK L;  2DK8 A;  2XGX A;  3MVP A;  2WB1 N;  3FIS A;  4KNY A;  1PVE A;  2CUF A;  3IWZ A;  4E7J A;  3CCU I;  2B9S A;  4I7H A;  3KP6 A;  5LFA A;  3RI4 A;  1FZP B;  3OR1 C;  1X3W B;  1GT0 C;  1GHC A;  3ZQG A;  1X2M A;  3PFY A;  3OIO A;  1LDD A;  2P81 A;  3RKW A;  2ID6 A;  4RS8 A;  1IGN A;  4AM3 A;  2ZB9 A;  4LB6 B;  4CSW A;  1OCO H;  1WQ2 A;  1Z7U A;  4NC8 A;  5FKN A;  3WGI A;  2KIM A;  3ZQF A;  3A0B C;  3LSP A;  1IN4 A;  1D0Z A;  2O03 A;  2HQR A;  4NBQ A;  1ON1 A;  2EK5 A;  4UUT A;  5FRM A;  5H6Q A;  3PIO F;  4EAT A;  1J9I A;  4BQA A;  2KRF A;  5GAH J;  1P6R A;  2I10 A;  2NS0 A;  1IN7 A;  2XKO A;  3AFH A;  3MD2 A;  4P55 A;  2V9V A;  4RB0 A;  1ZGJ A;  4XLH A;  1UG2 A;  4D0P A;  2QQA A;  1B9M A;  2DJN A;  3E6M A;  3GVA A;  1XMK A;  1DGR M;  3S2W A;  3UNG C;  2R7U A;  3M8J A;  4XIC A;  4RB2 C;  1BI2 A;  4A2U A;  3HOS A;  2AS5 F;  2PBI A;  2LY9 A;  3E3V A;  3OIP A;  5CVI A;  4KIB A;  2CV0 A;  2L7Z A;  2PX9 A;  3DKW A;  1VQ8 I;  2HTJ A;  2UWM A;  4YG2 F;  4DQ2 A;  2BVL A;  2JTV A;  3BG6 A;  4HAM A;  2W4S A;  5TRD A;  3L2Q A;  2CFO A;  3ROU A;  4YIF A;  2OZU A;  5E1Z B;  2X1D A;  1UST A;  4ZH4 F;  2HZD A;  3B6C A;  4DIQ A;  4RGR A;  3IAS 2;  1HKT A;  4CO8 A;  2K9L A;  2X85 A;  2Y2Z A;  4KMU X;  2D1H A;  4HNT A;  1UAA A;  5DCM B;  3GME A;  3E5X A;  4JX6 A;  2V26 A;  3JCU C;  4HNU A;  2O0Y A;  1UG0 A;  2L5Q A;  3S3M A;  1SD5 A;  3BCA A;  2OD5 A;  3FXR A;  1XPX A;  2K4J A;  4EM2 A;  3MWM A;  5J4V A;  4UUS B;  2DA1 A;  3ABM H;  3F6O A;  3FXO A;  1R1U A;  1XGN A;  1K79 A;  1TQM A;  3OR2 C;  4CA0 A;  4B48 A;  2XKP A;  1AKH B;  4I02 A;  1QRY A;  4F3Q A;  5AIP A;  5L3B A;  2LKP A;  1K83 J;  2IBD A;  2Z3Y A;  4ON0 A;  4Y13 A;  3FBI B;  2R7Z J;  3BLY A;  1XSX A;  3E6D A;  2ELK A;  3FK7 A;  5FKM A;  5E3O A;  3BR0 A;  2OTJ I;  4E7L A;  1S6L A;  3MFK A;  2I8D A;  4HV6 A;  3G4S I;  3PO3 J;  1AU7 A;  2JA6 J;  3J7Z I;  1YS7 A;  1O7F A;  1JUM A;  2L3D A;  2BE5 F;  1FOW A;  1W5T A;  2UUZ A;  2DFI A;  1IUY A;  3ONQ A;  2QQ8 A;  1LDJ A;  3VPR A;  2R5Y B;  5K7Z A;  2ZO4 A;  3HHH A;  5AON A;  3KX2 A;  2CG4 A;  4ETS A;  1SMT A;  1XX5 A;  4A3F J;  1MH4 A;  4BQQ A;  3IC7 A;  2XF5 A;  2E19 A;  4AUX A;  3WTX C;  3UKG A;  1P4W A;  4X1E A;  2HZT A;  1JTX A;  2XF6 A;  4EJT A;  1KQ8 A;  1DQU A;  1T08 B;  1G3Y A;  1XMX A;  1GLN A;  2MSY A;  1G6N A;  1STZ A;  3KET A;  2FBK A;  2F6C A;  5EG0 A;  4FET A;  3QOP A;  1OQY A;  1XN7 A;  2FX0 A;  3CJT B;  3LWF A;  2E7X A;  3M1C A;  3AKZ A;  2QQB A;  2LBF A;  2VB6 A;  1HW1 A;  1T8I A;  3WGG A;  3M8F A;  3SFI A;  4B47 A;  5ILU A;  4HDV A;  2STT A;  5ILS A;  1RUN A;  5CQG A;  5C4J J;  4CDG A;  4A3C J;  2VI6 A;  1X4P A;  5ERI A;  3IH2 A;  3VB2 A;  4L0Z B;  3P9C A;  1X4O A;  1WFX A;  4U0W A;  4HV5 A;  3TO7 A;  1ETW A;  1X2N A;  5HDG A;  1D8J A;  3GEZ A;  4XLC A;  1Q1H A;  2IS6 A;  1N78 A;  2CJJ A;  2ZJP F;  1R23 A;  1SFK A;  4A5M A;  2XRO A;  1MMN A;  1YG2 A;  4QTR A;  3K1P A;  3K1M A;  2ZSI B;  2V7F A;  1TW2 A;  3QPT A;  3OYI A;  5LLQ A;  2FF4 A;  3ERM A;  1DUX C;  3UR3 C;  2HQ5 A;  1JJ8 C;  1OLT A;  3M4O J;  2VON A;  1RR8 C;  3HOY J;  3TOA A;  2Y9Z A;  2H8R A;  3TP3 A;  3F8C A;  3TW6 A;  3DEU A;  1MJB A;  3J80 Z;  2V9P A;  5EEG A;  4N9I A;  1VND A;  4OMY A;  2F5F A;  3ESW B;  2CO5 A;  1LQ1 A;  1D0Y A;  1O57 A;  3ZQH A;  3J81 Z;  4NC6 A;  1QHG A;  2P7V B;  1WJD A; 
#chains in the Genus database with same CATH homology
 2L9R A;  1MBF A;  3A01 B;  5FLV A;  3GTM J;  1MBG A;  4XRS A;  1IC8 A;  2CRG A;  1ETK A;  1MBE A;  1OCP A;  3G1O A;  5E3L A;  3SJM A;  5FKK A;  2LD5 A;  2E2J J;  3BTL A;  5BNG A;  1YRN B;  5IP7 J;  2M8G X;  2NVX J;  2K9N A;  2ID3 A;  2ME0 A;  4V2G A;  3GTL J;  3Q0W A;  4A3E J;  4QIW N;  1ORK A;  4XID A;  4XRM A;  1F43 A;  2XPU A;  5JLX A;  1ETV A;  1B72 B;  1MSF C;  3LOC A;  2G0E A;  4X6A J;  3IH4 A;  3I4N J;  3GTG J;  4UUS A;  2ECC A;  1ETX A;  2KT0 A;  2LK2 A;  2HXI A;  3BR6 A;  2JMW A;  3W6V A;  1MBK A;  2COB A;  2R93 J;  3S1Q J;  4RBO A;  3WHB A;  1ZTR A;  3FK6 A;  3QQA A;  1TWA J;  1SFO J;  1HLV A;  1ZK8 A;  3RQI A;  1B72 A;  3LSJ A;  5GPA A;  1BW6 A;  1AKH A;  2M9H A;  1TWF J;  2E2H J;  3HKZ N;  4M3B A;  4FIS A;  1K61 A;  4BBR J;  3S14 J;  3ZOB A;  2K9Q A;  4S0H B;  2HYJ A;  1Q1V A;  3HOZ J;  3RZO J;  1WCM J;  1RKT A;  2GBY A;  1BJZ A;  5GP9 A;  1S7E A;  1LE8 A;  3ZQC A;  1TC3 C;  4DZP A;  1Z0X A;  2QCO A;  1FJL A;  3C2B A;  2XB5 A;  3F0C A;  1VF9 A;  1O4X A;  2DMP A;  5C4X J;  1UHS A;  3JRE A;  4D7N A;  2VPR A;  1ENH A;  5FKO A;  2VKV A;  2B63 J;  3GTO J;  4AC0 A;  2JA8 J;  4JP0 A;  2Y31 A;  2XPV A;  1MH3 A;  5IYC J;  2NOG A;  1NK2 P;  2DA5 A;  5C3E J;  4D5F A;  1FTT A;  1XG1 A;  3MN2 A;  5F08 A;  1JTY A;  1WH5 A;  5IOZ A;  3JRH A;  2NS7 A;  3RZD J;  3HDD A;  2LLK A;  2JWT A;  3PM1 A;  2NS8 A;  1JGG A;  1MBJ A;  3JRD A;  1IUF A;  5JLW A;  4Y52 J;  2JA7 J;  4A93 J;  2HOS A;  4IHX A;  1ETY A;  3O8G A;  4GFB A;  2DTZ A;  3ZQI A;  5F04 A;  4W1U A;  3HOW J;  1BA5 A;  1RPW A;  3HOU J;  3IV5 A;  4D5C A;  2TRT A;  3K7A J;  3TW7 A;  1IJW C;  1PUF B;  3CCY A;  2XGD A;  1RKW A;  2VKE A;  1GV2 A;  4A69 C;  2OPT A;  2R5Z A;  1U78 A;  1HF0 A;  4DW6 A;  3HEF A;  4FE7 A;  3SDG A;  1X58 A;  2EZL A;  9ANT A;  1AHD P;  3RKQ A;  4M3E A;  2K9S A;  2AHQ A;  4MLO A;  3HOV J;  4MFD A;  2CU7 A;  2R0Q C;  1H89 C;  1T56 A;  1P7I A;  5E3N A;  3JRB A;  1U8B A;  4NDL A;  2HI3 A;  1U9O A;  4HNV A;  4BBS J;  1WGX A;  3Q0V A;  1FIP A;  3OSF A;  3BTC A;  3HOX J;  4IHY A;  2GM4 A;  3OSG A;  2LR8 A;  4G12 A;  5EGO A;  4CYC A;  5F0C A;  2GLO A;  1E3O C;  2L7M P;  2X9D A;  4ABZ A;  2EZK A;  5J1U A;  1Y1W J;  2DMQ A;  2IEK A;  3O8H A;  2NVY J;  2ME6 A;  4I6Z A;  1XC5 A;  2N8G A;  5IPA A;  3A01 A;  1TWC J;  4MFE A;  2DA6 A;  5HOD A;  1B8I B;  4AYB N;  2LFB A;  2M2E A;  4FE4 A;  1YRN A;  4QSH A;  1WH7 A;  2XSD C;  1LFU P;  3H0G J;  2HDD A;  2K40 A;  4L5E A;  3BR2 A;  5DS9 A;  5J1R A;  2LP0 A;  5C44 J;  1JT6 A;  1IG7 A;  2XGC A;  5E3M A;  1H8A C;  2R92 J;  2AO9 A;  3FKI J;  2Y9Y A;  2MW8 A;  3OOU A;  2EZH A;  2JJ7 A;  4M6V A;  3NAU A;  3I4M J;  2FQ4 A;  3GTQ J;  1DU6 A;  4DYC A;  1I3Q J;  4C3J J;  2VUM J;  4MIM A;  1MSE C;  2JN6 A;  2XPW A;  3HB9 A;  1I50 J;  3S2D J;  5EEA A;  5J3L A;  1A5J A;  1SAN A;  2DMT A;  1T33 A;  2QF7 A;  5M3M J;  2LKX A;  1MNM C;  3D1N I;  3HBL A;  4LOC A;  5M3F J;  3S16 J;  1Y1V J;  2WV1 A;  2NVT J;  5EG0 B;  1UMQ A;  1HCR A;  3QPL A;  1IV6 A;  4DYQ A;  4RDU A;  3QPS A;  1DU0 A;  1QPI A;  1APL C;  2DA3 A;  1JT0 A;  2DMU A;  3BG5 A;  1ITY A;  5EZH A;  5EYR A;  3MVP A;  2CQX A;  4BY1 J;  2WB1 N;  3FIS A;  1D5Y A;  2YU9 J;  2CUF A;  2DA2 A;  3H3V K;  1I6H J;  1FIA A;  1GT0 C;  3BTI A;  1G2H A;  3ZQG A;  1X2M A;  5FKL A;  1QVU A;  3G1L A;  1GUU A;  2JA5 J;  3GTP J;  3BR5 A;  3B6A A;  5IYD J;  1ETO A;  3BQZ A;  3OIO A;  2P81 A;  2ID6 A;  5IP9 J;  2ECB A;  2DN0 A;  3BR3 A;  1IGN A;  2ZB9 A;  2JK3 A;  2L7F P;  5IOY A;  4A3B J;  4A3G J;  5FKN A;  3ZQF A;  4A3D J;  3E7L A;  3LSP A;  4IEJ A;  3BR1 A;  4A3K J;  1W0U A;  4B4C A;  1JJ6 C;  1IDY A;  4UUT A;  3CDL A;  2TCT A;  2I10 A;  2DMN A;  1H88 C;  2L0K A;  1ZR4 A;  1UG2 A;  3FIW A;  1PUF A;  2DJN A;  4JYK A;  3S15 J;  1RES A;  4XIC A;  3GTJ J;  2HOT A;  2RAE A;  3JRA A;  3JRI A;  3CMY A;  4V2F A;  5K7F A;  2LY9 A;  5M5Y J;  2M34 A;  2L7Z A;  3HGG A;  1RET A;  3DEW A;  2E2I J;  4M3D A;  4JX5 A;  2Y0S N;  3JRG A;  4C3H J;  2O9L A;  2FJ1 A;  2W48 A;  3NAR A;  3B6C A;  3S1M J;  3LSG A;  2Y2Z A;  5EDN A;  2DA4 A;  1ZGW A;  3Q0U A;  1HOM A;  2OF7 A;  1FEX A;  3JR9 A;  4JX6 A;  1W0T A;  1U9N A;  3IH3 A;  5F27 A;  3A02 A;  3ZQL A;  1MBH A;  2KDZ A;  4UUS B;  1EF4 A;  2EBI A;  3G1M A;  1HDD C;  2DA1 A;  4B3A A;  4XK4 A;  2DA7 A;  1F36 A;  1ZKG A;  1B8I A;  4IHW A;  4XRS G;  1OFC X;  3BG3 A;  1LFB A;  1AKH B;  1QRY A;  4MO7 A;  5FJ8 J;  1K83 J;  2IBD A;  2YUS A;  4EEF G;  1IRZ A;  3CQZ J;  2R7Z J;  1TWG J;  5FKM A;  2ELK A;  3FK7 A;  2X48 A;  5E3O A;  1Z77 A;  1GVD A;  3BR0 A;  2EZI A;  3GBG A;  5F0H A;  1NK3 P;  3PO3 J;  1AU7 A;  2JA6 J;  3DCF A;  2H1K A;  3MKL A;  1LE8 B;  1JUM A;  1BL0 A;  1TWH J;  3S17 J;  1JKO C;  3S1N J;  5GPC A;  2CUE A;  3VPR A;  2R5Y B;  5K7Z A;  1JKR C;  1POG A;  1QVT A;  4A3F J;  4D7M A;  1MH4 A;  5F0F A;  1GV5 A;  2E19 A;  5DTD A;  4AUX A;  3UKG A;  4X1E A;  5J1Y A;  1JTX A;  4JX4 A;  2HXO A;  4M3F A;  1P7J A;  2YS9 A;  4DZJ A;  4M3G A;  3TED A;  2R5Y A;  1WPK A;  2MSY A;  5EZG A;  2MGQ A;  1GDT A;  3BG9 A;  1JUS A;  1OJL A;  2LVS A;  5M5X J;  2O7O A;  5EG0 A;  3LNQ A;  2X6O A;  4C3I J;  2XGE A;  2PMZ N;  3BT9 A;  1CQT A;  4B1R A;  2MG4 A;  2XRL A;  3BQY A;  2FX0 A;  1JKP C;  3K2A A;  2LTP A;  3GTK J;  4A3L J;  4BXX J;  1ETQ A;  1OCT C;  2D5V A;  1HDP A;  4IHV A;  5EF6 A;  2WAQ N;  3LSR A;  3SFI A;  1NTC A;  1WI3 A;  4W97 A;  3TP0 A;  1VI0 A;  4I76 A;  5C4J J;  5K7H A;  1VFC A;  4A3C J;  2VI6 A;  1IDZ A;  3S2H J;  3S1R J;  2R5Z B;  1XS9 A;  3M3Y J;  3IH2 A;  2EH3 A;  2FD5 A;  1ZQ3 P;  2CQQ A;  3Q3S A;  2HOA A;  1ETW A;  1X2N A;  2CJJ A;  3HGY A;  1ZR2 A;  4QTR A;  2Y30 A;  5F1J A;  4FCY A;  1RR7 A;  3HM5 A;  2HQ5 A;  1JJ8 C;  3WHC A;  3M4O J;  4BY7 J;  3HOY J;  4FTH A;  4A3I J;  4C2M J;  4A3M J;  3PO2 J;  1A6I A;  2Y9Z A;  2H8R A;  3TP3 A;  5M5W J;  2M0C A;  5IYB J;  2E1O A;  4CYC B;  5EGO B;  4BKX A;  2O8K A;  3TW6 A;  5IP6 A;  3JRF A;  1JKQ C;  1BW5 A;  5FLM J;  4DYR A;  4Y7N J;  2EQR A;  1VND A;  3BTJ A;  4J19 A;  3L1P A;  2IAI A;  3JRC A;  1JUP A;  3A03 A;  3ZQH A;  2NVQ J;  1FTZ A;  4A3J J;  2XB0 X;  1R9T J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...