1VFQA

The crystal structure of human coactosin-like protein at 1.9 a resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
132
structure length
132
Chain Sequence
SMATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human coactosin-like protein at 1.9 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 46
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1vfqA00
1VFQA 1M2VB 1M4JA 1T3XA 3EGXA 5FAFA 4PKHB 1C0GS 4CBWG 1EQYS 1Q8XA 1YAGG 2L72A 5HVKD 1D0NA 5DD2A 1P8ZG 1T2LA 4KEFA 1NM1G 2FGHA 3L50A 2FH1A 2MOTA 1NMDG 1WFSA 1M2OA 1KCQA 1P8XA 1YVNG 5IVUA 2NUPA 1PCXA 1UDMA 1RGIG 2NUTA 5KYYB 1TMWA 3EH2A 2XFAA 1AK6A 2W0IA 4JD2H 2KVKA 3FG7A 4KEDA 3CIPG 3DAWB 1H1VG 3TU5B 1JHWA 1SVYA 2D8BA 3A5NS 3EGDB 5KYXA 1PD0A 2HD7A 4PKGG 1HQZ1 2NUTB 3A5OS 4KEEA 3A5MS 3EG9A 1WNJA 2FH3A 3FFKA 1C0FS 1SVQA 1AHQA 2LLFA 1M2VA 3EFOB 2FH4A 1CNUA 1X67A 3EH1A 1AK7A 2LXXA 2LJ8A 2I2QA 1T3YA 5KYUB 2NUPB 1TVJA 2MV2A 4Z94G 5A1MA 2VACA 1PD1A 4CBUG 1V6FA 3EGXB 1NLVG 2FF6G 3EGDA 5KYXB 1J72A 5FAEA 1COFA 1ESVS 1QPVA 3EG9B 5HVKB 5L6WC 5KYWA 5KYUA 2VILA 1VKKA 3EFOA 1CFYA 1Q8GA 2QTVA 5KYYA 3A5LS 1DEJS 4PKIG 4LIZA 1MDUA 1F7SA 1D4XG 1T44G 3Q2BA 5KYNA 2FF3A 4S10C 4CBXG 1NPHA 2MP4A 3CI5G 3FFNA 2VIKA 3CJBG 2XF1A 1WM4A 3FG6A 1SVRA 4BEX1 3CJCG 2FH2A 5KYWB
chains in the Genus database with same CATH superfamily
1VFQA 1M2VB 1M4JA 1T3XA 3EGXA 5FAFA 4PKHB 1C0GS 4CBWG 1EQYS 1Q8XA 1YAGG 2L72A 5HVKD 1D0NA 5DD2A 1P8ZG 1T2LA 4KEFA 1NM1G 2FGHA 3L50A 2FH1A 2MOTA 1NMDG 1WFSA 1M2OA 1KCQA 1P8XA 1YVNG 5IVUA 2NUPA 1PCXA 1UDMA 1RGIG 2NUTA 5KYYB 1TMWA 3EH2A 2XFAA 1AK6A 2W0IA 4JD2H 2KVKA 3FG7A 4KEDA 3CIPG 3DAWB 1H1VG 3TU5B 1JHWA 1SVYA 2D8BA 3A5NS 3EGDB 5KYXA 1PD0A 2HD7A 4PKGG 1HQZ1 2NUTB 3DA7A 3A5OS 4KEEA 3A5MS 3EG9A 1WNJA 2FH3A 3FFKA 1C0FS 1SVQA 1AHQA 2LLFA 1M2VA 3EFOB 2FH4A 1CNUA 1X67A 3EH1A 1AK7A 2LXXA 2LJ8A 2I2QA 1T3YA 5KYUB 2NUPB 1TVJA 2MV2A 4Z94G 5A1MA 2VACA 1PD1A 4CBUG 1V6FA 3EGXB 1NLVG 2FF6G 3EGDA 5KYXB 1J72A 5FAEA 1COFA 1ESVS 1QPVA 3EG9B 5HVKB 5L6WC 5KYWA 5KYUA 2VILA 1VKKA 3EFOA 1CFYA 1Q8GA 2QTVA 5KYYA 3A5LS 1DEJS 4PKIG 4LIZA 1MDUA 1F7SA 1D4XG 1T44G 3Q2BA 5KYNA 2FF3A 4S10C 4CBXG 1NPHA 2MP4A 3CI5G 3FFNA 2VIKA 3CJBG 2XF1A 1WM4A 3FG6A 1SVRA 4BEX1 3CJCG 2FH2A 5KYWB
chains in the Genus database with same CATH topology
1VFQA 1M2VB 1M4JA 1T3XA 3EGXA 5FAFA 4PKHB 1C0GS 4CBWG 1EQYS 1Q8XA 1YAGG 2L72A 5HVKD 1D0NA 5DD2A 1P8ZG 1T2LA 4KEFA 1NM1G 2FGHA 3L50A 2FH1A 2MOTA 1NMDG 1WFSA 1M2OA 1KCQA 1P8XA 1YVNG 5IVUA 2NUPA 1PCXA 1UDMA 1RGIG 2NUTA 5KYYB 1TMWA 3EH2A 2XFAA 1AK6A 2W0IA 4JD2H 2KVKA 3FG7A 4KEDA 3CIPG 3DAWB 1H1VG 3TU5B 1JHWA 1SVYA 2D8BA 3A5NS 3EGDB 5KYXA 1PD0A 2HD7A 4PKGG 1HQZ1 2NUTB 3DA7A 3A5OS 4KEEA 3A5MS 3EG9A 1WNJA 2FH3A 3FFKA 1C0FS 1SVQA 1AHQA 2LLFA 1M2VA 3EFOB 2FH4A 1CNUA 1X67A 3EH1A 1AK7A 2LXXA 2LJ8A 2I2QA 1T3YA 5KYUB 2NUPB 1TVJA 2MV2A 4Z94G 5A1MA 2VACA 1PD1A 4CBUG 1V6FA 3EGXB 1NLVG 2FF6G 3EGDA 5KYXB 1J72A 5FAEA 1COFA 1ESVS 1QPVA 3EG9B 5HVKB 5L6WC 5KYWA 5KYUA 2VILA 1VKKA 3EFOA 1CFYA 1Q8GA 2QTVA 5KYYA 3A5LS 1DEJS 4PKIG 4LIZA 1MDUA 1F7SA 1D4XG 1T44G 3Q2BA 5KYNA 2FF3A 4S10C 4CBXG 1NPHA 2MP4A 3CI5G 3FFNA 2VIKA 3CJBG 2XF1A 1WM4A 3FG6A 1SVRA 4BEX1 3CJCG 2FH2A 5KYWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFQ A;  1M2V B;  1M4J A;  1T3X A;  3EGX A;  5FAF A;  4PKH B;  1C0G S;  4CBW G;  1EQY S;  1Q8X A;  1YAG G;  2L72 A;  5HVK D;  1D0N A;  5DD2 A;  1P8Z G;  1T2L A;  4KEF A;  1NM1 G;  2FGH A;  3L50 A;  2FH1 A;  2MOT A;  1NMD G;  1WFS A;  1M2O A;  1KCQ A;  1P8X A;  1YVN G;  5IVU A;  2NUP A;  1PCX A;  1UDM A;  1RGI G;  2NUT A;  5KYY B;  1TMW A;  3EH2 A;  2XFA A;  1AK6 A;  2W0I A;  4JD2 H;  2KVK A;  3FG7 A;  4KED A;  3CIP G;  3DAW B;  1H1V G;  3TU5 B;  1JHW A;  1SVY A;  2D8B A;  3A5N S;  3EGD B;  5KYX A;  1PD0 A;  2HD7 A;  4PKG G;  1HQZ 1;  2NUT B;  3A5O S;  4KEE A;  3A5M S;  3EG9 A;  1WNJ A;  2FH3 A;  3FFK A;  1C0F S;  1SVQ A;  1AHQ A;  2LLF A;  1M2V A;  3EFO B;  2FH4 A;  1CNU A;  1X67 A;  3EH1 A;  1AK7 A;  2LXX A;  2LJ8 A;  2I2Q A;  1T3Y A;  5KYU B;  2NUP B;  1TVJ A;  2MV2 A;  4Z94 G;  5A1M A;  2VAC A;  1PD1 A;  4CBU G;  1V6F A;  3EGX B;  1NLV G;  2FF6 G;  3EGD A;  5KYX B;  1J72 A;  5FAE A;  1COF A;  1ESV S;  1QPV A;  3EG9 B;  5HVK B;  5L6W C;  5KYW A;  5KYU A;  2VIL A;  1VKK A;  3EFO A;  1CFY A;  1Q8G A;  2QTV A;  5KYY A;  3A5L S;  1DEJ S;  4PKI G;  4LIZ A;  1MDU A;  1F7S A;  1D4X G;  1T44 G;  3Q2B A;  5KYN A;  2FF3 A;  4S10 C;  4CBX G;  1NPH A;  2MP4 A;  3CI5 G;  3FFN A;  2VIK A;  3CJB G;  2XF1 A;  1WM4 A;  3FG6 A;  1SVR A;  4BEX 1;  3CJC G;  2FH2 A;  5KYW B; 
#chains in the Genus database with same CATH topology
 1VFQ A;  1M2V B;  1M4J A;  1T3X A;  3EGX A;  5FAF A;  4PKH B;  1C0G S;  4CBW G;  1EQY S;  1Q8X A;  1YAG G;  2L72 A;  5HVK D;  1D0N A;  5DD2 A;  1P8Z G;  1T2L A;  4KEF A;  1NM1 G;  2FGH A;  3L50 A;  2FH1 A;  2MOT A;  1NMD G;  1WFS A;  1M2O A;  1KCQ A;  1P8X A;  1YVN G;  5IVU A;  2NUP A;  1PCX A;  1UDM A;  1RGI G;  2NUT A;  5KYY B;  1TMW A;  3EH2 A;  2XFA A;  1AK6 A;  2W0I A;  4JD2 H;  2KVK A;  3FG7 A;  4KED A;  3CIP G;  3DAW B;  1H1V G;  3TU5 B;  1JHW A;  1SVY A;  2D8B A;  3A5N S;  3EGD B;  5KYX A;  1PD0 A;  2HD7 A;  4PKG G;  1HQZ 1;  2NUT B;  3DA7 A;  3A5O S;  4KEE A;  3A5M S;  3EG9 A;  1WNJ A;  2FH3 A;  3FFK A;  1C0F S;  1SVQ A;  1AHQ A;  2LLF A;  1M2V A;  3EFO B;  2FH4 A;  1CNU A;  1X67 A;  3EH1 A;  1AK7 A;  2LXX A;  2LJ8 A;  2I2Q A;  1T3Y A;  5KYU B;  2NUP B;  1TVJ A;  2MV2 A;  4Z94 G;  5A1M A;  2VAC A;  1PD1 A;  4CBU G;  1V6F A;  3EGX B;  1NLV G;  2FF6 G;  3EGD A;  5KYX B;  1J72 A;  5FAE A;  1COF A;  1ESV S;  1QPV A;  3EG9 B;  5HVK B;  5L6W C;  5KYW A;  5KYU A;  2VIL A;  1VKK A;  3EFO A;  1CFY A;  1Q8G A;  2QTV A;  5KYY A;  3A5L S;  1DEJ S;  4PKI G;  4LIZ A;  1MDU A;  1F7S A;  1D4X G;  1T44 G;  3Q2B A;  5KYN A;  2FF3 A;  4S10 C;  4CBX G;  1NPH A;  2MP4 A;  3CI5 G;  3FFN A;  2VIK A;  3CJB G;  2XF1 A;  1WM4 A;  3FG6 A;  1SVR A;  4BEX 1;  3CJC G;  2FH2 A;  5KYW B; 
#chains in the Genus database with same CATH homology
 1VFQ A;  1M2V B;  1M4J A;  1T3X A;  3EGX A;  5FAF A;  4PKH B;  1C0G S;  4CBW G;  1EQY S;  1Q8X A;  1YAG G;  2L72 A;  5HVK D;  1D0N A;  5DD2 A;  1P8Z G;  1T2L A;  4KEF A;  1NM1 G;  2FGH A;  3L50 A;  2FH1 A;  2MOT A;  1NMD G;  1WFS A;  1M2O A;  1KCQ A;  1P8X A;  1YVN G;  5IVU A;  2NUP A;  1PCX A;  1UDM A;  1RGI G;  2NUT A;  5KYY B;  1TMW A;  3EH2 A;  2XFA A;  1AK6 A;  2W0I A;  4JD2 H;  2KVK A;  3FG7 A;  4KED A;  3CIP G;  3DAW B;  1H1V G;  3TU5 B;  1JHW A;  1SVY A;  2D8B A;  3A5N S;  3EGD B;  5KYX A;  1PD0 A;  2HD7 A;  4PKG G;  1HQZ 1;  2NUT B;  3DA7 A;  3A5O S;  4KEE A;  3A5M S;  3EG9 A;  1WNJ A;  2FH3 A;  3FFK A;  1C0F S;  1SVQ A;  1AHQ A;  2LLF A;  1M2V A;  3EFO B;  2FH4 A;  1CNU A;  1X67 A;  3EH1 A;  1AK7 A;  2LXX A;  2LJ8 A;  2I2Q A;  1T3Y A;  5KYU B;  2NUP B;  1TVJ A;  2MV2 A;  4Z94 G;  5A1M A;  2VAC A;  1PD1 A;  4CBU G;  1V6F A;  3EGX B;  1NLV G;  2FF6 G;  3EGD A;  5KYX B;  1J72 A;  5FAE A;  1COF A;  1ESV S;  1QPV A;  3EG9 B;  5HVK B;  5L6W C;  5KYW A;  5KYU A;  2VIL A;  1VKK A;  3EFO A;  1CFY A;  1Q8G A;  2QTV A;  5KYY A;  3A5L S;  1DEJ S;  4PKI G;  4LIZ A;  1MDU A;  1F7S A;  1D4X G;  1T44 G;  3Q2B A;  5KYN A;  2FF3 A;  4S10 C;  4CBX G;  1NPH A;  2MP4 A;  3CI5 G;  3FFN A;  2VIK A;  3CJB G;  2XF1 A;  1WM4 A;  3FG6 A;  1SVR A;  4BEX 1;  3CJC G;  2FH2 A;  5KYW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...