1VFCA

Solution structure of the dna complex of human trf2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
EDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparison between TRF2 and TRF1 of their telomeric DNA-bound structures and DNA-binding activities
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Short G-rich strand
total genus 14
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vfcA00
2CQXA 1JUPA 4B4CA 3M4OJ 4DZPA 3GBGA 2XPUA 4UUTA 5C44J 2DJNA 3JRAA 1D5YA 2W48A 2CUEA 2L7ZA 3HM5A 4X1EA 5FKNA 1SFOJ 3HOWJ 9ANTA 2R93J 1TWGJ 1FTTA 3G1OA 2PMZN 4LOCA 4XRSA 1RKWA 2JA7J 5GP9A 4B3AA 4XICA 5C4XJ 4C3JJ 3S15J 2E19A 3GTKJ 2VPRA 3I4MJ 1GV5A 2M9HA 4AYBN 2HOTA 1X58A 3PM1A 4BBSJ 3G1LA 4D5CA 3LSPA 1R9TJ 1NK2P 4XIDA 1YRNB 2VKEA 4V2GA 3A01B 1CQTA 3F0CA 2EZLA 2K9SA 3GTQJ 1ENHA 3Q0WA 3PO2J 2ECCA 3S2DJ 1JTXA 1TWCJ 5J1RA 3BTCA 3GTPJ 3HOUJ 2NVTJ 1A5JA 5IOYA 1U9NA 3MVPA 4DYQA 3RKQA 1PUFB 2DN0A 2COBA 3HOXJ 1K83J 2XSDC 3CMYA 2L0KA 5EEAA 3S1RJ 1Z0XA 5M5WJ 1APLC 1X2MA 2JWTA 4UUSA 2ME6A 2OPTA 5EF6A 1TWFJ 4JP0A 1IDYA 4A3IJ 3IH2A 2L9RA 1UG2A 1W0UA 1E3OC 1HCRA 3LOCA 2JN6A 1U8BA 3M3YJ 1WH7A 4M3EA 4I6ZA 2DMTA 2WAQN 1I6HJ 2GBYA 3HDDA 3I4NJ 1Z77A 4FE4A 1RESA 3LNQA 1IC8A 2XGCA 1ZGWA 1ORKA 1JUMA 3S1NJ 1U78A 1GVDA 2EZKA 2DTZA 1I3QJ 5EZHA 1WI3A 2QF7A 3HKZN 2R5YB 4C2MJ 2CUFA 2ME0A 2HI3A 4D7NA 1JUSA 2VKVA 4BBRJ 5GPCA 3GTJJ 2NVYJ 4Y7NJ 3A01A 4D5FA 2XGEA 4MFDA 3ZQGA 4AUXA 4A3JJ 3IH4A 1UHSA 2M0CA 3ZQIA 2VUMJ 1ETWA 1Y1VJ 1FEXA 5C3EJ 1FJLA 5IP9J 1MNMC 3S17J 3OSFA 5F04A 4C3IJ 5F0CA 3HGYA 1RKTA 2FJ1A 5M5YJ 4MLOA 3FK6A 1JT0A 3GTMJ 3E7LA 3S2HJ 2JJ7A 2O8KA 5EGOA 2NVQJ 1MBKA 3B6AA 1ZTRA 2YS9A 2HOAA 5FKMA 1K61A 3NAUA 3FISA 4XK4A 2P81A 3H3VK 2R5ZA 5EGOB 3HEFA 3OSGA 2E2JJ 4XRSG 2QCOA 3JRHA 1ETYA 1VF9A 4JYKA 2EBIA 3BTIA 3UKGA 3DEWA 4A3LJ 2K40A 3H0GJ 2L7MP 4MIMA 3ZQFA 1H88C 4ABZA 2DMNA 3TEDA 4DYCA 3JRGA 4IHWA 4CYCB 2D5VA 2M2EA 1GDTA 2R0QC 4GFBA 2LLKA 5FJ8J 1XS9A 2DA7A 3HOYJ 4X6AJ 2DA6A 3FK7A 3WHCA 5GPAA 1F36A 3BTLA 1JTYA 1ZKGA 2IBDA 3HOVJ 1T56A 2R5YA 4M3FA 2HDDA 2LVSA 2K9NA 3HBLA 4JX4A 2DA1A 3TP3A 2HXIA 2KDZA 2XRLA 1ETXA 2O7OA 2HOSA 2LP0A 2DA4A 1HLVA 3A02A 2X6OA 4BKXA 3ZQLA 4L5EA 1MSFC 3TP0A 5JLXA 1VI0A 1RETA 2EQRA 3OOUA 1I50J 4BY1J 3RQIA 2LY9A 5EG0A 1T33A 2NOGA 4FCYA 3BR2A 2M34A 1MBGA 4Y52J 2YUSA 5FKKA 1WGXA 4A93J 1BW6A 2LTPA 1BJZA 4IHXA 5DTDA 4C3HJ 2LKXA 2OF7A 4EEFG 3IV5A 4I76A 3TW7A 1XG1A 1HF0A 3MN2A 3A03A 4M3DA 1LE8A 2CRGA 3WHBA 5F0FA 4A3DJ 3JRBA 3S1MJ 2XB0X 5F1JA 1POGA 2MG4A 2IEKA 3NARA 2L7FP 1G2HA 3D1NI 2JMWA 3BG9A 3BQYA 1BA5A 3RZDJ 1A6IA 5K7ZA 1JKOC 3CQZJ 1QVTA 5C4JJ 4NDLA 2ID6A 1UMQA 2AO9A 4DZJA 4J19A 1F43A 3JRDA 2Y30A 4FE7A 2M8GX 1OCTC 1FIPA 1MBHA 1IJWC 1DU0A 5J1UA 2ID3A 1FIAA 2O9LA 2EH3A 3K7AJ 3FKIJ 4JX5A 2KT0A 5FLVA 3Q0VA 4V2FA 2YU9J 3JREA 3ZQCA 3S16J 4RBOA 5IP6A 5J3LA 3HGGA 4MO7A 1ETVA 2R92J 2VI6A 2HXOA 3QPLA 5K7HA 3BR0A 4QIWN 2B63J 4HNVA 1VFCA 1IG7A 3B6CA 1HOMA 1QRYA 2DMUA 3O8HA 2XGDA 5FKLA 2AHQA 1JKRC 1LFUP 1B8IB 5FLMJ 3GTLJ 2WB1N 4D7MA 5DS9A 3SFIA 1ZR2A 1B72A 3OIOA 4A3GJ 1IDZA 5E3OA 3VPRA 2LR8A 2MSYA 5E3MA 4IEJA 2LK2A 3JRCA 1GT0C 1X2NA 4QTRA 2MGQA 1AHDP 2GLOA 3JRIA 1WPKA 2JK3A 1S7EA 4BXXJ 1MH3A 2N8GA 1OFCX 2LD5A 1JJ6C 2CU7A 1ZK8A 1JGGA 4W1UA 4DW6A 1ETQA 2ELKA 4A3EJ 1RPWA 3S14J 2TCTA 4M3GA 2XB5A 1ETOA 2EZHA 2E2HJ 1BL0A 1Y1WJ 1AKHB 2JA5J 1O4XA 2Y2ZA 2R7ZJ 4A3CJ 1FTZA 1IUFA 2DA5A 4W97A 2E1OA 1RR7A 1NTCA 3LSJA 3ZQHA 4DYRA 3L1PA 2IAIA 1XC5A 5EG0B 2EZIA 1DU6A 3CCYA 4QSHA 4CYCA 4A3BJ 3Q3SA 1W0TA 2DMQA 1WH5A 3SDGA 4A69C 2FD5A 1ZQ3P 1SANA 2Y0SN 2NS8A 1JKPC 3ZOBA 1P7IA 2R5ZB 1GUUA 2CQQA 4JX6A 2MW8A 3Q0UA 5IYCJ 4IHYA 1Q1VA 2I10A 1JT6A 2X9DA 3BG5A 4S0HB 1TC3C 3C2BA 3BG3A 3O8GA 1TWAJ 4B1RA 1AU7A 2Y9ZA 2XPVA 2H8RA 1GV2A 4UUSB 5E3LA 5IP7J 2CJJA 5BNGA 1JKQC 3QPSA 5M3MJ 1PUFA 1MBJA 1U9OA 1IGNA 1MH4A 4G12A 3BR3A 5IPAA 2RAEA 2XPWA 1YRNA 4XRMA 3BTJA 1P7JA 1B8IA 3BT9A 2Y9YA 1IV6A 1ETKA 5FKOA 3JRFA 1QVUA 2X48A 4A3MJ 3IH3A 5EDNA 3SJMA 1LE8B 5F0HA 1HDPA 2JA6J 2NS7A 3BR5A 2ZB9A 5HODA 5F08A 1OCPA 1NK3P 3S1QJ 1TWHJ 3QQAA 2DA3A 2NVXJ 3BQZA 3RZOJ 2DA2A 2HQ5A 5IYBJ 2JA8J 3G1MA 2DMPA 1HDDC 3LSGA 1LFBA 1MBFA 2K9QA 3JR9A 2E2IJ 1IRZA 1ZR4A 2GM4A 4A3KJ 5IYDJ 3LSRA 3PO3J 4IHVA 3HB9A 4FTHA 5J1YA 2FX0A 1B72B 5EYRA 2LFBA 1H8AC 1EF4A 1MSEC 2ECBA 1WCMJ 5E3NA 5F27A 4A3FJ 3CDLA 3W6VA 4AC0A 5EZGA 4MFEA 3HOZJ 5M5XJ 4BY7J 3BR1A 3MKLA 4M6VA 1AKHA 2WV1A 4M3BA 3GTGJ 2G0EA 1H89C 1OJLA 1MBEA 3K2AA 2Y31A 1QPIA 2FQ4A 2TRTA 2HYJA 4RDUA 5M3FJ 4FISA 5JLWA 1BW5A 3BR6A 2H1KA 1JJ8C 3FIWA 3GTOJ 5K7FA 3TW6A 5IOZA 3DCFA 1VNDA 1ITYA
chains in the Genus database with same CATH superfamily
2XF5A 3GBGA 2DYRH 4UUTA 1UG0A 1D5YA 2W48A 2AQFA 1M1EB 3FDYA 3NRVA 4BJTA 2LSOA 4F93B 2L7ZA 3ZN1A 1R1TA 2UZKA 3LAJA 2HQAA 9ANTA 1X1DA 1EA3A 3OS2A 2X6WA 2P7CB 3JTGA 1FTTA 2LH9A 4LOCA 5L3BA 2R7WA 2K7LA 2BE5F 5ED4A 1OISA 3KEOA 3P9KA 3OR2C 3I4MJ 2FUG2 1ZG5A 3GLLA 2IA1A 1X58A 1FYLA 2HOTA 2BOLA 1I3AA 3G1LA 5EEHA 4D5CA 3A0HC 1HKSA 3E0JB 3RYRA 2W7NA 4ESJA 3PNTA 2PJRB 2FOKA 3CCEI 2VKEA 1Z6RA 3A01B 3M9AA 4UUVA 3F0CA 4DNCA 2RNGA 2K9SA 1TW3A 2VASA 3GTQJ 3Q0WA 2HTJA 1SFKA 2ECCA 3SXYA 1JTXA 1G59A 3BTCA 1K7AA 2PJRA 3HOUJ 2NVTJ 4HQEA 4X0GA 3PNYA 2JPCA 2DN0A 3HOXJ 1VQPI 1SC7A 2OCCH 3BOQA 1K83J 4KT5C 5KAIC 2XSDC 3C2GA 3DU5A 3RPQA 3HL2A 4L9VA 3OYNA 1O57A 4I7HA 1APLC 2B0LA 4F55A 3KCCA 4U88A 4NHJA 2JWTA 4UUSA 1S8NA 3L2WA 4QPOA 2Y0MA 2BV6A 2IP2A 2V6CA 4N9HA 5EF6A 3FWEA 1TWFJ 3FXLA 4AYBA 2ELJA 4A3IJ 1Y8RB 2CO5A 2DJIA 2E1MB 5EEGA 1IV8A 3ASOH 1SMYF 2DFFA 4GYIA 3BLYA 3GFLA 1IAWA 2WAQN 3D5LA 1I6HJ 3K1MA 1H9TA 4LFUA 1ZGWA 2Q2EA 2C6YA 1U5TB 3C7JA 1TL8A 4IVNA 2F5FA 1RUOA 3S1NJ 2NXNB 5J47A 2DTZA 3Q9SA 4Q47A 2V1XA 5HNHA 3FXUA 3V4GA 2Z1DA 1BI3A 4IQ4A 2CV2A 2CV1A 3FKJA 1SFXA 1YE9A 2LDUA 3P7NA 2HI3A 2HPIA 2VKVA 3GZ5A 3KLOA 3OIQA 3OR1C 3GTJJ 2CW8A 5FFZA 1ON1A 2NVYJ 3CUQB 2PJPA 3JSOA 3IH4A 4PJMA 2OUMA 4GDFA 2W25A 3ZQIA 3I55I 4AM3A 1QZEA 4ON0A 1A31A 5IP9J 2GAUA 2PI0A 3OSFA 5F0CA 3HGYA 2EJRA 5GADJ 2WAFA 2AQEA 1JT0A 1Q1HA 3E7LA 4U7DA 1QBJA 2KLOA 3JTHA 4KYWA 2B9SA 2JJ7A 1LDJA 2YS9A 3I53A 3L2CA 1R4NB 3GWZA 5LGTA 2PFBA 3SYTA 2P81A 3H3VK 3CD6I 2XKOA 3HC7A 1W1WE 3RQ4A 5KNLA 5DCMB 3RDIA 3CP2A 4KITB 2Z33A 4J00A 2E2JJ 4OOIA 3JRHA 1ETYA 1VF9A 4AWXB 4MQ9F 2DW4A 3AG1H 2E1CA 2QM3A 3ZQFA 3SZTA 5CQGA 5K5OA 2DMNA 3WTTC 4CYCB 1BC7C 1FWZA 1VQ7I 2OCEA 2P6SA 3P9CA 4UVAA 3E6CC 2LY1A 2NS0A 4X6AJ 2DA6A 3VODA 3OS1A 1S3JA 1ACIA 3BTLA 4D1QA 4OU0A 1JTYA 4HOBA 1KQ0A 1ZKGA 4AVZA 3ASNH 3DV8A 3TMOA 2IBDA 4XSZF 2VJ4A 1WRJA 4YG2F 5A2QK 3ECOA 4M3FA 5FLXK 3DBLB 3CCSI 3E5XA 1R7JA 2K9NA 4JX4A 3WE2A 3LL7A 3VEPA 3N05A 3M07A 2MLGA 1ETXA 2IGOA 1ZREA 2ZJQF 1SD5A 1UHWA 2DA4A 5J8FA 4CYDA 3V7CA 5FRNA 1BOBA 1BBYA 2EQRA 3LFKA 3ZR8X 3KP4A 4OWRB 1MZBA 1QHGA 1KA8A 2LY9A 3F6VA 2NOGA 1LJ9A 1XGNA 3BR2A 3R6SA 5EG0A 3PIOF 2VOOA 4EJUA 3WTYC 4HF0A 3C18A 3V8JA 2ZBKA 1BJZA 2BBYA 2Z2SB 5H6RA 1XCVA 2OF7A 1I27A 3IV5A 4LG0A 3TW7A 2KP6A 3HUGA 4M3DA 3ZMZA 1QO0D 3HOSA 3WTWC 1TTYA 2H94A 5F0FA 3RPUD 3JRBA 3H5NA 4I0BA 3FXJA 4MHGA 2AXTC 2KZVA 2L02A 3CC2I 3IHUA 3K2ZA 2OQGA 1ZARA 1D1BA 3MKWB 4KICA 2BY2A 1RUNA 2KKOA 2D1HA 2L5QA 3DTEA 2ZJRF 1NG7A 2D45A 2IS6A 1I5ZA 1FT9A 1UJ8A 4XLNF 3KP3A 1QVTA 4PUSA 1J2XA 3AL0B 2OZUA 3PL8A 1ONVA 1D0YA 3JRDA 4FE7A 2K4BA 4B48A 4HW0A 1USSA 3FHZA 2QGUA 4CZCA 1TQPA 2W84A 1IJWC 4XORA 2XASA 1FIAA 1HW1A 3WODF 2O9LA 4YELA 3GFJA 3S32A 1G8XA 3PSFA 2WAEA 5L3FA 3J7YJ 4BL0B 1NH3A 2P8TA 5HS9A 5D4RA 2DFIA 3JREA 5E20A 3S16J 4RBOA 3WU2C 2BXYA 3VSKA 2CQ7A 3DWLE 3FXKA 1YLFA 3HGGA 1Z9CA 2IGNA 2HKXA 3FBIB 3DP7A 3RYPA 3DU6A 3OYMA 1S7AA 4IZZA 1FMVA 1R5GA 4PSXA 4HF1A 3E6MA 1FOXA 3KZIC 2KQRA 1J75A 2IT0A 1O7LA 1HOMA 1V5FA 4RB1A 3KP5A 1D3YA 1VZ0A 2LYCA 1BR4A 3VYRB 2HU9A 2M8EA 2A69F 1V54H 1R71A 4ENMA 2M7BA 1D5VA 5E3OA 4PZJA 2OZ6A 1O3QA 3K4JA 2WB1A 1L3LA 1LKXA 4Y4RA 1X2NA 2MH2A 2VBZA 4RAZA 4XKBA 1BR2A 1WPKA 2P7VB 5LEJA 1MKMA 1S7EA 1MH3A 2N8GA 3KIOA 1IN7A 3FMSA 1X1BA 1PP7U 2XUBA 2MC4A 2CU7A 4RGSA 4UVCA 3E5UA 3KP2A 4W1UA 1YFHA 3E6DA 3U2RA 1ETQA 2ELKA 4GXOA 4C9YA 1XGOA 4M3GA 2XB5A 3E6BA 1V5GA 3K4CA 4BGDA 1O4XA 2Y2ZA 1VQ8I 2E60A 2O5RA 1T95A 1NHAA 1IUFA 2QA4I 2E1OA 2WV0A 1NTCA 4R79A 3ZQHA 5ICEA 1QZYA 2IAIA 4HX4A 1XC5A 2EZIA 1IXCA 2I5UA 4ZDLA 3OL3A 2GXAA 2DTRA 3OOPA 3CUQC 4QSHA 1MNDA 1I39A 2HQRA 4E6KG 3BCAA 5DEQA 5ILUA 2VJIA 2V79A 4A69C 1FLIA 1EKEA 1NG6A 1WJ5A 1ZQ3P 1SANA 1W4MA 5TJJA 4E70A 4OIQF 4BS9A 3H0DA 4CCOA 1GUUA 4II2A 2MW8A 1FSEA 4L9NA 1ZGJA 1R00A 2CWEA 3R0JA 3CJTB 4XLCA 2HR3A 4XSXF 3HOTA 4G7ZF 2X9DA 3BG5A 5FO5A 3WG7H 1BIBA 4Y13A 4KFCA 2X1CA 2KIQA 4M9XA 2V7FA 2A61A 4YFXF 2EIMH 1GV2A 3BG6A 3BWGA 4AVPA 4HSRA 2EINH 2CJJA 3H1CA 3KZYA 1K6YA 3MQ0A 3QPSA 5HNFA 3G71I 3I54A 1KQ8A 5E1WA 1X19A 2X6YA 1P7JA 1B8IA 3BT9A 1V3FA 5L3CA 4WXHA 2QQ8A 2K02A 3WGGA 1IV6A 4F7ZA 4B47A 2R7OA 4RGUA 3IH3A 2K9MA 1T38A 3SJMA 2QVOA 1HDPA 1TZLA 1WJEA 2ZB9A 1OCPA 4PK4A 4P9UA 1NK3P 4B09A 1Y0NA 3FM5A 2NAZA 2V4JC 1G3SA 4IRHA 1TNTA 2HQ5A 4PJ0C 2Y75A 2DMPA 3HJEA 1HDDC 1LFBA 1SVLA 1MBFA 3DPTA 1XGSA 2A68F 3CCMI 4KJZA 1OR7C 1VQ4I 1ZR4A 3LQRA 1T08B 4NNJA 5E1ZB 1FSHA 3F8MA 3DTKA 5DCMA 1W5TA 1EH6A 2FRHA 3DF8A 2PMUA 2KISA 4ZC3A 5ILVA 2QYOA 5DDGA 1EF4A 3FM3A 3RKXA 4IPAA 4AIDA 3EDPA 2I8DA 5F27A 1QHHD 3CDLA 4DOZA 2W4SA 5D4SA 1XB4A 3FMRA 4O3MA 4ZDPA 4D9JA 1DGRM 2KJCA 1LDDA 2A5WA 1VQLI 1AKHA 4M3BA 1VQ6I 3HG9A 1OJLA 1IRFA 4B44A 3N4MA 3K2AA 4ZZLA 4S04A 1FYMA 2TRTA 4U7BA 1Z1DA 4FISA 5JLWA 4EM1A 5E8GA 3W6JB 2EPFA 4GGGA 3NWTA 4IX7A 3JSPA 4XN0A 1JJ8C 4G6QA 4BAYA 4L0ZB 5K7FA 5HVQC 2F2EA 5DYMA 2IS1A 2EIJH 5BS6A 1JUPA 3V8KA 4ANJA 3JRAA 2DJNA 4QWQA 1IRGA 1T8IA 4KISA 2DYSH 4CO8A 3QWLA 2L54A 4LB5A 3GYHX 4X1EA 3GMEA 5FKNA 3VDXA 4EGYA 4KMFA 1KYZA 4FQGA 3HOWJ 1R22A 3S3OA 4RM3A 4EV0A 2QBYB 2MFZA 2LMDA 3NQOA 3O3KA 1YHQI 3EQLF 2V1UA 1B6AA 4XRSA 4ZH4F 1JGSA 4B3AA 2V1DA 3QODA 3PIPF 1W36D 1P2FA 2UUZA 4HDVA 3L2RA 3GTKJ 1BI1A 4BHPA 4AYBN 3PM1A 2ZJPF 4P1WA 4BBSJ 3FZVA 3LFUA 3LA7A 4L0YB 4FX0A 4V2GA 4CCJA 1CQTA 1YRNB 1DP3A 3QU3A 4RLQA 4FX4A 2QSFX 4LMYA 2Z16A 3BJAA 2OA4A 1A5JA 2EWNA 3CUOA 2COBA 1USTA 1G3WA 3KZZA 4I99C 3F6OA 3JW4A 3CC7I 2HVSA 2RVCA 1Z0XA 1SVOA 1UHMA 4LD5A 2XAQA 4RMNA 3PUBA 1XPXA 3V8LA 5K5RA 5CKTA 2IXSA 1ODDA 3BPXA 2OPTA 1N75A 1QPMA 1PJRA 3IH2A 5JHUA 1E3OC 3WTVC 3S2WA 3HZJA 4WCGA 1MGTA 4U0VA 2NOJB 1U8BA 2LG4A 4I6ZA 3CO7C 3ZP5A 3ZMUA 2DMTA 3CUQA 2ZFWA 1D0ZA 1Z77A 3K10A 2K9LA 3UR3C 1WJBA 3W2WA 1WJFA 2XGCA 3MZ8A 4R8HA 1G3YA 2EV5A 1JUMA 1U78A 4NUBA 1TNSA 2EZKA 3HSEA 4P55A 3MZYA 3TQNA 5BQTA 1WI3A 2QF7A 3ROUA 3HKZN 5GAEJ 2Q2EB 2ZCWA 4BBRJ 5GPCA 5H6QA 3HSRA 2KL4A 1X3ZB 2XGEA 4AUXA 2A6HF 2K27A 1MMGA 1UHSA 2M0CA 1XMXA 1O3TA 2FBIA 2H1LA 1ETWA 2VUMJ 1W7PB 1Y1VJ 3OYCA 4EGZA 1FEXA 1LVAA 1FJLA 4NB5A 1I1SA 2ESNA 5DV5A 5GAHJ 5F04A 4MLOA 4P9FA 3GFIA 1FMWA 3EUAA 1A6QA 3HHGA 2QQ9A 3S2HJ 4BQNA 2HYGD 2XV4S 3IAS2 2NVQJ 2J5PA 1MBKA 3B6AA 4XBFA 2HOAA 2JTVA 1W5CC 1YIOA 3GLXA 5KAFC 3K1PA 3NAUA 4XK4A 4YIRX 3CTAA 1HW2A 2QZ8A 4MQVA 1D0XA 1IRXA 2MYSA 2H09A 1H9GA 4OIOF 5EGOB 3HEFA 4XRSG 1OYWA 2O8XA 4JYKA 3I4PA 3HTSB 2EBIA 4YFKF 3M1CA 1P6RA 3DEWA 5LBQA 1OYIA 4MIMA 1BOAA 1YW8A 1T0FA 3MKYB 4DQ2A 1H88C 4Y3OA 1HC8A 2Q0OA 5L3EA 1FOWA 3W2VA 4DBQA 3B73A 1U8RA 5CVJA 5GAGJ 3VYTB 5FJ8J 4GFBA 3LMMA 3S8PA 1OR7A 2DA7A 3B02A 4CCMA 1XS9A 4IJAA 1SVMA 5GPAA 3WHCA 1CF7B 1MJBA 4M71A 1SD6A 2NYXA 2JQ7A 4CCLA 2FA5A 1U5TA 3KYDB 3LSMA 3K0LA 2OTJI 3KX2A 2R5YA 4B8XA 3GXOA 1KZHA 2LVSA 2X1EA 2E36A 2FXAA 3F3XA 4PJNA 4G6TB 4FASD 2PMHA 2XRLA 1P4XA 3ZCOA 2O7OA 2XDVA 2V6EA 4BE0A 2HOSA 3GZNB 2ZXJA 2P4WA 1RZ4A 5AONA 2QSHX 1YTYA 3A02A 1JHFA 1WI9A 1OYYA 1DUXC 3CF2A 4XLEA 2F5DA 1VI0A 5HDKA 1T98A 3BJOA 3MEXA 2XF7A 1WJAA 4YIFA 1FP1D 4MEXF 1FBUA 4BY1J 3COAC 2E7WA 1MBGA 3R61A 2KRFA 2BEOA 1OQYA 1WGXA 4A93J 2LTPA 4YEJA 2HZDA 2QLZA 4EEFG 2KIFA 1W7PD 2HTSA 2CUZA 4I76A 5JVGF 5ICCA 2ACJA 1HF0A 3ABLH 4HNTA 1LE8A 2VXDA 3RSNA 1R58A 1W5SA 2XGXA 3ZXSA 3S1MJ 1Z3YA 4XONA 2W82A 1X1PA 2ESHA 3NARA 2Z3YA 3AG4H 1E2XA 2HZTA 3K1NA 4M6YA 1DGWY 5IT9Z 2L7FP 1J59A 2CW0F 4RLFA 1A36A 4OIRF 4GRIA 2EV6A 2NVUB 3RZDJ 1HW5A 1DPUA 3QPHA 1QA6A 4WK8F 4G9YA 3WU0A 1T0FC 2NRAC 2AO9A 4BEHB 4WXDA 4J19A 1J0RA 2Y30A 4KN4X 5FRMA 1OCTC 3L09A 1J5YA 1FIPA 4O5VA 1PUEE 4P5OA 1XSVA 1MBHA 2MBFA 3LSIA 5J1UA 4A5NA 3S3NA 3FKIJ 4XKWA 1X4PA 3I3LA 1FOKA 2KT0A 3KEYA 5FROA 3J80Z 2A5YB 2DFHA 4KIFA 4ZDOA 5IP6A 3HPGA 3BPVA 5J3LA 1ULYA 2LF8A 3IAM2 2P5LC 2V9VA 2M1BA 3LSHA 4HLYA 2HXOA 2K5CA 3QPLA 5K7HA 4BNCA 3I0TA 2XC7A 1LPQA 2B63J 4A6DA 3OYAA 2FSWA 4YIIA 2L3DA 1QRYA 3O8HA 3ONQA 5CYVA 1SMTA 2ZKZA 4WWCA 1B1BA 3G3ZA 4BHBA 1O7FA 3VYUB 1KU3A 4G8XA 4AIHA 5HS7A 4D7MA 4XLPF 2H27A 2JSPA 3ZMDA 1KQ9A 3TDZC 1P9QC 2OD5A 1FNNA 4HF2A 1UELB 1Z21A 5D8KB 2VT3A 1GT0C 2QUFA 2ZO4A 1OCRH 2F5EA 4JOMA 2GLOA 4CSWA 1TP4A 2DXIA 2PLYA 5J8CA 4KIBA 4IOCF 3EETA 4XMYA 3GCMA 3SEZA 5LHIA 4HG2A 4LJZF 4CCKA 2ZJ2A 1JJ6C 4A0XA 4A12A 3P9IA 2RKHA 3CCRI 2DO7A 3TO9A 1IZ1A 1IF1A 3CF5F 3AAFA 1FBQA 1P92A 1TBXA 2VQCA 1SAXA 1RPWA 4II3A 1TQIA 1PP8F 1AKHB 2JA5J 1UB9A 2LBFA 3DFGA 2R7ZJ 2HYFA 3SQNA 2KZGA 2Y69H 4DYRA 4IO9F 1RR7A 1O3RA 5J6XA 1GXQA 3CCUI 4E7JA 5EG0B 2HQNA 5IT3A 3QRFF 2F5CA 5B5EC 2KIMA 1V5EA 3TOBA 4CYCA 1W0TA 1WH5A 3E1SA 2VKDA 5E1XA 2L9VA 2FD5A 5BPDA 2FMYA 2CYYA 2R4GA 2VC0A 3ZMVA 2Q1ZB 4Z2YA 2R7DA 1YYVA 1DP7P 4IHYA 2ISZA 3OY9A 3C2BA 4B43A 2DPDA 2K4JA 5B1BH 3W6KB 2UWMA 2H8RA 1K4TA 4UUSB 5E3LA 2O0YA 5FLXZ 1JE8A 4BDYA 3R0AA 2GA2A 2L01A 5IY5H 4HX7A 1JKQC 1OMIA 3OYBA 4HDUA 2UXXA 2L7KA 1U9OA 2CH0A 5BPIA 2XPWA 4Y33A 5DUIA 2VBWA 3CDIA 4A5MA 4UNOA 3D5SC 3CCLI 2WA0A 2RC4A 1DQUA 2X48A 2E5NA 2AS5F 4D0PA 5F0HA 4JK1X 3HPHA 2O6GE 2NS7A 3BR5A 2JA6J 5F08A 3K4NA 3H5RA 5HDGA 4XLFA 3CESA 3ML6A 2Q8KA 2VE9A 2DA3A 1UZCA 4NQWA 2VIXA 3BQZA 4XOTA 4BYYA 3F23A 2LOOA 3PUFA 3KE2A 1ZGAA 2YX7A 2DU9A 2HKOA 2GZWA 3OYFA 1YJ9I 2VPLA 3JR9A 3J81Z 3F8NA 2AXLA 3TBIA 3REOA 3LSRA 4BU2A 5TRDA 2CMPA 1J9IA 1MIJA 3DBHB 5LD2C 4MNUA 4BJ6C 4F92B 5EYRA 1YI2I 2LFBA 3F8BA 1WCMJ 4LGWA 3X2QH 5E3NA 3ZPLA 2MABA 1O3SA 2F5VA 3TO7A 3ZMSA 2HDCA 4L9JA 4UB8C 2E71A 4V19K 4YFNF 2ZFUA 1QU3A 2R7XA 2Z99A 1YO5C 1YS7A 3WG9A 3HOZJ 2CFXA 5EJCA 2YSRA 1XMKA 2UV1A 3BR1A 2D1VA 3OYGA 2KRCA 2DOFA 3GO5A 3H36A 4CXFA 1MBEA 1EH7A 1GHCA 2DDBA 3CLOA 4DGWB 3DEEA 3GFMA 2L4AA 1VQNI 1ZRDA 3BZ6A 2H1KA 2F6CA 2WAQA 3FIWA 2F4IA 2OU2A 4GO1A 2A05A 3OYLA 3DLAA 2VQLA 4H4KC 3I56I 2CQXA 3I59A 3M4OJ 2JT1A 4DZPA 4ZYHA 2FU4A 4EJWA 2CUEA 3HM5A 4HRIA 4G7OF 2KMUA 1TWGJ 3MMYB 3G1OA 1G4DA 3RCOA 5E17F 3O2PE 3OYHA 4S05A 1RKWA 1ZN2A 2JA7J 2HS5A 5C4XJ 1ZG3A 3FF5A 4C3JJ 4IHTA 2QEXI 1B4AA 2E7XA 2E19A 2K86A 4RB2C 3S15J 2MC3A 2FF4A 2M9HA 1K6OA 4ZTFA 3LSKA 3TGNA 3WTSC 4GYGA 3LSPA 1R9TJ 1NK2P 4XIDA 2W57A 3U21A 1U6GA 1TQMA 1XMAA 4WF2A 2DLLA 2EZLA 1P4AA 2M3AA 3D0SA 3PFYA 1BI0A 5KK1A 1ENHA 1K4SA 2GXBA 3PO2J 2V9PA 3S2DJ 4E7KA 5J1RA 4K2EA 5KVRA 2O03A 2HPMA 3GTPJ 3NEUA 2VLAA 3DTIA 5IOYA 3BCBA 3MVPA 4DYQA 1PUFB 1X3WB 4U0WA 2VONA 4AU7A 4LLLA 2HVRA 4P96A 3CMYA 2EFNA 2L0KA 5EEAA 4E7HA 3CCVI 4HA8A 1R5HA 5M5WJ 2IPQX 3BZKA 3JAMZ 2K85A 3W3CA 2P6TA 1FZPB 1X2MA 3J81K 1Z91A 5E79C 4XRFA 4ENNA 3IKTA 3FHNA 3MZHA 1PVEA 3KP6A 4JP0A 2L9RA 3U9GA 4UB6C 4I2OA 1B9MA 2DQLA 4BQOA 4Q48A 1Y8QB 4PGHA 3K69A 3K70C 4Y17A 3V42A 4DJAA 3T8TA 1D1AA 1SFUA 1KYWA 2B7EA 3HDDA 3AG3H 3PQKA 1RESA 3KEQA 4FE4A 2V26A 4KIGA 4WXCA 1H0MA 4BE2A 4A2UA 4RAYA 3AL0C 1X4OA 2MA3A 1GVDA 5K1YA 3R4KA 1I1GA 2FE3A 1AWCA 1Z7LA 5EZHA 3FMQA 4GCVA 2R5YB 2LNBA 2DCEA 2XAUA 2JVGA 5A2QZ 1VQ9I 1XSXA 2RV8A 5D6EA 2BHYA 2CUFA 2ME0A 1D1CA 2GOXB 1XTAA 5JI6A 3TDUC 1W36C 4HV6A 4KUMA 4D5FA 2XF6A 3H35A 3K6GA 4MFDA 3ZQGA 2KJBA 4A3JJ 1X1AA 2K3PA 2KFDA 3CCQI 2JUGA 3DXJF 5C3EJ 1G3TA 3S17J 5D5XB 3CJRB 3CCJI 2KIUA 1RKTA 2FJ1A 3JCUC 5D6FA 3GTMJ 4HZFA 3M7GA 2W00A 3ZRGA 3ULQB 4M74A 4HX8A 5EGOA 2O8KA 1RR8C 2QBYA 4EJVA 4BJ5C 4LIVA 1HA8A 2H6CA 2R5ZA 1MJAA 1XX5A 1KGSA 3QOEA 2E1MC 2XAFA 2D2WA 2QCOA 5ICFA 3ABUA 3RKYA 1RIOH 1KU9A 1WSUA 2WY8Q 2VB6A 3T8RA 2K40A 3H0GJ 2L7MP 3U1DA 3PJRA 2VC1A 4ABZA 3MKZA 1UFMA 2IA2A 4DYCA 5F1RA 3JRGA 4IHWA 2D5VA 2M2EA 1LEAA 2GIVA 1GDTA 2R0QC 3CDHA 2R7VA 2H6BA 2IVMA 3BY6A 1WQ2A 1E3PA 3C3WA 3F9KA 3FK7A 3CZ6A 3OL4A 4HBLA 3K70D 4KA4A 5L3DA 1FX7A 3OYIA 3N97A 5LGNA 2DAOA 2L2OA 1VQOI 2ELHA 2LY2A 3RTRA 3HOVJ 2BYVE 1T56A 5E18F 2FEZA 3HBLA 4LITA 2RQQA 1WJCA 2PBIA 1V55H 2OTLI 2X6XA 1OPCA 1VQ5I 3ERED 4HPQA 1FOYA 3IC7A 1MDMA 4L9TA 1HLVA 3HKZA 5TISC 2X6OA 2DK8A 4BKXA 4L5EA 3V7RA 1MSFC 5JLXA 3HXLA 1QNTA 2CGPA 3QPTA 2L9SA 4H0EA 1VQKI 1MNEA 2IRFG 2YU3A 2M34A 4M9ZA 1GVJA 1PDNC 3ABKH 4KT6A 4Y52J 5CVRA 4DIQA 3QYFA 2G7UA 1SD7A 1XGMA 1UCRA 1KU7A 1BW6A 4HQMA 4NQWB 1X1CA 5DTDA 3C1DA 3IWFA 2LKXA 2STWA 2LREA 4XOPA 3M8EA 1IN4A 5CVUA 4RB3C 4I98B 2IS2A 3M8FA 3ZN0A 4RAGA 3AFHA 4G6DA 1ZYRF 4MGRA 5F1JA 1POGA 4PFPA 4ZYEA 1SAUA 3H9QA 3WGIA 3OYJA 2VJJA 5ILSA 4BXUA 4Q5SF 3SHFA 3D1NI 3F22A 4EQQA 4XR6A 3BQYA 4A6EA 1G6NA 4JQFA 1BA5A 1XDUA 3A2KA 1A6IA 2ZXWH 1FC3A 3GEZA 4C30A 1JKOC 2ISYA 2L9NA 3Q9VA 4HYEA 2ID6A 4O6JA 1UMQA 3L9FA 4BQAA 3K4KA 3WTXC 2MD5A 2ZMEB 1HKTA 2WBMA 1U3EM 1YS6A 2CG4A 4CH7A 4CA0A 1DU0A 2ID3A 4LLNA 4AIJA 2EH3A 1ZRFA 1YIJI 4JX5A 2FNAA 5FLVA 2FBHA 3MD2A 1UAAA 4ZJZA 1S6LA 3PNVA 2YU9J 1XN7A 2M5WA 2X1DA 2R92J 2VI6A 2EA4A 5GTHC 1A04A 3I71A 4OMZA 4HNVA 1VFCA 1OCCH 3OIPA 3B6CA 5DM6F 1PYVA 2CQKA 4CUGA 5ICGA 3OS0A 2RREA 2AHQA 3KPHA 1LFUP 3QP6A 4BUPA 4OAYA 5TGTA 3GTLJ 4FT8A 4BH9A 3OYKA 5DS9A 3SFIA 1B72A 3OIOA 3LAPA 2NNNA 2ZSIB 1SEUA 2BY1A 1Y6IA 3BG7A 3E3VA 3FXQA 3DLLF 3KP7A 5E3MA 2MLKA 1TT5B 5F64A 4IXAA 5B1AH 3M8JA 4M72A 5DD4A 3DPLC 3JRIA 2JK3A 1YJWI 3BP8A 2JZYA 3R60A 2R7SA 5D5VB 3QYEA 1YJNI 1OFCX 1B59A 4CICA 2LD5A 2QSGX 2QWWA 4PJJA 3GF2A 2WTEA 1ZK8A 3A4CA 1MMAA 3QP5A 4F3QA 1XDSA 3U1KA 2WC2A 3J7AY 2TCTA 2DBBA 2R7TA 2ICWG 1SD4A 1Y1WJ 4XKCA 2BZTA 2ZNZA 5CQEA 4A3CJ 3GW2A 1IN5A 1FTZA 3LSJA 1S5LC 5GTIC 1Z05A 3BZCA 2VQGA 4N4NB 1DU6A 4OMYA 2FNPA 1LFPA 1OCZH 4A3BJ 3Q3SA 3PSIA 5E8IA 2NNYA 2XAJA 2VKHA 2O61A 2E5ZA 3SDGA 3CJNA 5FB2A 4EVIA 4EM2A 2V1NA 2Y0SN 2NS8A 3ELKA 1P7IA 2R5ZB 4ZYGA 2ETHA 2CQQA 4JX6A 5HLTA 5IYCJ 2EB7A 4AIKA 2EA2A 1EH8A 2O3FA 4KN7X 3D5RC 2I10A 3DKYA 1JT6A 2GIZA 2EFWA 4S0HB 1YX3A 2VBXA 5J4VA 4HLXA 3BG3A 4UXNA 3O8GA 4ZZDA 4B1RA 2ZXHA 1YX5A 2W85A 2Y9ZA 1GLNA 2XPVA 2J5OA 3FXMA 2EIKH 2X0LA 3BROA 4IF4A 4ITVA 5DUKA 4OINF 5M3MJ 1PUFA 1MBJA 2RDPA 2PEXA 2XIGA 1IGNA 1MH4A 2VXZA 4G12A 3QYBA 5IPAA 4IQJA 1YRNA 2PX9A 3BTJA 1WKMA 4LG3A 4MTEA 2Y9YA 3A0BC 1ETKA 2IW5A 5FKOA 1XCBA 1QVUA 3GVAA 1MD0A 4PGGA 4M73A 1IN6A 2DOAA 2FMLA 4CCNA 3IRRA 1LE8B 5HLGA 1FYKA 1WWXA 5HODA 1IXRC 1R49A 2ZSHB 3S1QJ 2EV0A 1TWHJ 3EPZA 2ZMEA 1LEBA 3A1YA 1ON2A 2DA2A 1ERDA 1IW7F 4HAMA 1U2WA 3G1MA 2JA8J 3UNGC 1Y56A 3SDBA 3LSGA 5CLSA 1N78A 2E2IJ 3HSFA 2PQ8A 2GM4A 1TW2A 3HB9A 4UV8A 4IOAF 3I9V2 2RNJA 5J1YA 1YQAA 2FX0A 2R3SA 2KRHA 1K79A 1B72B 1IUYA 1EV7A 4L18B 1H8AC 1Z3XA 2EFOA 1BI2A 2JA2A 5LGUA 2ECBA 1U0JA 2JVHA 3EUKL 5BMZA 4XLAA 4A3FJ 5J4YA 2RN7A 5EZGA 2JUCA 1JI8A 1YG2A 2XKPA 2TDXA 1FY7A 4KMUX 2BW3A 1R1VA 3Q5FA 2P5VA 3KFWX 3MKLA 1WFXA 4M6VA 3IKVA 3GTGJ 2G0EA 1E17A 4QLCU 1IN8A 1F1ZA 2XVCA 1ZLJA 3CLQA 4I0AA 4C2TA 4LG0B 2VQHA 1QPIA 3IUOA 5M3FJ 1BW5A 1N77A 2ZMEC 3FXOA 4R1HA 3KLNA 3TOAA 2OBPA 2IJLA 4N4OB 2DT5A 3V7SA 4N9IA 1F9NA 4MTDA 1LB2A 2CW7A 4PCQA 4UHTA 3RKWA 3RIRA 1U5TC 4B4CA 2JPBA 2PMZA 3ZQ7A 2XPUA 5C44J 1GXPA 3W2AA 5JFRA 4HV5A 3QU6A 2G7HA 1QGPA 4XL9A 4A0ZA 4DBRA 4B3XA 1VTNC 1SFOJ 5FD6A 1FP2A 3CMMA 2R93J 3KETA 4RS8A 4ASNA 2PMZN 4CZZA 1ZELA 5GP9A 2VE8A 4IRGA 4XICA 1HXDA 2PN6A 5HS8A 2VT2A 2ADUA 2VPRA 2M30A 2DT6A 1GV5A 4RAFA 1EJ9A 1Z7UA 4PSWA 2A07F 3EYYA 4I02A 2Y0SA 1MDMB 2EFPA 3SZGA 4BHCA 1QZZA 3CJQB 4OIPF 1T6SA 3H5AA 1XSDA 1T2KA 2VBYA 3CC4I 2R7FA 4L5JA 3G2BA 1TWCJ 1U9NA 2QQAA 3RKQA 5HDNA 2BW3B 3FX3A 1ZH5A 3GX4X 3G73A 1REPC 5LLQA 3S1RJ 4HSTA 3SEQA 1BIAA 2G9WA 4RGRA 4ESFA 3HRUA 4ZTJA 3ESWB 3SFZA 5LRSA 3HYIA 4EJTA 2ME6A 6PAXA 5LFAA 1E0EA 1IDYA 1ZAOA 1WHUA 1UG2A 1W0UA 2DT7B 4BACA 1HCRA 4MEYF 4BDZA 3WGHA 4NC7A 3LOCA 2JN6A 2X85A 3M3YJ 1WH7A 4M3EA 1MMNA 3NWSA 4RA2A 3ZQQA 2GBYA 3I4NJ 1LDKB 3K9TA 3AKZA 1Z67A 3LNQA 1IC8A 4NC6A 1ORKA 3HRMA 4IHSA 2DPUA 3O6BB 1I3QJ 2LKSA 3DBRB 2HEOA 1DDNA 2BVLA 1S72I 4ZYAA 5L3GA 4C2MJ 3I58A 4D7NA 1JUSA 2HGCA 2YPRA 3H92A 2M4GA 5F6FA 3F21A 4Y7NJ 3A01A 3T1BA 3L2UA 3I64A 4IRIA 3CO6C 3OV8A 2DQRA 1LUJB 5DM7F 2GXGA 3HRSA 5BOXA 3QOPA 1MNMC 1E3HA 3I5UA 2VODA 4G94A 3BC8A 4C3IJ 5M5YJ 5D5UB 3FK6A 3H3UA 2DOEA 4PFOA 2BHZA 2FBKA 2CV0A 1DPRA 5DCFA 1YITI 1V4RA 4ENKA 2F4OB 1ZTRA 3DKWA 5FKMA 1K61A 2A6EF 3FISA 3IRQA 3DKXA 2M7AA 1ZLKA 3DEUA 2HVQA 1HSTA 3P5JA 3OSGA 1RRJA 4RGXA 3BTIA 3H9GA 5KHDA 3UKGA 1C0WA 4A3LJ 2XROA 3HHHA 1CF7A 2HNHA 5H20A 3LA2A 3TEDA 1Z6TA 2VJ5A 3LWFA 3I59B 1R5ID 1K78A 2LLKA 4N0BA 4Q4ZF 4XQFA 2XAHA 3ABMH 1TLHB 3HOYJ 3F72A 5LHHA 1JHHA 3KYCB 4L5IA 2JRTA 2WY7Q 1F36A 2CSOA 3C2HA 5FFXA 3EUHC 3LA3A 2HDDA 2HOEA 1F5TA 2Y48A 3ISPA 2P5KA 2ZNYA 4IKFA 2DA1A 2M45A 2VN2A 1J09A 3TP3A 4XNFA 1STZA 2HXIA 4LLGF 4EMSA 2KDZA 4XM3A 4AD9A 3AG2H 2FOWA 1F4KA 1OLTA 2GOMA 2LP0A 4E7SA 3H9JA 4A0YA 2M87A 1R4MB 2F48A 3ZQLA 3S3MA 2A3SA 3TP0A 3OMYA 4Z6YA 2COMA 4BEHA 2IGMA 1RETA 4UV9A 5FGMA 3OOUA 1I50J 3RQIA 1FPQA 2DODA 1T33A 4FCYA 3RJPA 1ZG1A 1VQMI 1AA7A 2RQPA 5B3SH 2P0WA 1CGPA 2JSCA 4WX9A 1SFEA 2YUSA 5FKKA 4KNYA 4IHXA 4E7ZA 4C3HJ 4J01A 1MMDA 4CDGA 1QQIA 1XG1A 2H8WA 3MN2A 4NC8A 3A03A 4BE1A 1YW9A 2CRGA 3L2VA 3IP4B 2M0MA 3WHBA 3K4LA 2XAGA 4A3DJ 3T5XA 2XSJC 2Z5UA 2XB0X 1HSJA 1W7PA 3VB2A 2MG4A 2IEKA 3WE3A 2GQQA 1P4WA 1D8KA 4M9SA 3KYLA 3GUDA 1G2HA 2JMWA 2GA1A 4LB6B 4E4HA 3BG9A 2A6TA 2LC2A 4XKVA 5CVVA 5HLHA 2E34A 2IS4A 1J7KA 1R23A 3TL4X 5K7ZA 3CQZJ 5CPRB 1ZRCA 2HDWA 2KPMA 5C4JJ 4NDLA 3PQJA 4Y15A 4DZJA 5ERIA 1F43A 4LK0F 4TV7A 3VSLA 2M8GX 3G6EI 3WTUC 3F8CA 3CMEI 3WU1B 1IXSB 2CUJA 2QKMB 3L2QA 4OAZA 1S7OA 4EJOA 2EK5A 2OAZA 2R7RA 3K7AJ 3IL2A 3EYIA 2IGKA 1HQCA 3FBNB 3Q0VA 1TT0A 4V2FA 1LVKA 1OCOH 1R6RA 2W1OA 5LHGA 4FETA 3ZQCA 3WTZA 1MMSA 4MO7A 1ETVA 2M4KA 1BM9A 1N25A 3BR0A 4RB0A 4QIWN 3MFKA 1IG7A 4UVBA 1S9HA 2JRMA 2DMUA 2X4HA 2XGDA 2LF7A 5FKLA 1JKRC 2YR2A 2XRNA 5FLMJ 1B8IB 5D8LB 2WB1N 3TKYA 2HFHA 4U0YA 3DQVC 1T39A 1ZR2A 2W24A 1Y39A 2Z9OA 4A3GJ 1IDZA 2X51A 4RM2A 5B66C 1BR1A 3VPRA 2LR8A 2MSYA 3FXRA 4HEA2 4I09A 4IEJA 3SZPA 2LK2A 3DPUA 3JRCA 4QTRA 2EILH 1RNLA 5D5WB 1RC9A 2MGQA 5CVIA 1AHDP 3HRTA 3L7WA 1WJDA 5K5QA 5AIQA 4BXXJ 5JVTA 2R7UA 1AOYA 5DD8A 5FD5A 3GZ6A 2XHKA 2UXNA 4KDPA 1BN5A 2OJED 2DFEA 2LBFB 1JGGA 3MAJA 4LIUA 1WZ2A 2QQBA 4DW6A 4A3EJ 5JR3A 3K4BA 3S14J 2QENA 1ETOA 2EZHA 2E2HJ 1BL0A 2KDOA 1WVRA 4XN3A 1A35A 2BXZA 3VOEA 3JAMK 2VOPA 4E7IA 2DA5A 4W97A 3L1PA 1HKQA 3S93A 4FHTA 2ZXIA 3T0YA 2QKLB 3CCYA 2DK5A 3MWMA 3LQQA 3K4MA 2FQ3A 2WADA 4CGZA 5LRRA 1IO2A 1OKRA 2DMQA 2LKPA 1MJ9A 4XLHA 1D8JA 4ZYDA 3E97A 1BJAA 2BY3A 1JKPC 3ZOBA 5LEKA 4CHUA 4I01A 3Q0UA 3VFZA 1X3UA 2OC6A 3EUHA 1Q1VA 5J40A 2BY0A 4LK1F 1TC3C 2STTA 3ZMTA 2HWVA 2DDAA 1TWAJ 1AU7A 2LRDA 3ZGKA 5IP7J 5BNGA 2WWYA 1Y0UA 3OYEA 3LSTA 3MCZA 4PDKA 4ESBA 3HIFA 2BVMA 1R36A 5AIPA 3OYDA 3BR3A 2RAEA 1FBSA 3H3ZA 4XRMA 3QAHA 2CFOA 2V9KA 5H2FC 2K3FA 3JRFA 4E7LA 4A3MJ 5EDNA 4U87A 4IL6C 4BXFA 3VYSB 2CQNA 2IA0A 2E35A 2MD0A 3ECHA 4C2UA 1LNWA 2OQRA 4F91B 3QQAA 3F8FA 4EM0B 2NVXJ 2DI3A 4QPQA 3J7ZI 3RZOJ 5IYBJ 1YOVB 1S29A 5HLIA 3L00A 1YW7A 3IWZA 4YRVA 1RI7A 4EATA 2K9QA 2R7QA 1K78B 1IRZA 4PJLA 3CMAI 4A3KJ 3HTUA 5IYDJ 5IT9K 3PO3J 4IHVA 1R1UA 3ABTA 1BC8C 4FTHA 1LQ1A 3M1EA 1L0OC 5KCMA 4ETSA 1ZHFA 4G7HF 1MW7A 1B9NA 1KONA 2GWRA 4NBQA 2ZC2A 3ERMA 2CS3A 3G4SI 1MSEC 4F52A 2RGVA 3W6VA 4AC0A 2KHMA 3E5QA 2VL8A 1HBXG 4MFEA 2EFQA 1JXSA 1KU2A 5CJ9A 3BJ6A 5M5XJ 2YX4A 4BY7J 4JBAA 3J80K 4ENJA 2MH9A 3RPUA 2WV1A 3BDDA 3OWTA 1H89C 4UY8I 2PG4A 1I6XA 3PFIA 2Y31A 3VWBA 2E1NA 2FQ4A 2OV7A 2HYJA 5JHFA 4RDUA 3HUGB 3BR6A 2BGCA 3CP8A 4M6XA 5HOOA 2F4MB 4BQQA 1XD7A 3GTOJ 4HNUA 3TW6A 2L4MA 3RI4A 3J7AO 5IOZA 3DCFA 1VNDA 1ITYA 3TO6A
chains in the Genus database with same CATH topology
2CQXA 1JUPA 4B4CA 3M4OJ 4DZPA 3GBGA 2XPUA 4UUTA 5C44J 2DJNA 3JRAA 1D5YA 2W48A 2CUEA 2L7ZA 3HM5A 4X1EA 5FKNA 1SFOJ 3HOWJ 9ANTA 2R93J 1TWGJ 1FTTA 3G1OA 2PMZN 4LOCA 4XRSA 1RKWA 2JA7J 5GP9A 4B3AA 4XICA 5C4XJ 4C3JJ 3S15J 2E19A 3GTKJ 2VPRA 3I4MJ 1GV5A 2M9HA 4AYBN 2HOTA 1X58A 3PM1A 4BBSJ 3G1LA 4D5CA 3LSPA 1R9TJ 1NK2P 4XIDA 1YRNB 2VKEA 4V2GA 3A01B 1CQTA 3F0CA 2EZLA 2K9SA 3GTQJ 1ENHA 3Q0WA 3PO2J 2ECCA 3S2DJ 1JTXA 1TWCJ 5J1RA 3BTCA 3GTPJ 3HOUJ 2NVTJ 1A5JA 5IOYA 1U9NA 3MVPA 4DYQA 3RKQA 1PUFB 2DN0A 2COBA 3HOXJ 1K83J 2XSDC 3CMYA 2L0KA 5EEAA 3S1RJ 1Z0XA 5M5WJ 1APLC 1X2MA 2JWTA 4UUSA 2ME6A 2OPTA 5EF6A 1TWFJ 4JP0A 1IDYA 4A3IJ 3IH2A 2L9RA 1UG2A 1W0UA 1E3OC 1HCRA 3LOCA 2JN6A 1U8BA 3M3YJ 1WH7A 4M3EA 4I6ZA 2DMTA 2WAQN 1I6HJ 2GBYA 3HDDA 3I4NJ 1Z77A 4FE4A 1RESA 3LNQA 1IC8A 2XGCA 1ZGWA 1ORKA 1JUMA 3S1NJ 1U78A 1GVDA 2EZKA 2DTZA 1I3QJ 5EZHA 1WI3A 2QF7A 3HKZN 2R5YB 4C2MJ 2CUFA 2ME0A 2HI3A 4D7NA 1JUSA 2VKVA 4BBRJ 5GPCA 3GTJJ 2NVYJ 4Y7NJ 3A01A 4D5FA 2XGEA 4MFDA 3ZQGA 4AUXA 4A3JJ 3IH4A 1UHSA 2M0CA 3ZQIA 2VUMJ 1ETWA 1Y1VJ 1FEXA 5C3EJ 1FJLA 5IP9J 1MNMC 3S17J 3OSFA 5F04A 4C3IJ 5F0CA 3HGYA 1RKTA 2FJ1A 5M5YJ 4MLOA 3FK6A 1JT0A 3GTMJ 3E7LA 3S2HJ 2JJ7A 2O8KA 5EGOA 2NVQJ 1MBKA 3B6AA 1ZTRA 2YS9A 2HOAA 5FKMA 1K61A 3NAUA 3FISA 4XK4A 2P81A 3H3VK 2R5ZA 5EGOB 3HEFA 3OSGA 2E2JJ 4XRSG 2QCOA 3JRHA 1ETYA 1VF9A 4JYKA 2EBIA 3BTIA 3UKGA 3DEWA 4A3LJ 2K40A 3H0GJ 2L7MP 4MIMA 3ZQFA 1H88C 4ABZA 2DMNA 3TEDA 4DYCA 3JRGA 4IHWA 4CYCB 2D5VA 2M2EA 1GDTA 2R0QC 4GFBA 2LLKA 5FJ8J 1XS9A 2DA7A 3HOYJ 4X6AJ 2DA6A 3FK7A 3WHCA 5GPAA 1F36A 3BTLA 1JTYA 1ZKGA 2IBDA 3HOVJ 1T56A 2R5YA 4M3FA 2HDDA 2LVSA 2K9NA 3HBLA 4JX4A 2DA1A 3TP3A 2HXIA 2KDZA 2XRLA 1ETXA 2O7OA 2HOSA 2LP0A 2DA4A 1HLVA 3A02A 2X6OA 4BKXA 3ZQLA 4L5EA 1MSFC 3TP0A 5JLXA 1VI0A 1RETA 2EQRA 3OOUA 1I50J 4BY1J 3RQIA 2LY9A 5EG0A 1T33A 2NOGA 4FCYA 3BR2A 2M34A 1MBGA 4Y52J 2YUSA 5FKKA 1WGXA 4A93J 1BW6A 2LTPA 1BJZA 4IHXA 5DTDA 4C3HJ 2LKXA 2OF7A 4EEFG 3IV5A 4I76A 3TW7A 1XG1A 1HF0A 3MN2A 3A03A 4M3DA 1LE8A 2CRGA 3WHBA 5F0FA 4A3DJ 3JRBA 3S1MJ 2XB0X 5F1JA 1POGA 2MG4A 2IEKA 3NARA 2L7FP 1G2HA 3D1NI 2JMWA 3BG9A 3BQYA 1BA5A 3RZDJ 1A6IA 5K7ZA 1JKOC 3CQZJ 1QVTA 5C4JJ 4NDLA 2ID6A 1UMQA 2AO9A 4DZJA 4J19A 1F43A 3JRDA 2Y30A 4FE7A 2M8GX 1OCTC 1FIPA 1MBHA 1IJWC 1DU0A 5J1UA 2ID3A 1FIAA 2O9LA 2EH3A 3K7AJ 3FKIJ 4JX5A 2KT0A 5FLVA 3Q0VA 4V2FA 2YU9J 3JREA 3ZQCA 3S16J 4RBOA 5IP6A 5J3LA 3HGGA 4MO7A 1ETVA 2R92J 2VI6A 2HXOA 3QPLA 5K7HA 3BR0A 4QIWN 2B63J 4HNVA 1VFCA 1IG7A 3B6CA 1HOMA 1QRYA 2DMUA 3O8HA 2XGDA 5FKLA 2AHQA 1JKRC 1LFUP 1B8IB 5FLMJ 3GTLJ 2WB1N 4D7MA 5DS9A 3SFIA 1ZR2A 1B72A 3OIOA 4A3GJ 1IDZA 5E3OA 3VPRA 2LR8A 2MSYA 5E3MA 4IEJA 2LK2A 3JRCA 1GT0C 1X2NA 4QTRA 2MGQA 1AHDP 2GLOA 3JRIA 1WPKA 2JK3A 1S7EA 4BXXJ 1MH3A 2N8GA 1OFCX 2LD5A 1JJ6C 2CU7A 1ZK8A 1JGGA 4W1UA 4DW6A 1ETQA 2ELKA 4A3EJ 1RPWA 3S14J 2TCTA 4M3GA 2XB5A 1ETOA 2EZHA 2E2HJ 1BL0A 1Y1WJ 1AKHB 2JA5J 1O4XA 2Y2ZA 2R7ZJ 4A3CJ 1FTZA 1IUFA 2DA5A 4W97A 2E1OA 1RR7A 1NTCA 3LSJA 3ZQHA 4DYRA 3L1PA 2IAIA 1XC5A 5EG0B 2EZIA 1DU6A 3CCYA 4QSHA 4CYCA 4A3BJ 3Q3SA 1W0TA 2DMQA 1WH5A 3SDGA 4A69C 2FD5A 1ZQ3P 1SANA 2Y0SN 2NS8A 1JKPC 3ZOBA 1P7IA 2R5ZB 1GUUA 2CQQA 4JX6A 2MW8A 3Q0UA 5IYCJ 4IHYA 1Q1VA 2I10A 1JT6A 2X9DA 3BG5A 4S0HB 1TC3C 3C2BA 3BG3A 3O8GA 1TWAJ 4B1RA 1AU7A 2Y9ZA 2XPVA 2H8RA 1GV2A 4UUSB 5E3LA 5IP7J 2CJJA 5BNGA 1JKQC 3QPSA 5M3MJ 1PUFA 1MBJA 1U9OA 1IGNA 1MH4A 4G12A 3BR3A 5IPAA 2RAEA 2XPWA 1YRNA 4XRMA 3BTJA 1P7JA 1B8IA 3BT9A 2Y9YA 1IV6A 1ETKA 5FKOA 3JRFA 1QVUA 2X48A 4A3MJ 3IH3A 5EDNA 3SJMA 1LE8B 5F0HA 1HDPA 2JA6J 2NS7A 3BR5A 2ZB9A 5HODA 5F08A 1OCPA 1NK3P 3S1QJ 1TWHJ 3QQAA 2DA3A 2NVXJ 3BQZA 3RZOJ 2DA2A 2HQ5A 5IYBJ 2JA8J 3G1MA 2DMPA 1HDDC 3LSGA 1LFBA 1MBFA 2K9QA 3JR9A 2E2IJ 1IRZA 1ZR4A 2GM4A 4A3KJ 5IYDJ 3LSRA 3PO3J 4IHVA 3HB9A 4FTHA 5J1YA 2FX0A 1B72B 5EYRA 2LFBA 1H8AC 1EF4A 1MSEC 2ECBA 1WCMJ 5E3NA 5F27A 4A3FJ 3CDLA 3W6VA 4AC0A 5EZGA 4MFEA 3HOZJ 5M5XJ 4BY7J 3BR1A 3MKLA 4M6VA 1AKHA 2WV1A 4M3BA 3GTGJ 2G0EA 1H89C 1OJLA 1MBEA 3K2AA 2Y31A 1QPIA 2FQ4A 2TRTA 2HYJA 4RDUA 5M3FJ 4FISA 5JLWA 1BW5A 3BR6A 2H1KA 1JJ8C 3FIWA 3GTOJ 5K7FA 3TW6A 5IOZA 3DCFA 1VNDA 1ITYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQX A;  1JUP A;  4B4C A;  3M4O J;  4DZP A;  3GBG A;  2XPU A;  4UUT A;  5C44 J;  2DJN A;  3JRA A;  1D5Y A;  2W48 A;  2CUE A;  2L7Z A;  3HM5 A;  4X1E A;  5FKN A;  1SFO J;  3HOW J;  9ANT A;  2R93 J;  1TWG J;  1FTT A;  3G1O A;  2PMZ N;  4LOC A;  4XRS A;  1RKW A;  2JA7 J;  5GP9 A;  4B3A A;  4XIC A;  5C4X J;  4C3J J;  3S15 J;  2E19 A;  3GTK J;  2VPR A;  3I4M J;  1GV5 A;  2M9H A;  4AYB N;  2HOT A;  1X58 A;  3PM1 A;  4BBS J;  3G1L A;  4D5C A;  3LSP A;  1R9T J;  1NK2 P;  4XID A;  1YRN B;  2VKE A;  4V2G A;  3A01 B;  1CQT A;  3F0C A;  2EZL A;  2K9S A;  3GTQ J;  1ENH A;  3Q0W A;  3PO2 J;  2ECC A;  3S2D J;  1JTX A;  1TWC J;  5J1R A;  3BTC A;  3GTP J;  3HOU J;  2NVT J;  1A5J A;  5IOY A;  1U9N A;  3MVP A;  4DYQ A;  3RKQ A;  1PUF B;  2DN0 A;  2COB A;  3HOX J;  1K83 J;  2XSD C;  3CMY A;  2L0K A;  5EEA A;  3S1R J;  1Z0X A;  5M5W J;  1APL C;  1X2M A;  2JWT A;  4UUS A;  2ME6 A;  2OPT A;  5EF6 A;  1TWF J;  4JP0 A;  1IDY A;  4A3I J;  3IH2 A;  2L9R A;  1UG2 A;  1W0U A;  1E3O C;  1HCR A;  3LOC A;  2JN6 A;  1U8B A;  3M3Y J;  1WH7 A;  4M3E A;  4I6Z A;  2DMT A;  2WAQ N;  1I6H J;  2GBY A;  3HDD A;  3I4N J;  1Z77 A;  4FE4 A;  1RES A;  3LNQ A;  1IC8 A;  2XGC A;  1ZGW A;  1ORK A;  1JUM A;  3S1N J;  1U78 A;  1GVD A;  2EZK A;  2DTZ A;  1I3Q J;  5EZH A;  1WI3 A;  2QF7 A;  3HKZ N;  2R5Y B;  4C2M J;  2CUF A;  2ME0 A;  2HI3 A;  4D7N A;  1JUS A;  2VKV A;  4BBR J;  5GPC A;  3GTJ J;  2NVY J;  4Y7N J;  3A01 A;  4D5F A;  2XGE A;  4MFD A;  3ZQG A;  4AUX A;  4A3J J;  3IH4 A;  1UHS A;  2M0C A;  3ZQI A;  2VUM J;  1ETW A;  1Y1V J;  1FEX A;  5C3E J;  1FJL A;  5IP9 J;  1MNM C;  3S17 J;  3OSF A;  5F04 A;  4C3I J;  5F0C A;  3HGY A;  1RKT A;  2FJ1 A;  5M5Y J;  4MLO A;  3FK6 A;  1JT0 A;  3GTM J;  3E7L A;  3S2H J;  2JJ7 A;  2O8K A;  5EGO A;  2NVQ J;  1MBK A;  3B6A A;  1ZTR A;  2YS9 A;  2HOA A;  5FKM A;  1K61 A;  3NAU A;  3FIS A;  4XK4 A;  2P81 A;  3H3V K;  2R5Z A;  5EGO B;  3HEF A;  3OSG A;  2E2J J;  4XRS G;  2QCO A;  3JRH A;  1ETY A;  1VF9 A;  4JYK A;  2EBI A;  3BTI A;  3UKG A;  3DEW A;  4A3L J;  2K40 A;  3H0G J;  2L7M P;  4MIM A;  3ZQF A;  1H88 C;  4ABZ A;  2DMN A;  3TED A;  4DYC A;  3JRG A;  4IHW A;  4CYC B;  2D5V A;  2M2E A;  1GDT A;  2R0Q C;  4GFB A;  2LLK A;  5FJ8 J;  1XS9 A;  2DA7 A;  3HOY J;  4X6A J;  2DA6 A;  3FK7 A;  3WHC A;  5GPA A;  1F36 A;  3BTL A;  1JTY A;  1ZKG A;  2IBD A;  3HOV J;  1T56 A;  2R5Y A;  4M3F A;  2HDD A;  2LVS A;  2K9N A;  3HBL A;  4JX4 A;  2DA1 A;  3TP3 A;  2HXI A;  2KDZ A;  2XRL A;  1ETX A;  2O7O A;  2HOS A;  2LP0 A;  2DA4 A;  1HLV A;  3A02 A;  2X6O A;  4BKX A;  3ZQL A;  4L5E A;  1MSF C;  3TP0 A;  5JLX A;  1VI0 A;  1RET A;  2EQR A;  3OOU A;  1I50 J;  4BY1 J;  3RQI A;  2LY9 A;  5EG0 A;  1T33 A;  2NOG A;  4FCY A;  3BR2 A;  2M34 A;  1MBG A;  4Y52 J;  2YUS A;  5FKK A;  1WGX A;  4A93 J;  1BW6 A;  2LTP A;  1BJZ A;  4IHX A;  5DTD A;  4C3H J;  2LKX A;  2OF7 A;  4EEF G;  3IV5 A;  4I76 A;  3TW7 A;  1XG1 A;  1HF0 A;  3MN2 A;  3A03 A;  4M3D A;  1LE8 A;  2CRG A;  3WHB A;  5F0F A;  4A3D J;  3JRB A;  3S1M J;  2XB0 X;  5F1J A;  1POG A;  2MG4 A;  2IEK A;  3NAR A;  2L7F P;  1G2H A;  3D1N I;  2JMW A;  3BG9 A;  3BQY A;  1BA5 A;  3RZD J;  1A6I A;  5K7Z A;  1JKO C;  3CQZ J;  1QVT A;  5C4J J;  4NDL A;  2ID6 A;  1UMQ A;  2AO9 A;  4DZJ A;  4J19 A;  1F43 A;  3JRD A;  2Y30 A;  4FE7 A;  2M8G X;  1OCT C;  1FIP A;  1MBH A;  1IJW C;  1DU0 A;  5J1U A;  2ID3 A;  1FIA A;  2O9L A;  2EH3 A;  3K7A J;  3FKI J;  4JX5 A;  2KT0 A;  5FLV A;  3Q0V A;  4V2F A;  2YU9 J;  3JRE A;  3ZQC A;  3S16 J;  4RBO A;  5IP6 A;  5J3L A;  3HGG A;  4MO7 A;  1ETV A;  2R92 J;  2VI6 A;  2HXO A;  3QPL A;  5K7H A;  3BR0 A;  4QIW N;  2B63 J;  4HNV A;  1VFC A;  1IG7 A;  3B6C A;  1HOM A;  1QRY A;  2DMU A;  3O8H A;  2XGD A;  5FKL A;  2AHQ A;  1JKR C;  1LFU P;  1B8I B;  5FLM J;  3GTL J;  2WB1 N;  4D7M A;  5DS9 A;  3SFI A;  1ZR2 A;  1B72 A;  3OIO A;  4A3G J;  1IDZ A;  5E3O A;  3VPR A;  2LR8 A;  2MSY A;  5E3M A;  4IEJ A;  2LK2 A;  3JRC A;  1GT0 C;  1X2N A;  4QTR A;  2MGQ A;  1AHD P;  2GLO A;  3JRI A;  1WPK A;  2JK3 A;  1S7E A;  4BXX J;  1MH3 A;  2N8G A;  1OFC X;  2LD5 A;  1JJ6 C;  2CU7 A;  1ZK8 A;  1JGG A;  4W1U A;  4DW6 A;  1ETQ A;  2ELK A;  4A3E J;  1RPW A;  3S14 J;  2TCT A;  4M3G A;  2XB5 A;  1ETO A;  2EZH A;  2E2H J;  1BL0 A;  1Y1W J;  1AKH B;  2JA5 J;  1O4X A;  2Y2Z A;  2R7Z J;  4A3C J;  1FTZ A;  1IUF A;  2DA5 A;  4W97 A;  2E1O A;  1RR7 A;  1NTC A;  3LSJ A;  3ZQH A;  4DYR A;  3L1P A;  2IAI A;  1XC5 A;  5EG0 B;  2EZI A;  1DU6 A;  3CCY A;  4QSH A;  4CYC A;  4A3B J;  3Q3S A;  1W0T A;  2DMQ A;  1WH5 A;  3SDG A;  4A69 C;  2FD5 A;  1ZQ3 P;  1SAN A;  2Y0S N;  2NS8 A;  1JKP C;  3ZOB A;  1P7I A;  2R5Z B;  1GUU A;  2CQQ A;  4JX6 A;  2MW8 A;  3Q0U A;  5IYC J;  4IHY A;  1Q1V A;  2I10 A;  1JT6 A;  2X9D A;  3BG5 A;  4S0H B;  1TC3 C;  3C2B A;  3BG3 A;  3O8G A;  1TWA J;  4B1R A;  1AU7 A;  2Y9Z A;  2XPV A;  2H8R A;  1GV2 A;  4UUS B;  5E3L A;  5IP7 J;  2CJJ A;  5BNG A;  1JKQ C;  3QPS A;  5M3M J;  1PUF A;  1MBJ A;  1U9O A;  1IGN A;  1MH4 A;  4G12 A;  3BR3 A;  5IPA A;  2RAE A;  2XPW A;  1YRN A;  4XRM A;  3BTJ A;  1P7J A;  1B8I A;  3BT9 A;  2Y9Y A;  1IV6 A;  1ETK A;  5FKO A;  3JRF A;  1QVU A;  2X48 A;  4A3M J;  3IH3 A;  5EDN A;  3SJM A;  1LE8 B;  5F0H A;  1HDP A;  2JA6 J;  2NS7 A;  3BR5 A;  2ZB9 A;  5HOD A;  5F08 A;  1OCP A;  1NK3 P;  3S1Q J;  1TWH J;  3QQA A;  2DA3 A;  2NVX J;  3BQZ A;  3RZO J;  2DA2 A;  2HQ5 A;  5IYB J;  2JA8 J;  3G1M A;  2DMP A;  1HDD C;  3LSG A;  1LFB A;  1MBF A;  2K9Q A;  3JR9 A;  2E2I J;  1IRZ A;  1ZR4 A;  2GM4 A;  4A3K J;  5IYD J;  3LSR A;  3PO3 J;  4IHV A;  3HB9 A;  4FTH A;  5J1Y A;  2FX0 A;  1B72 B;  5EYR A;  2LFB A;  1H8A C;  1EF4 A;  1MSE C;  2ECB A;  1WCM J;  5E3N A;  5F27 A;  4A3F J;  3CDL A;  3W6V A;  4AC0 A;  5EZG A;  4MFE A;  3HOZ J;  5M5X J;  4BY7 J;  3BR1 A;  3MKL A;  4M6V A;  1AKH A;  2WV1 A;  4M3B A;  3GTG J;  2G0E A;  1H89 C;  1OJL A;  1MBE A;  3K2A A;  2Y31 A;  1QPI A;  2FQ4 A;  2TRT A;  2HYJ A;  4RDU A;  5M3F J;  4FIS A;  5JLW A;  1BW5 A;  3BR6 A;  2H1K A;  1JJ8 C;  3FIW A;  3GTO J;  5K7F A;  3TW6 A;  5IOZ A;  3DCF A;  1VND A;  1ITY A; 
#chains in the Genus database with same CATH topology
 2XF5 A;  3GBG A;  2DYR H;  4UUT A;  1UG0 A;  1D5Y A;  2W48 A;  2AQF A;  1M1E B;  3FDY A;  3NRV A;  4BJT A;  2LSO A;  4F93 B;  2L7Z A;  3ZN1 A;  1R1T A;  2UZK A;  3LAJ A;  2HQA A;  9ANT A;  1X1D A;  1EA3 A;  3OS2 A;  2X6W A;  2P7C B;  3JTG A;  1FTT A;  2LH9 A;  4LOC A;  5L3B A;  2R7W A;  2K7L A;  2BE5 F;  5ED4 A;  1OIS A;  3KEO A;  3P9K A;  3OR2 C;  3I4M J;  2FUG 2;  1ZG5 A;  3GLL A;  2IA1 A;  1X58 A;  1FYL A;  2HOT A;  2BOL A;  1I3A A;  3G1L A;  5EEH A;  4D5C A;  3A0H C;  1HKS A;  3E0J B;  3RYR A;  2W7N A;  4ESJ A;  3PNT A;  2PJR B;  2FOK A;  3CCE I;  2VKE A;  1Z6R A;  3A01 B;  3M9A A;  4UUV A;  3F0C A;  4DNC A;  2RNG A;  2K9S A;  1TW3 A;  2VAS A;  3GTQ J;  3Q0W A;  2HTJ A;  1SFK A;  2ECC A;  3SXY A;  1JTX A;  1G59 A;  3BTC A;  1K7A A;  2PJR A;  3HOU J;  2NVT J;  4HQE A;  4X0G A;  3PNY A;  2JPC A;  2DN0 A;  3HOX J;  1VQP I;  1SC7 A;  2OCC H;  3BOQ A;  1K83 J;  4KT5 C;  5KAI C;  2XSD C;  3C2G A;  3DU5 A;  3RPQ A;  3HL2 A;  4L9V A;  3OYN A;  1O57 A;  4I7H A;  1APL C;  2B0L A;  4F55 A;  3KCC A;  4U88 A;  4NHJ A;  2JWT A;  4UUS A;  1S8N A;  3L2W A;  4QPO A;  2Y0M A;  2BV6 A;  2IP2 A;  2V6C A;  4N9H A;  5EF6 A;  3FWE A;  1TWF J;  3FXL A;  4AYB A;  2ELJ A;  4A3I J;  1Y8R B;  2CO5 A;  2DJI A;  2E1M B;  5EEG A;  1IV8 A;  3ASO H;  1SMY F;  2DFF A;  4GYI A;  3BLY A;  3GFL A;  1IAW A;  2WAQ N;  3D5L A;  1I6H J;  3K1M A;  1H9T A;  4LFU A;  1ZGW A;  2Q2E A;  2C6Y A;  1U5T B;  3C7J A;  1TL8 A;  4IVN A;  2F5F A;  1RUO A;  3S1N J;  2NXN B;  5J47 A;  2DTZ A;  3Q9S A;  4Q47 A;  2V1X A;  5HNH A;  3FXU A;  3V4G A;  2Z1D A;  1BI3 A;  4IQ4 A;  2CV2 A;  2CV1 A;  3FKJ A;  1SFX A;  1YE9 A;  2LDU A;  3P7N A;  2HI3 A;  2HPI A;  2VKV A;  3GZ5 A;  3KLO A;  3OIQ A;  3OR1 C;  3GTJ J;  2CW8 A;  5FFZ A;  1ON1 A;  2NVY J;  3CUQ B;  2PJP A;  3JSO A;  3IH4 A;  4PJM A;  2OUM A;  4GDF A;  2W25 A;  3ZQI A;  3I55 I;  4AM3 A;  1QZE A;  4ON0 A;  1A31 A;  5IP9 J;  2GAU A;  2PI0 A;  3OSF A;  5F0C A;  3HGY A;  2EJR A;  5GAD J;  2WAF A;  2AQE A;  1JT0 A;  1Q1H A;  3E7L A;  4U7D A;  1QBJ A;  2KLO A;  3JTH A;  4KYW A;  2B9S A;  2JJ7 A;  1LDJ A;  2YS9 A;  3I53 A;  3L2C A;  1R4N B;  3GWZ A;  5LGT A;  2PFB A;  3SYT A;  2P81 A;  3H3V K;  3CD6 I;  2XKO A;  3HC7 A;  1W1W E;  3RQ4 A;  5KNL A;  5DCM B;  3RDI A;  3CP2 A;  4KIT B;  2Z33 A;  4J00 A;  2E2J J;  4OOI A;  3JRH A;  1ETY A;  1VF9 A;  4AWX B;  4MQ9 F;  2DW4 A;  3AG1 H;  2E1C A;  2QM3 A;  3ZQF A;  3SZT A;  5CQG A;  5K5O A;  2DMN A;  3WTT C;  4CYC B;  1BC7 C;  1FWZ A;  1VQ7 I;  2OCE A;  2P6S A;  3P9C A;  4UVA A;  3E6C C;  2LY1 A;  2NS0 A;  4X6A J;  2DA6 A;  3VOD A;  3OS1 A;  1S3J A;  1ACI A;  3BTL A;  4D1Q A;  4OU0 A;  1JTY A;  4HOB A;  1KQ0 A;  1ZKG A;  4AVZ A;  3ASN H;  3DV8 A;  3TMO A;  2IBD A;  4XSZ F;  2VJ4 A;  1WRJ A;  4YG2 F;  5A2Q K;  3ECO A;  4M3F A;  5FLX K;  3DBL B;  3CCS I;  3E5X A;  1R7J A;  2K9N A;  4JX4 A;  3WE2 A;  3LL7 A;  3VEP A;  3N05 A;  3M07 A;  2MLG A;  1ETX A;  2IGO A;  1ZRE A;  2ZJQ F;  1SD5 A;  1UHW A;  2DA4 A;  5J8F A;  4CYD A;  3V7C A;  5FRN A;  1BOB A;  1BBY A;  2EQR A;  3LFK A;  3ZR8 X;  3KP4 A;  4OWR B;  1MZB A;  1QHG A;  1KA8 A;  2LY9 A;  3F6V A;  2NOG A;  1LJ9 A;  1XGN A;  3BR2 A;  3R6S A;  5EG0 A;  3PIO F;  2VOO A;  4EJU A;  3WTY C;  4HF0 A;  3C18 A;  3V8J A;  2ZBK A;  1BJZ A;  2BBY A;  2Z2S B;  5H6R A;  1XCV A;  2OF7 A;  1I27 A;  3IV5 A;  4LG0 A;  3TW7 A;  2KP6 A;  3HUG A;  4M3D A;  3ZMZ A;  1QO0 D;  3HOS A;  3WTW C;  1TTY A;  2H94 A;  5F0F A;  3RPU D;  3JRB A;  3H5N A;  4I0B A;  3FXJ A;  4MHG A;  2AXT C;  2KZV A;  2L02 A;  3CC2 I;  3IHU A;  3K2Z A;  2OQG A;  1ZAR A;  1D1B A;  3MKW B;  4KIC A;  2BY2 A;  1RUN A;  2KKO A;  2D1H A;  2L5Q A;  3DTE A;  2ZJR F;  1NG7 A;  2D45 A;  2IS6 A;  1I5Z A;  1FT9 A;  1UJ8 A;  4XLN F;  3KP3 A;  1QVT A;  4PUS A;  1J2X A;  3AL0 B;  2OZU A;  3PL8 A;  1ONV A;  1D0Y A;  3JRD A;  4FE7 A;  2K4B A;  4B48 A;  4HW0 A;  1USS A;  3FHZ A;  2QGU A;  4CZC A;  1TQP A;  2W84 A;  1IJW C;  4XOR A;  2XAS A;  1FIA A;  1HW1 A;  3WOD F;  2O9L A;  4YEL A;  3GFJ A;  3S32 A;  1G8X A;  3PSF A;  2WAE A;  5L3F A;  3J7Y J;  4BL0 B;  1NH3 A;  2P8T A;  5HS9 A;  5D4R A;  2DFI A;  3JRE A;  5E20 A;  3S16 J;  4RBO A;  3WU2 C;  2BXY A;  3VSK A;  2CQ7 A;  3DWL E;  3FXK A;  1YLF A;  3HGG A;  1Z9C A;  2IGN A;  2HKX A;  3FBI B;  3DP7 A;  3RYP A;  3DU6 A;  3OYM A;  1S7A A;  4IZZ A;  1FMV A;  1R5G A;  4PSX A;  4HF1 A;  3E6M A;  1FOX A;  3KZI C;  2KQR A;  1J75 A;  2IT0 A;  1O7L A;  1HOM A;  1V5F A;  4RB1 A;  3KP5 A;  1D3Y A;  1VZ0 A;  2LYC A;  1BR4 A;  3VYR B;  2HU9 A;  2M8E A;  2A69 F;  1V54 H;  1R71 A;  4ENM A;  2M7B A;  1D5V A;  5E3O A;  4PZJ A;  2OZ6 A;  1O3Q A;  3K4J A;  2WB1 A;  1L3L A;  1LKX A;  4Y4R A;  1X2N A;  2MH2 A;  2VBZ A;  4RAZ A;  4XKB A;  1BR2 A;  1WPK A;  2P7V B;  5LEJ A;  1MKM A;  1S7E A;  1MH3 A;  2N8G A;  3KIO A;  1IN7 A;  3FMS A;  1X1B A;  1PP7 U;  2XUB A;  2MC4 A;  2CU7 A;  4RGS A;  4UVC A;  3E5U A;  3KP2 A;  4W1U A;  1YFH A;  3E6D A;  3U2R A;  1ETQ A;  2ELK A;  4GXO A;  4C9Y A;  1XGO A;  4M3G A;  2XB5 A;  3E6B A;  1V5G A;  3K4C A;  4BGD A;  1O4X A;  2Y2Z A;  1VQ8 I;  2E60 A;  2O5R A;  1T95 A;  1NHA A;  1IUF A;  2QA4 I;  2E1O A;  2WV0 A;  1NTC A;  4R79 A;  3ZQH A;  5ICE A;  1QZY A;  2IAI A;  4HX4 A;  1XC5 A;  2EZI A;  1IXC A;  2I5U A;  4ZDL A;  3OL3 A;  2GXA A;  2DTR A;  3OOP A;  3CUQ C;  4QSH A;  1MND A;  1I39 A;  2HQR A;  4E6K G;  3BCA A;  5DEQ A;  5ILU A;  2VJI A;  2V79 A;  4A69 C;  1FLI A;  1EKE A;  1NG6 A;  1WJ5 A;  1ZQ3 P;  1SAN A;  1W4M A;  5TJJ A;  4E70 A;  4OIQ F;  4BS9 A;  3H0D A;  4CCO A;  1GUU A;  4II2 A;  2MW8 A;  1FSE A;  4L9N A;  1ZGJ A;  1R00 A;  2CWE A;  3R0J A;  3CJT B;  4XLC A;  2HR3 A;  4XSX F;  3HOT A;  4G7Z F;  2X9D A;  3BG5 A;  5FO5 A;  3WG7 H;  1BIB A;  4Y13 A;  4KFC A;  2X1C A;  2KIQ A;  4M9X A;  2V7F A;  2A61 A;  4YFX F;  2EIM H;  1GV2 A;  3BG6 A;  3BWG A;  4AVP A;  4HSR A;  2EIN H;  2CJJ A;  3H1C A;  3KZY A;  1K6Y A;  3MQ0 A;  3QPS A;  5HNF A;  3G71 I;  3I54 A;  1KQ8 A;  5E1W A;  1X19 A;  2X6Y A;  1P7J A;  1B8I A;  3BT9 A;  1V3F A;  5L3C A;  4WXH A;  2QQ8 A;  2K02 A;  3WGG A;  1IV6 A;  4F7Z A;  4B47 A;  2R7O A;  4RGU A;  3IH3 A;  2K9M A;  1T38 A;  3SJM A;  2QVO A;  1HDP A;  1TZL A;  1WJE A;  2ZB9 A;  1OCP A;  4PK4 A;  4P9U A;  1NK3 P;  4B09 A;  1Y0N A;  3FM5 A;  2NAZ A;  2V4J C;  1G3S A;  4IRH A;  1TNT A;  2HQ5 A;  4PJ0 C;  2Y75 A;  2DMP A;  3HJE A;  1HDD C;  1LFB A;  1SVL A;  1MBF A;  3DPT A;  1XGS A;  2A68 F;  3CCM I;  4KJZ A;  1OR7 C;  1VQ4 I;  1ZR4 A;  3LQR A;  1T08 B;  4NNJ A;  5E1Z B;  1FSH A;  3F8M A;  3DTK A;  5DCM A;  1W5T A;  1EH6 A;  2FRH A;  3DF8 A;  2PMU A;  2KIS A;  4ZC3 A;  5ILV A;  2QYO A;  5DDG A;  1EF4 A;  3FM3 A;  3RKX A;  4IPA A;  4AID A;  3EDP A;  2I8D A;  5F27 A;  1QHH D;  3CDL A;  4DOZ A;  2W4S A;  5D4S A;  1XB4 A;  3FMR A;  4O3M A;  4ZDP A;  4D9J A;  1DGR M;  2KJC A;  1LDD A;  2A5W A;  1VQL I;  1AKH A;  4M3B A;  1VQ6 I;  3HG9 A;  1OJL A;  1IRF A;  4B44 A;  3N4M A;  3K2A A;  4ZZL A;  4S04 A;  1FYM A;  2TRT A;  4U7B A;  1Z1D A;  4FIS A;  5JLW A;  4EM1 A;  5E8G A;  3W6J B;  2EPF A;  4GGG A;  3NWT A;  4IX7 A;  3JSP A;  4XN0 A;  1JJ8 C;  4G6Q A;  4BAY A;  4L0Z B;  5K7F A;  5HVQ C;  2F2E A;  5DYM A;  2IS1 A;  2EIJ H;  5BS6 A;  1JUP A;  3V8K A;  4ANJ A;  3JRA A;  2DJN A;  4QWQ A;  1IRG A;  1T8I A;  4KIS A;  2DYS H;  4CO8 A;  3QWL A;  2L54 A;  4LB5 A;  3GYH X;  4X1E A;  3GME A;  5FKN A;  3VDX A;  4EGY A;  4KMF A;  1KYZ A;  4FQG A;  3HOW J;  1R22 A;  3S3O A;  4RM3 A;  4EV0 A;  2QBY B;  2MFZ A;  2LMD A;  3NQO A;  3O3K A;  1YHQ I;  3EQL F;  2V1U A;  1B6A A;  4XRS A;  4ZH4 F;  1JGS A;  4B3A A;  2V1D A;  3QOD A;  3PIP F;  1W36 D;  1P2F A;  2UUZ A;  4HDV A;  3L2R A;  3GTK J;  1BI1 A;  4BHP A;  4AYB N;  3PM1 A;  2ZJP F;  4P1W A;  4BBS J;  3FZV A;  3LFU A;  3LA7 A;  4L0Y B;  4FX0 A;  4V2G A;  4CCJ A;  1CQT A;  1YRN B;  1DP3 A;  3QU3 A;  4RLQ A;  4FX4 A;  2QSF X;  4LMY A;  2Z16 A;  3BJA A;  2OA4 A;  1A5J A;  2EWN A;  3CUO A;  2COB A;  1UST A;  1G3W A;  3KZZ A;  4I99 C;  3F6O A;  3JW4 A;  3CC7 I;  2HVS A;  2RVC A;  1Z0X A;  1SVO A;  1UHM A;  4LD5 A;  2XAQ A;  4RMN A;  3PUB A;  1XPX A;  3V8L A;  5K5R A;  5CKT A;  2IXS A;  1ODD A;  3BPX A;  2OPT A;  1N75 A;  1QPM A;  1PJR A;  3IH2 A;  5JHU A;  1E3O C;  3WTV C;  3S2W A;  3HZJ A;  4WCG A;  1MGT A;  4U0V A;  2NOJ B;  1U8B A;  2LG4 A;  4I6Z A;  3CO7 C;  3ZP5 A;  3ZMU A;  2DMT A;  3CUQ A;  2ZFW A;  1D0Z A;  1Z77 A;  3K10 A;  2K9L A;  3UR3 C;  1WJB A;  3W2W A;  1WJF A;  2XGC A;  3MZ8 A;  4R8H A;  1G3Y A;  2EV5 A;  1JUM A;  1U78 A;  4NUB A;  1TNS A;  2EZK A;  3HSE A;  4P55 A;  3MZY A;  3TQN A;  5BQT A;  1WI3 A;  2QF7 A;  3ROU A;  3HKZ N;  5GAE J;  2Q2E B;  2ZCW A;  4BBR J;  5GPC A;  5H6Q A;  3HSR A;  2KL4 A;  1X3Z B;  2XGE A;  4AUX A;  2A6H F;  2K27 A;  1MMG A;  1UHS A;  2M0C A;  1XMX A;  1O3T A;  2FBI A;  2H1L A;  1ETW A;  2VUM J;  1W7P B;  1Y1V J;  3OYC A;  4EGZ A;  1FEX A;  1LVA A;  1FJL A;  4NB5 A;  1I1S A;  2ESN A;  5DV5 A;  5GAH J;  5F04 A;  4MLO A;  4P9F A;  3GFI A;  1FMW A;  3EUA A;  1A6Q A;  3HHG A;  2QQ9 A;  3S2H J;  4BQN A;  2HYG D;  2XV4 S;  3IAS 2;  2NVQ J;  2J5P A;  1MBK A;  3B6A A;  4XBF A;  2HOA A;  2JTV A;  1W5C C;  1YIO A;  3GLX A;  5KAF C;  3K1P A;  3NAU A;  4XK4 A;  4YIR X;  3CTA A;  1HW2 A;  2QZ8 A;  4MQV A;  1D0X A;  1IRX A;  2MYS A;  2H09 A;  1H9G A;  4OIO F;  5EGO B;  3HEF A;  4XRS G;  1OYW A;  2O8X A;  4JYK A;  3I4P A;  3HTS B;  2EBI A;  4YFK F;  3M1C A;  1P6R A;  3DEW A;  5LBQ A;  1OYI A;  4MIM A;  1BOA A;  1YW8 A;  1T0F A;  3MKY B;  4DQ2 A;  1H88 C;  4Y3O A;  1HC8 A;  2Q0O A;  5L3E A;  1FOW A;  3W2V A;  4DBQ A;  3B73 A;  1U8R A;  5CVJ A;  5GAG J;  3VYT B;  5FJ8 J;  4GFB A;  3LMM A;  3S8P A;  1OR7 A;  2DA7 A;  3B02 A;  4CCM A;  1XS9 A;  4IJA A;  1SVM A;  5GPA A;  3WHC A;  1CF7 B;  1MJB A;  4M71 A;  1SD6 A;  2NYX A;  2JQ7 A;  4CCL A;  2FA5 A;  1U5T A;  3KYD B;  3LSM A;  3K0L A;  2OTJ I;  3KX2 A;  2R5Y A;  4B8X A;  3GXO A;  1KZH A;  2LVS A;  2X1E A;  2E36 A;  2FXA A;  3F3X A;  4PJN A;  4G6T B;  4FAS D;  2PMH A;  2XRL A;  1P4X A;  3ZCO A;  2O7O A;  2XDV A;  2V6E A;  4BE0 A;  2HOS A;  3GZN B;  2ZXJ A;  2P4W A;  1RZ4 A;  5AON A;  2QSH X;  1YTY A;  3A02 A;  1JHF A;  1WI9 A;  1OYY A;  1DUX C;  3CF2 A;  4XLE A;  2F5D A;  1VI0 A;  5HDK A;  1T98 A;  3BJO A;  3MEX A;  2XF7 A;  1WJA A;  4YIF A;  1FP1 D;  4MEX F;  1FBU A;  4BY1 J;  3COA C;  2E7W A;  1MBG A;  3R61 A;  2KRF A;  2BEO A;  1OQY A;  1WGX A;  4A93 J;  2LTP A;  4YEJ A;  2HZD A;  2QLZ A;  4EEF G;  2KIF A;  1W7P D;  2HTS A;  2CUZ A;  4I76 A;  5JVG F;  5ICC A;  2ACJ A;  1HF0 A;  3ABL H;  4HNT A;  1LE8 A;  2VXD A;  3RSN A;  1R58 A;  1W5S A;  2XGX A;  3ZXS A;  3S1M J;  1Z3Y A;  4XON A;  2W82 A;  1X1P A;  2ESH A;  3NAR A;  2Z3Y A;  3AG4 H;  1E2X A;  2HZT A;  3K1N A;  4M6Y A;  1DGW Y;  5IT9 Z;  2L7F P;  1J59 A;  2CW0 F;  4RLF A;  1A36 A;  4OIR F;  4GRI A;  2EV6 A;  2NVU B;  3RZD J;  1HW5 A;  1DPU A;  3QPH A;  1QA6 A;  4WK8 F;  4G9Y A;  3WU0 A;  1T0F C;  2NRA C;  2AO9 A;  4BEH B;  4WXD A;  4J19 A;  1J0R A;  2Y30 A;  4KN4 X;  5FRM A;  1OCT C;  3L09 A;  1J5Y A;  1FIP A;  4O5V A;  1PUE E;  4P5O A;  1XSV A;  1MBH A;  2MBF A;  3LSI A;  5J1U A;  4A5N A;  3S3N A;  3FKI J;  4XKW A;  1X4P A;  3I3L A;  1FOK A;  2KT0 A;  3KEY A;  5FRO A;  3J80 Z;  2A5Y B;  2DFH A;  4KIF A;  4ZDO A;  5IP6 A;  3HPG A;  3BPV A;  5J3L A;  1ULY A;  2LF8 A;  3IAM 2;  2P5L C;  2V9V A;  2M1B A;  3LSH A;  4HLY A;  2HXO A;  2K5C A;  3QPL A;  5K7H A;  4BNC A;  3I0T A;  2XC7 A;  1LPQ A;  2B63 J;  4A6D A;  3OYA A;  2FSW A;  4YII A;  2L3D A;  1QRY A;  3O8H A;  3ONQ A;  5CYV A;  1SMT A;  2ZKZ A;  4WWC A;  1B1B A;  3G3Z A;  4BHB A;  1O7F A;  3VYU B;  1KU3 A;  4G8X A;  4AIH A;  5HS7 A;  4D7M A;  4XLP F;  2H27 A;  2JSP A;  3ZMD A;  1KQ9 A;  3TDZ C;  1P9Q C;  2OD5 A;  1FNN A;  4HF2 A;  1UEL B;  1Z21 A;  5D8K B;  2VT3 A;  1GT0 C;  2QUF A;  2ZO4 A;  1OCR H;  2F5E A;  4JOM A;  2GLO A;  4CSW A;  1TP4 A;  2DXI A;  2PLY A;  5J8C A;  4KIB A;  4IOC F;  3EET A;  4XMY A;  3GCM A;  3SEZ A;  5LHI A;  4HG2 A;  4LJZ F;  4CCK A;  2ZJ2 A;  1JJ6 C;  4A0X A;  4A12 A;  3P9I A;  2RKH A;  3CCR I;  2DO7 A;  3TO9 A;  1IZ1 A;  1IF1 A;  3CF5 F;  3AAF A;  1FBQ A;  1P92 A;  1TBX A;  2VQC A;  1SAX A;  1RPW A;  4II3 A;  1TQI A;  1PP8 F;  1AKH B;  2JA5 J;  1UB9 A;  2LBF A;  3DFG A;  2R7Z J;  2HYF A;  3SQN A;  2KZG A;  2Y69 H;  4DYR A;  4IO9 F;  1RR7 A;  1O3R A;  5J6X A;  1GXQ A;  3CCU I;  4E7J A;  5EG0 B;  2HQN A;  5IT3 A;  3QRF F;  2F5C A;  5B5E C;  2KIM A;  1V5E A;  3TOB A;  4CYC A;  1W0T A;  1WH5 A;  3E1S A;  2VKD A;  5E1X A;  2L9V A;  2FD5 A;  5BPD A;  2FMY A;  2CYY A;  2R4G A;  2VC0 A;  3ZMV A;  2Q1Z B;  4Z2Y A;  2R7D A;  1YYV A;  1DP7 P;  4IHY A;  2ISZ A;  3OY9 A;  3C2B A;  4B43 A;  2DPD A;  2K4J A;  5B1B H;  3W6K B;  2UWM A;  2H8R A;  1K4T A;  4UUS B;  5E3L A;  2O0Y A;  5FLX Z;  1JE8 A;  4BDY A;  3R0A A;  2GA2 A;  2L01 A;  5IY5 H;  4HX7 A;  1JKQ C;  1OMI A;  3OYB A;  4HDU A;  2UXX A;  2L7K A;  1U9O A;  2CH0 A;  5BPI A;  2XPW A;  4Y33 A;  5DUI A;  2VBW A;  3CDI A;  4A5M A;  4UNO A;  3D5S C;  3CCL I;  2WA0 A;  2RC4 A;  1DQU A;  2X48 A;  2E5N A;  2AS5 F;  4D0P A;  5F0H A;  4JK1 X;  3HPH A;  2O6G E;  2NS7 A;  3BR5 A;  2JA6 J;  5F08 A;  3K4N A;  3H5R A;  5HDG A;  4XLF A;  3CES A;  3ML6 A;  2Q8K A;  2VE9 A;  2DA3 A;  1UZC A;  4NQW A;  2VIX A;  3BQZ A;  4XOT A;  4BYY A;  3F23 A;  2LOO A;  3PUF A;  3KE2 A;  1ZGA A;  2YX7 A;  2DU9 A;  2HKO A;  2GZW A;  3OYF A;  1YJ9 I;  2VPL A;  3JR9 A;  3J81 Z;  3F8N A;  2AXL A;  3TBI A;  3REO A;  3LSR A;  4BU2 A;  5TRD A;  2CMP A;  1J9I A;  1MIJ A;  3DBH B;  5LD2 C;  4MNU A;  4BJ6 C;  4F92 B;  5EYR A;  1YI2 I;  2LFB A;  3F8B A;  1WCM J;  4LGW A;  3X2Q H;  5E3N A;  3ZPL A;  2MAB A;  1O3S A;  2F5V A;  3TO7 A;  3ZMS A;  2HDC A;  4L9J A;  4UB8 C;  2E71 A;  4V19 K;  4YFN F;  2ZFU A;  1QU3 A;  2R7X A;  2Z99 A;  1YO5 C;  1YS7 A;  3WG9 A;  3HOZ J;  2CFX A;  5EJC A;  2YSR A;  1XMK A;  2UV1 A;  3BR1 A;  2D1V A;  3OYG A;  2KRC A;  2DOF A;  3GO5 A;  3H36 A;  4CXF A;  1MBE A;  1EH7 A;  1GHC A;  2DDB A;  3CLO A;  4DGW B;  3DEE A;  3GFM A;  2L4A A;  1VQN I;  1ZRD A;  3BZ6 A;  2H1K A;  2F6C A;  2WAQ A;  3FIW A;  2F4I A;  2OU2 A;  4GO1 A;  2A05 A;  3OYL A;  3DLA A;  2VQL A;  4H4K C;  3I56 I;  2CQX A;  3I59 A;  3M4O J;  2JT1 A;  4DZP A;  4ZYH A;  2FU4 A;  4EJW A;  2CUE A;  3HM5 A;  4HRI A;  4G7O F;  2KMU A;  1TWG J;  3MMY B;  3G1O A;  1G4D A;  3RCO A;  5E17 F;  3O2P E;  3OYH A;  4S05 A;  1RKW A;  1ZN2 A;  2JA7 J;  2HS5 A;  5C4X J;  1ZG3 A;  3FF5 A;  4C3J J;  4IHT A;  2QEX I;  1B4A A;  2E7X A;  2E19 A;  2K86 A;  4RB2 C;  3S15 J;  2MC3 A;  2FF4 A;  2M9H A;  1K6O A;  4ZTF A;  3LSK A;  3TGN A;  3WTS C;  4GYG A;  3LSP A;  1R9T J;  1NK2 P;  4XID A;  2W57 A;  3U21 A;  1U6G A;  1TQM A;  1XMA A;  4WF2 A;  2DLL A;  2EZL A;  1P4A A;  2M3A A;  3D0S A;  3PFY A;  1BI0 A;  5KK1 A;  1ENH A;  1K4S A;  2GXB A;  3PO2 J;  2V9P A;  3S2D J;  4E7K A;  5J1R A;  4K2E A;  5KVR A;  2O03 A;  2HPM A;  3GTP J;  3NEU A;  2VLA A;  3DTI A;  5IOY A;  3BCB A;  3MVP A;  4DYQ A;  1PUF B;  1X3W B;  4U0W A;  2VON A;  4AU7 A;  4LLL A;  2HVR A;  4P96 A;  3CMY A;  2EFN A;  2L0K A;  5EEA A;  4E7H A;  3CCV I;  4HA8 A;  1R5H A;  5M5W J;  2IPQ X;  3BZK A;  3JAM Z;  2K85 A;  3W3C A;  2P6T A;  1FZP B;  1X2M A;  3J81 K;  1Z91 A;  5E79 C;  4XRF A;  4ENN A;  3IKT A;  3FHN A;  3MZH A;  1PVE A;  3KP6 A;  4JP0 A;  2L9R A;  3U9G A;  4UB6 C;  4I2O A;  1B9M A;  2DQL A;  4BQO A;  4Q48 A;  1Y8Q B;  4PGH A;  3K69 A;  3K70 C;  4Y17 A;  3V42 A;  4DJA A;  3T8T A;  1D1A A;  1SFU A;  1KYW A;  2B7E A;  3HDD A;  3AG3 H;  3PQK A;  1RES A;  3KEQ A;  4FE4 A;  2V26 A;  4KIG A;  4WXC A;  1H0M A;  4BE2 A;  4A2U A;  4RAY A;  3AL0 C;  1X4O A;  2MA3 A;  1GVD A;  5K1Y A;  3R4K A;  1I1G A;  2FE3 A;  1AWC A;  1Z7L A;  5EZH A;  3FMQ A;  4GCV A;  2R5Y B;  2LNB A;  2DCE A;  2XAU A;  2JVG A;  5A2Q Z;  1VQ9 I;  1XSX A;  2RV8 A;  5D6E A;  2BHY A;  2CUF A;  2ME0 A;  1D1C A;  2GOX B;  1XTA A;  5JI6 A;  3TDU C;  1W36 C;  4HV6 A;  4KUM A;  4D5F A;  2XF6 A;  3H35 A;  3K6G A;  4MFD A;  3ZQG A;  2KJB A;  4A3J J;  1X1A A;  2K3P A;  2KFD A;  3CCQ I;  2JUG A;  3DXJ F;  5C3E J;  1G3T A;  3S17 J;  5D5X B;  3CJR B;  3CCJ I;  2KIU A;  1RKT A;  2FJ1 A;  3JCU C;  5D6F A;  3GTM J;  4HZF A;  3M7G A;  2W00 A;  3ZRG A;  3ULQ B;  4M74 A;  4HX8 A;  5EGO A;  2O8K A;  1RR8 C;  2QBY A;  4EJV A;  4BJ5 C;  4LIV A;  1HA8 A;  2H6C A;  2R5Z A;  1MJA A;  1XX5 A;  1KGS A;  3QOE A;  2E1M C;  2XAF A;  2D2W A;  2QCO A;  5ICF A;  3ABU A;  3RKY A;  1RIO H;  1KU9 A;  1WSU A;  2WY8 Q;  2VB6 A;  3T8R A;  2K40 A;  3H0G J;  2L7M P;  3U1D A;  3PJR A;  2VC1 A;  4ABZ A;  3MKZ A;  1UFM A;  2IA2 A;  4DYC A;  5F1R A;  3JRG A;  4IHW A;  2D5V A;  2M2E A;  1LEA A;  2GIV A;  1GDT A;  2R0Q C;  3CDH A;  2R7V A;  2H6B A;  2IVM A;  3BY6 A;  1WQ2 A;  1E3P A;  3C3W A;  3F9K A;  3FK7 A;  3CZ6 A;  3OL4 A;  4HBL A;  3K70 D;  4KA4 A;  5L3D A;  1FX7 A;  3OYI A;  3N97 A;  5LGN A;  2DAO A;  2L2O A;  1VQO I;  2ELH A;  2LY2 A;  3RTR A;  3HOV J;  2BYV E;  1T56 A;  5E18 F;  2FEZ A;  3HBL A;  4LIT A;  2RQQ A;  1WJC A;  2PBI A;  1V55 H;  2OTL I;  2X6X A;  1OPC A;  1VQ5 I;  3ERE D;  4HPQ A;  1FOY A;  3IC7 A;  1MDM A;  4L9T A;  1HLV A;  3HKZ A;  5TIS C;  2X6O A;  2DK8 A;  4BKX A;  4L5E A;  3V7R A;  1MSF C;  5JLX A;  3HXL A;  1QNT A;  2CGP A;  3QPT A;  2L9S A;  4H0E A;  1VQK I;  1MNE A;  2IRF G;  2YU3 A;  2M34 A;  4M9Z A;  1GVJ A;  1PDN C;  3ABK H;  4KT6 A;  4Y52 J;  5CVR A;  4DIQ A;  3QYF A;  2G7U A;  1SD7 A;  1XGM A;  1UCR A;  1KU7 A;  1BW6 A;  4HQM A;  4NQW B;  1X1C A;  5DTD A;  3C1D A;  3IWF A;  2LKX A;  2STW A;  2LRE A;  4XOP A;  3M8E A;  1IN4 A;  5CVU A;  4RB3 C;  4I98 B;  2IS2 A;  3M8F A;  3ZN0 A;  4RAG A;  3AFH A;  4G6D A;  1ZYR F;  4MGR A;  5F1J A;  1POG A;  4PFP A;  4ZYE A;  1SAU A;  3H9Q A;  3WGI A;  3OYJ A;  2VJJ A;  5ILS A;  4BXU A;  4Q5S F;  3SHF A;  3D1N I;  3F22 A;  4EQQ A;  4XR6 A;  3BQY A;  4A6E A;  1G6N A;  4JQF A;  1BA5 A;  1XDU A;  3A2K A;  1A6I A;  2ZXW H;  1FC3 A;  3GEZ A;  4C30 A;  1JKO C;  2ISY A;  2L9N A;  3Q9V A;  4HYE A;  2ID6 A;  4O6J A;  1UMQ A;  3L9F A;  4BQA A;  3K4K A;  3WTX C;  2MD5 A;  2ZME B;  1HKT A;  2WBM A;  1U3E M;  1YS6 A;  2CG4 A;  4CH7 A;  4CA0 A;  1DU0 A;  2ID3 A;  4LLN A;  4AIJ A;  2EH3 A;  1ZRF A;  1YIJ I;  4JX5 A;  2FNA A;  5FLV A;  2FBH A;  3MD2 A;  1UAA A;  4ZJZ A;  1S6L A;  3PNV A;  2YU9 J;  1XN7 A;  2M5W A;  2X1D A;  2R92 J;  2VI6 A;  2EA4 A;  5GTH C;  1A04 A;  3I71 A;  4OMZ A;  4HNV A;  1VFC A;  1OCC H;  3OIP A;  3B6C A;  5DM6 F;  1PYV A;  2CQK A;  4CUG A;  5ICG A;  3OS0 A;  2RRE A;  2AHQ A;  3KPH A;  1LFU P;  3QP6 A;  4BUP A;  4OAY A;  5TGT A;  3GTL J;  4FT8 A;  4BH9 A;  3OYK A;  5DS9 A;  3SFI A;  1B72 A;  3OIO A;  3LAP A;  2NNN A;  2ZSI B;  1SEU A;  2BY1 A;  1Y6I A;  3BG7 A;  3E3V A;  3FXQ A;  3DLL F;  3KP7 A;  5E3M A;  2MLK A;  1TT5 B;  5F64 A;  4IXA A;  5B1A H;  3M8J A;  4M72 A;  5DD4 A;  3DPL C;  3JRI A;  2JK3 A;  1YJW I;  3BP8 A;  2JZY A;  3R60 A;  2R7S A;  5D5V B;  3QYE A;  1YJN I;  1OFC X;  1B59 A;  4CIC A;  2LD5 A;  2QSG X;  2QWW A;  4PJJ A;  3GF2 A;  2WTE A;  1ZK8 A;  3A4C A;  1MMA A;  3QP5 A;  4F3Q A;  1XDS A;  3U1K A;  2WC2 A;  3J7A Y;  2TCT A;  2DBB A;  2R7T A;  2ICW G;  1SD4 A;  1Y1W J;  4XKC A;  2BZT A;  2ZNZ A;  5CQE A;  4A3C J;  3GW2 A;  1IN5 A;  1FTZ A;  3LSJ A;  1S5L C;  5GTI C;  1Z05 A;  3BZC A;  2VQG A;  4N4N B;  1DU6 A;  4OMY A;  2FNP A;  1LFP A;  1OCZ H;  4A3B J;  3Q3S A;  3PSI A;  5E8I A;  2NNY A;  2XAJ A;  2VKH A;  2O61 A;  2E5Z A;  3SDG A;  3CJN A;  5FB2 A;  4EVI A;  4EM2 A;  2V1N A;  2Y0S N;  2NS8 A;  3ELK A;  1P7I A;  2R5Z B;  4ZYG A;  2ETH A;  2CQQ A;  4JX6 A;  5HLT A;  5IYC J;  2EB7 A;  4AIK A;  2EA2 A;  1EH8 A;  2O3F A;  4KN7 X;  3D5R C;  2I10 A;  3DKY A;  1JT6 A;  2GIZ A;  2EFW A;  4S0H B;  1YX3 A;  2VBX A;  5J4V A;  4HLX A;  3BG3 A;  4UXN A;  3O8G A;  4ZZD A;  4B1R A;  2ZXH A;  1YX5 A;  2W85 A;  2Y9Z A;  1GLN A;  2XPV A;  2J5O A;  3FXM A;  2EIK H;  2X0L A;  3BRO A;  4IF4 A;  4ITV A;  5DUK A;  4OIN F;  5M3M J;  1PUF A;  1MBJ A;  2RDP A;  2PEX A;  2XIG A;  1IGN A;  1MH4 A;  2VXZ A;  4G12 A;  3QYB A;  5IPA A;  4IQJ A;  1YRN A;  2PX9 A;  3BTJ A;  1WKM A;  4LG3 A;  4MTE A;  2Y9Y A;  3A0B C;  1ETK A;  2IW5 A;  5FKO A;  1XCB A;  1QVU A;  3GVA A;  1MD0 A;  4PGG A;  4M73 A;  1IN6 A;  2DOA A;  2FML A;  4CCN A;  3IRR A;  1LE8 B;  5HLG A;  1FYK A;  1WWX A;  5HOD A;  1IXR C;  1R49 A;  2ZSH B;  3S1Q J;  2EV0 A;  1TWH J;  3EPZ A;  2ZME A;  1LEB A;  3A1Y A;  1ON2 A;  2DA2 A;  1ERD A;  1IW7 F;  4HAM A;  1U2W A;  3G1M A;  2JA8 J;  3UNG C;  1Y56 A;  3SDB A;  3LSG A;  5CLS A;  1N78 A;  2E2I J;  3HSF A;  2PQ8 A;  2GM4 A;  1TW2 A;  3HB9 A;  4UV8 A;  4IOA F;  3I9V 2;  2RNJ A;  5J1Y A;  1YQA A;  2FX0 A;  2R3S A;  2KRH A;  1K79 A;  1B72 B;  1IUY A;  1EV7 A;  4L18 B;  1H8A C;  1Z3X A;  2EFO A;  1BI2 A;  2JA2 A;  5LGU A;  2ECB A;  1U0J A;  2JVH A;  3EUK L;  5BMZ A;  4XLA A;  4A3F J;  5J4Y A;  2RN7 A;  5EZG A;  2JUC A;  1JI8 A;  1YG2 A;  2XKP A;  2TDX A;  1FY7 A;  4KMU X;  2BW3 A;  1R1V A;  3Q5F A;  2P5V A;  3KFW X;  3MKL A;  1WFX A;  4M6V A;  3IKV A;  3GTG J;  2G0E A;  1E17 A;  4QLC U;  1IN8 A;  1F1Z A;  2XVC A;  1ZLJ A;  3CLQ A;  4I0A A;  4C2T A;  4LG0 B;  2VQH A;  1QPI A;  3IUO A;  5M3F J;  1BW5 A;  1N77 A;  2ZME C;  3FXO A;  4R1H A;  3KLN A;  3TOA A;  2OBP A;  2IJL A;  4N4O B;  2DT5 A;  3V7S A;  4N9I A;  1F9N A;  4MTD A;  1LB2 A;  2CW7 A;  4PCQ A;  4UHT A;  3RKW A;  3RIR A;  1U5T C;  4B4C A;  2JPB A;  2PMZ A;  3ZQ7 A;  2XPU A;  5C44 J;  1GXP A;  3W2A A;  5JFR A;  4HV5 A;  3QU6 A;  2G7H A;  1QGP A;  4XL9 A;  4A0Z A;  4DBR A;  4B3X A;  1VTN C;  1SFO J;  5FD6 A;  1FP2 A;  3CMM A;  2R93 J;  3KET A;  4RS8 A;  4ASN A;  2PMZ N;  4CZZ A;  1ZEL A;  5GP9 A;  2VE8 A;  4IRG A;  4XIC A;  1HXD A;  2PN6 A;  5HS8 A;  2VT2 A;  2ADU A;  2VPR A;  2M30 A;  2DT6 A;  1GV5 A;  4RAF A;  1EJ9 A;  1Z7U A;  4PSW A;  2A07 F;  3EYY A;  4I02 A;  2Y0S A;  1MDM B;  2EFP A;  3SZG A;  4BHC A;  1QZZ A;  3CJQ B;  4OIP F;  1T6S A;  3H5A A;  1XSD A;  1T2K A;  2VBY A;  3CC4 I;  2R7F A;  4L5J A;  3G2B A;  1TWC J;  1U9N A;  2QQA A;  3RKQ A;  5HDN A;  2BW3 B;  3FX3 A;  1ZH5 A;  3GX4 X;  3G73 A;  1REP C;  5LLQ A;  3S1R J;  4HST A;  3SEQ A;  1BIA A;  2G9W A;  4RGR A;  4ESF A;  3HRU A;  4ZTJ A;  3ESW B;  3SFZ A;  5LRS A;  3HYI A;  4EJT A;  2ME6 A;  6PAX A;  5LFA A;  1E0E A;  1IDY A;  1ZAO A;  1WHU A;  1UG2 A;  1W0U A;  2DT7 B;  4BAC A;  1HCR A;  4MEY F;  4BDZ A;  3WGH A;  4NC7 A;  3LOC A;  2JN6 A;  2X85 A;  3M3Y J;  1WH7 A;  4M3E A;  1MMN A;  3NWS A;  4RA2 A;  3ZQQ A;  2GBY A;  3I4N J;  1LDK B;  3K9T A;  3AKZ A;  1Z67 A;  3LNQ A;  1IC8 A;  4NC6 A;  1ORK A;  3HRM A;  4IHS A;  2DPU A;  3O6B B;  1I3Q J;  2LKS A;  3DBR B;  2HEO A;  1DDN A;  2BVL A;  1S72 I;  4ZYA A;  5L3G A;  4C2M J;  3I58 A;  4D7N A;  1JUS A;  2HGC A;  2YPR A;  3H92 A;  2M4G A;  5F6F A;  3F21 A;  4Y7N J;  3A01 A;  3T1B A;  3L2U A;  3I64 A;  4IRI A;  3CO6 C;  3OV8 A;  2DQR A;  1LUJ B;  5DM7 F;  2GXG A;  3HRS A;  5BOX A;  3QOP A;  1MNM C;  1E3H A;  3I5U A;  2VOD A;  4G94 A;  3BC8 A;  4C3I J;  5M5Y J;  5D5U B;  3FK6 A;  3H3U A;  2DOE A;  4PFO A;  2BHZ A;  2FBK A;  2CV0 A;  1DPR A;  5DCF A;  1YIT I;  1V4R A;  4ENK A;  2F4O B;  1ZTR A;  3DKW A;  5FKM A;  1K61 A;  2A6E F;  3FIS A;  3IRQ A;  3DKX A;  2M7A A;  1ZLK A;  3DEU A;  2HVQ A;  1HST A;  3P5J A;  3OSG A;  1RRJ A;  4RGX A;  3BTI A;  3H9G A;  5KHD A;  3UKG A;  1C0W A;  4A3L J;  2XRO A;  3HHH A;  1CF7 A;  2HNH A;  5H20 A;  3LA2 A;  3TED A;  1Z6T A;  2VJ5 A;  3LWF A;  3I59 B;  1R5I D;  1K78 A;  2LLK A;  4N0B A;  4Q4Z F;  4XQF A;  2XAH A;  3ABM H;  1TLH B;  3HOY J;  3F72 A;  5LHH A;  1JHH A;  3KYC B;  4L5I A;  2JRT A;  2WY7 Q;  1F36 A;  2CSO A;  3C2H A;  5FFX A;  3EUH C;  3LA3 A;  2HDD A;  2HOE A;  1F5T A;  2Y48 A;  3ISP A;  2P5K A;  2ZNY A;  4IKF A;  2DA1 A;  2M45 A;  2VN2 A;  1J09 A;  3TP3 A;  4XNF A;  1STZ A;  2HXI A;  4LLG F;  4EMS A;  2KDZ A;  4XM3 A;  4AD9 A;  3AG2 H;  2FOW A;  1F4K A;  1OLT A;  2GOM A;  2LP0 A;  4E7S A;  3H9J A;  4A0Y A;  2M87 A;  1R4M B;  2F48 A;  3ZQL A;  3S3M A;  2A3S A;  3TP0 A;  3OMY A;  4Z6Y A;  2COM A;  4BEH A;  2IGM A;  1RET A;  4UV9 A;  5FGM A;  3OOU A;  1I50 J;  3RQI A;  1FPQ A;  2DOD A;  1T33 A;  4FCY A;  3RJP A;  1ZG1 A;  1VQM I;  1AA7 A;  2RQP A;  5B3S H;  2P0W A;  1CGP A;  2JSC A;  4WX9 A;  1SFE A;  2YUS A;  5FKK A;  4KNY A;  4IHX A;  4E7Z A;  4C3H J;  4J01 A;  1MMD A;  4CDG A;  1QQI A;  1XG1 A;  2H8W A;  3MN2 A;  4NC8 A;  3A03 A;  4BE1 A;  1YW9 A;  2CRG A;  3L2V A;  3IP4 B;  2M0M A;  3WHB A;  3K4L A;  2XAG A;  4A3D J;  3T5X A;  2XSJ C;  2Z5U A;  2XB0 X;  1HSJ A;  1W7P A;  3VB2 A;  2MG4 A;  2IEK A;  3WE3 A;  2GQQ A;  1P4W A;  1D8K A;  4M9S A;  3KYL A;  3GUD A;  1G2H A;  2JMW A;  2GA1 A;  4LB6 B;  4E4H A;  3BG9 A;  2A6T A;  2LC2 A;  4XKV A;  5CVV A;  5HLH A;  2E34 A;  2IS4 A;  1J7K A;  1R23 A;  3TL4 X;  5K7Z A;  3CQZ J;  5CPR B;  1ZRC A;  2HDW A;  2KPM A;  5C4J J;  4NDL A;  3PQJ A;  4Y15 A;  4DZJ A;  5ERI A;  1F43 A;  4LK0 F;  4TV7 A;  3VSL A;  2M8G X;  3G6E I;  3WTU C;  3F8C A;  3CME I;  3WU1 B;  1IXS B;  2CUJ A;  2QKM B;  3L2Q A;  4OAZ A;  1S7O A;  4EJO A;  2EK5 A;  2OAZ A;  2R7R A;  3K7A J;  3IL2 A;  3EYI A;  2IGK A;  1HQC A;  3FBN B;  3Q0V A;  1TT0 A;  4V2F A;  1LVK A;  1OCO H;  1R6R A;  2W1O A;  5LHG A;  4FET A;  3ZQC A;  3WTZ A;  1MMS A;  4MO7 A;  1ETV A;  2M4K A;  1BM9 A;  1N25 A;  3BR0 A;  4RB0 A;  4QIW N;  3MFK A;  1IG7 A;  4UVB A;  1S9H A;  2JRM A;  2DMU A;  2X4H A;  2XGD A;  2LF7 A;  5FKL A;  1JKR C;  2YR2 A;  2XRN A;  5FLM J;  1B8I B;  5D8L B;  2WB1 N;  3TKY A;  2HFH A;  4U0Y A;  3DQV C;  1T39 A;  1ZR2 A;  2W24 A;  1Y39 A;  2Z9O A;  4A3G J;  1IDZ A;  2X51 A;  4RM2 A;  5B66 C;  1BR1 A;  3VPR A;  2LR8 A;  2MSY A;  3FXR A;  4HEA 2;  4I09 A;  4IEJ A;  3SZP A;  2LK2 A;  3DPU A;  3JRC A;  4QTR A;  2EIL H;  1RNL A;  5D5W B;  1RC9 A;  2MGQ A;  5CVI A;  1AHD P;  3HRT A;  3L7W A;  1WJD A;  5K5Q A;  5AIQ A;  4BXX J;  5JVT A;  2R7U A;  1AOY A;  5DD8 A;  5FD5 A;  3GZ6 A;  2XHK A;  2UXN A;  4KDP A;  1BN5 A;  2OJE D;  2DFE A;  2LBF B;  1JGG A;  3MAJ A;  4LIU A;  1WZ2 A;  2QQB A;  4DW6 A;  4A3E J;  5JR3 A;  3K4B A;  3S14 J;  2QEN A;  1ETO A;  2EZH A;  2E2H J;  1BL0 A;  2KDO A;  1WVR A;  4XN3 A;  1A35 A;  2BXZ A;  3VOE A;  3JAM K;  2VOP A;  4E7I A;  2DA5 A;  4W97 A;  3L1P A;  1HKQ A;  3S93 A;  4FHT A;  2ZXI A;  3T0Y A;  2QKL B;  3CCY A;  2DK5 A;  3MWM A;  3LQQ A;  3K4M A;  2FQ3 A;  2WAD A;  4CGZ A;  5LRR A;  1IO2 A;  1OKR A;  2DMQ A;  2LKP A;  1MJ9 A;  4XLH A;  1D8J A;  4ZYD A;  3E97 A;  1BJA A;  2BY3 A;  1JKP C;  3ZOB A;  5LEK A;  4CHU A;  4I01 A;  3Q0U A;  3VFZ A;  1X3U A;  2OC6 A;  3EUH A;  1Q1V A;  5J40 A;  2BY0 A;  4LK1 F;  1TC3 C;  2STT A;  3ZMT A;  2HWV A;  2DDA A;  1TWA J;  1AU7 A;  2LRD A;  3ZGK A;  5IP7 J;  5BNG A;  2WWY A;  1Y0U A;  3OYE A;  3LST A;  3MCZ A;  4PDK A;  4ESB A;  3HIF A;  2BVM A;  1R36 A;  5AIP A;  3OYD A;  3BR3 A;  2RAE A;  1FBS A;  3H3Z A;  4XRM A;  3QAH A;  2CFO A;  2V9K A;  5H2F C;  2K3F A;  3JRF A;  4E7L A;  4A3M J;  5EDN A;  4U87 A;  4IL6 C;  4BXF A;  3VYS B;  2CQN A;  2IA0 A;  2E35 A;  2MD0 A;  3ECH A;  4C2U A;  1LNW A;  2OQR A;  4F91 B;  3QQA A;  3F8F A;  4EM0 B;  2NVX J;  2DI3 A;  4QPQ A;  3J7Z I;  3RZO J;  5IYB J;  1YOV B;  1S29 A;  5HLI A;  3L00 A;  1YW7 A;  3IWZ A;  4YRV A;  1RI7 A;  4EAT A;  2K9Q A;  2R7Q A;  1K78 B;  1IRZ A;  4PJL A;  3CMA I;  4A3K J;  3HTU A;  5IYD J;  5IT9 K;  3PO3 J;  4IHV A;  1R1U A;  3ABT A;  1BC8 C;  4FTH A;  1LQ1 A;  3M1E A;  1L0O C;  5KCM A;  4ETS A;  1ZHF A;  4G7H F;  1MW7 A;  1B9N A;  1KON A;  2GWR A;  4NBQ A;  2ZC2 A;  3ERM A;  2CS3 A;  3G4S I;  1MSE C;  4F52 A;  2RGV A;  3W6V A;  4AC0 A;  2KHM A;  3E5Q A;  2VL8 A;  1HBX G;  4MFE A;  2EFQ A;  1JXS A;  1KU2 A;  5CJ9 A;  3BJ6 A;  5M5X J;  2YX4 A;  4BY7 J;  4JBA A;  3J80 K;  4ENJ A;  2MH9 A;  3RPU A;  2WV1 A;  3BDD A;  3OWT A;  1H89 C;  4UY8 I;  2PG4 A;  1I6X A;  3PFI A;  2Y31 A;  3VWB A;  2E1N A;  2FQ4 A;  2OV7 A;  2HYJ A;  5JHF A;  4RDU A;  3HUG B;  3BR6 A;  2BGC A;  3CP8 A;  4M6X A;  5HOO A;  2F4M B;  4BQQ A;  1XD7 A;  3GTO J;  4HNU A;  3TW6 A;  2L4M A;  3RI4 A;  3J7A O;  5IOZ A;  3DCF A;  1VND A;  1ITY A;  3TO6 A; 
#chains in the Genus database with same CATH homology
 2CQX A;  1JUP A;  4B4C A;  3M4O J;  4DZP A;  3GBG A;  2XPU A;  4UUT A;  5C44 J;  2DJN A;  3JRA A;  1D5Y A;  2W48 A;  2CUE A;  2L7Z A;  3HM5 A;  4X1E A;  5FKN A;  1SFO J;  3HOW J;  9ANT A;  2R93 J;  1TWG J;  1FTT A;  3G1O A;  2PMZ N;  4LOC A;  4XRS A;  1RKW A;  2JA7 J;  5GP9 A;  4B3A A;  4XIC A;  5C4X J;  4C3J J;  3S15 J;  2E19 A;  3GTK J;  2VPR A;  3I4M J;  1GV5 A;  2M9H A;  4AYB N;  2HOT A;  1X58 A;  3PM1 A;  4BBS J;  3G1L A;  4D5C A;  3LSP A;  1R9T J;  1NK2 P;  4XID A;  1YRN B;  2VKE A;  4V2G A;  3A01 B;  1CQT A;  3F0C A;  2EZL A;  2K9S A;  3GTQ J;  1ENH A;  3Q0W A;  3PO2 J;  2ECC A;  3S2D J;  1JTX A;  1TWC J;  5J1R A;  3BTC A;  3GTP J;  3HOU J;  2NVT J;  1A5J A;  5IOY A;  1U9N A;  3MVP A;  4DYQ A;  3RKQ A;  1PUF B;  2DN0 A;  2COB A;  3HOX J;  1K83 J;  2XSD C;  3CMY A;  2L0K A;  5EEA A;  3S1R J;  1Z0X A;  5M5W J;  1APL C;  1X2M A;  2JWT A;  4UUS A;  2ME6 A;  2OPT A;  5EF6 A;  1TWF J;  4JP0 A;  1IDY A;  4A3I J;  3IH2 A;  2L9R A;  1UG2 A;  1W0U A;  1E3O C;  1HCR A;  3LOC A;  2JN6 A;  1U8B A;  3M3Y J;  1WH7 A;  4M3E A;  4I6Z A;  2DMT A;  2WAQ N;  1I6H J;  2GBY A;  3HDD A;  3I4N J;  1Z77 A;  4FE4 A;  1RES A;  3LNQ A;  1IC8 A;  2XGC A;  1ZGW A;  1ORK A;  1JUM A;  3S1N J;  1U78 A;  1GVD A;  2EZK A;  2DTZ A;  1I3Q J;  5EZH A;  1WI3 A;  2QF7 A;  3HKZ N;  2R5Y B;  4C2M J;  2CUF A;  2ME0 A;  2HI3 A;  4D7N A;  1JUS A;  2VKV A;  4BBR J;  5GPC A;  3GTJ J;  2NVY J;  4Y7N J;  3A01 A;  4D5F A;  2XGE A;  4MFD A;  3ZQG A;  4AUX A;  4A3J J;  3IH4 A;  1UHS A;  2M0C A;  3ZQI A;  2VUM J;  1ETW A;  1Y1V J;  1FEX A;  5C3E J;  1FJL A;  5IP9 J;  1MNM C;  3S17 J;  3OSF A;  5F04 A;  4C3I J;  5F0C A;  3HGY A;  1RKT A;  2FJ1 A;  5M5Y J;  4MLO A;  3FK6 A;  1JT0 A;  3GTM J;  3E7L A;  3S2H J;  2JJ7 A;  2O8K A;  5EGO A;  2NVQ J;  1MBK A;  3B6A A;  1ZTR A;  2YS9 A;  2HOA A;  5FKM A;  1K61 A;  3NAU A;  3FIS A;  4XK4 A;  2P81 A;  3H3V K;  2R5Z A;  5EGO B;  3HEF A;  3OSG A;  2E2J J;  4XRS G;  2QCO A;  3JRH A;  1ETY A;  1VF9 A;  4JYK A;  2EBI A;  3BTI A;  3UKG A;  3DEW A;  4A3L J;  2K40 A;  3H0G J;  2L7M P;  4MIM A;  3ZQF A;  1H88 C;  4ABZ A;  2DMN A;  3TED A;  4DYC A;  3JRG A;  4IHW A;  4CYC B;  2D5V A;  2M2E A;  1GDT A;  2R0Q C;  4GFB A;  2LLK A;  5FJ8 J;  1XS9 A;  2DA7 A;  3HOY J;  4X6A J;  2DA6 A;  3FK7 A;  3WHC A;  5GPA A;  1F36 A;  3BTL A;  1JTY A;  1ZKG A;  2IBD A;  3HOV J;  1T56 A;  2R5Y A;  4M3F A;  2HDD A;  2LVS A;  2K9N A;  3HBL A;  4JX4 A;  2DA1 A;  3TP3 A;  2HXI A;  2KDZ A;  2XRL A;  1ETX A;  2O7O A;  2HOS A;  2LP0 A;  2DA4 A;  1HLV A;  3A02 A;  2X6O A;  4BKX A;  3ZQL A;  4L5E A;  1MSF C;  3TP0 A;  5JLX A;  1VI0 A;  1RET A;  2EQR A;  3OOU A;  1I50 J;  4BY1 J;  3RQI A;  2LY9 A;  5EG0 A;  1T33 A;  2NOG A;  4FCY A;  3BR2 A;  2M34 A;  1MBG A;  4Y52 J;  2YUS A;  5FKK A;  1WGX A;  4A93 J;  1BW6 A;  2LTP A;  1BJZ A;  4IHX A;  5DTD A;  4C3H J;  2LKX A;  2OF7 A;  4EEF G;  3IV5 A;  4I76 A;  3TW7 A;  1XG1 A;  1HF0 A;  3MN2 A;  3A03 A;  4M3D A;  1LE8 A;  2CRG A;  3WHB A;  5F0F A;  4A3D J;  3JRB A;  3S1M J;  2XB0 X;  5F1J A;  1POG A;  2MG4 A;  2IEK A;  3NAR A;  2L7F P;  1G2H A;  3D1N I;  2JMW A;  3BG9 A;  3BQY A;  1BA5 A;  3RZD J;  1A6I A;  5K7Z A;  1JKO C;  3CQZ J;  1QVT A;  5C4J J;  4NDL A;  2ID6 A;  1UMQ A;  2AO9 A;  4DZJ A;  4J19 A;  1F43 A;  3JRD A;  2Y30 A;  4FE7 A;  2M8G X;  1OCT C;  1FIP A;  1MBH A;  1IJW C;  1DU0 A;  5J1U A;  2ID3 A;  1FIA A;  2O9L A;  2EH3 A;  3K7A J;  3FKI J;  4JX5 A;  2KT0 A;  5FLV A;  3Q0V A;  4V2F A;  2YU9 J;  3JRE A;  3ZQC A;  3S16 J;  4RBO A;  5IP6 A;  5J3L A;  3HGG A;  4MO7 A;  1ETV A;  2R92 J;  2VI6 A;  2HXO A;  3QPL A;  5K7H A;  3BR0 A;  4QIW N;  2B63 J;  4HNV A;  1VFC A;  1IG7 A;  3B6C A;  1HOM A;  1QRY A;  2DMU A;  3O8H A;  2XGD A;  5FKL A;  2AHQ A;  1JKR C;  1LFU P;  1B8I B;  5FLM J;  3GTL J;  2WB1 N;  4D7M A;  5DS9 A;  3SFI A;  1ZR2 A;  1B72 A;  3OIO A;  4A3G J;  1IDZ A;  5E3O A;  3VPR A;  2LR8 A;  2MSY A;  5E3M A;  4IEJ A;  2LK2 A;  3JRC A;  1GT0 C;  1X2N A;  4QTR A;  2MGQ A;  1AHD P;  2GLO A;  3JRI A;  1WPK A;  2JK3 A;  1S7E A;  4BXX J;  1MH3 A;  2N8G A;  1OFC X;  2LD5 A;  1JJ6 C;  2CU7 A;  1ZK8 A;  1JGG A;  4W1U A;  4DW6 A;  1ETQ A;  2ELK A;  4A3E J;  1RPW A;  3S14 J;  2TCT A;  4M3G A;  2XB5 A;  1ETO A;  2EZH A;  2E2H J;  1BL0 A;  1Y1W J;  1AKH B;  2JA5 J;  1O4X A;  2Y2Z A;  2R7Z J;  4A3C J;  1FTZ A;  1IUF A;  2DA5 A;  4W97 A;  2E1O A;  1RR7 A;  1NTC A;  3LSJ A;  3ZQH A;  4DYR A;  3L1P A;  2IAI A;  1XC5 A;  5EG0 B;  2EZI A;  1DU6 A;  3CCY A;  4QSH A;  4CYC A;  4A3B J;  3Q3S A;  1W0T A;  2DMQ A;  1WH5 A;  3SDG A;  4A69 C;  2FD5 A;  1ZQ3 P;  1SAN A;  2Y0S N;  2NS8 A;  1JKP C;  3ZOB A;  1P7I A;  2R5Z B;  1GUU A;  2CQQ A;  4JX6 A;  2MW8 A;  3Q0U A;  5IYC J;  4IHY A;  1Q1V A;  2I10 A;  1JT6 A;  2X9D A;  3BG5 A;  4S0H B;  1TC3 C;  3C2B A;  3BG3 A;  3O8G A;  1TWA J;  4B1R A;  1AU7 A;  2Y9Z A;  2XPV A;  2H8R A;  1GV2 A;  4UUS B;  5E3L A;  5IP7 J;  2CJJ A;  5BNG A;  1JKQ C;  3QPS A;  5M3M J;  1PUF A;  1MBJ A;  1U9O A;  1IGN A;  1MH4 A;  4G12 A;  3BR3 A;  5IPA A;  2RAE A;  2XPW A;  1YRN A;  4XRM A;  3BTJ A;  1P7J A;  1B8I A;  3BT9 A;  2Y9Y A;  1IV6 A;  1ETK A;  5FKO A;  3JRF A;  1QVU A;  2X48 A;  4A3M J;  3IH3 A;  5EDN A;  3SJM A;  1LE8 B;  5F0H A;  1HDP A;  2JA6 J;  2NS7 A;  3BR5 A;  2ZB9 A;  5HOD A;  5F08 A;  1OCP A;  1NK3 P;  3S1Q J;  1TWH J;  3QQA A;  2DA3 A;  2NVX J;  3BQZ A;  3RZO J;  2DA2 A;  2HQ5 A;  5IYB J;  2JA8 J;  3G1M A;  2DMP A;  1HDD C;  3LSG A;  1LFB A;  1MBF A;  2K9Q A;  3JR9 A;  2E2I J;  1IRZ A;  1ZR4 A;  2GM4 A;  4A3K J;  5IYD J;  3LSR A;  3PO3 J;  4IHV A;  3HB9 A;  4FTH A;  5J1Y A;  2FX0 A;  1B72 B;  5EYR A;  2LFB A;  1H8A C;  1EF4 A;  1MSE C;  2ECB A;  1WCM J;  5E3N A;  5F27 A;  4A3F J;  3CDL A;  3W6V A;  4AC0 A;  5EZG A;  4MFE A;  3HOZ J;  5M5X J;  4BY7 J;  3BR1 A;  3MKL A;  4M6V A;  1AKH A;  2WV1 A;  4M3B A;  3GTG J;  2G0E A;  1H89 C;  1OJL A;  1MBE A;  3K2A A;  2Y31 A;  1QPI A;  2FQ4 A;  2TRT A;  2HYJ A;  4RDU A;  5M3F J;  4FIS A;  5JLW A;  1BW5 A;  3BR6 A;  2H1K A;  1JJ8 C;  3FIW A;  3GTO J;  5K7F A;  3TW6 A;  5IOZ A;  3DCF A;  1VND A;  1ITY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...