1VG9B

The crystal structures of the rep-1 protein in complex with c-terminally truncated rab7 protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
169
Chain Sequence
KVLLKVIILGDSGVGKTSLMNQYVNKKFSNIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/protein transport
molecule keywords Rab proteins geranylgeranyltransferase component A 1
total genus 60
structure length 169
sequence length 174
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vg9B00
2B21A 4LY6A 4M8NE 3KXIA 4YXWD 2ZJOA 4KCGA 1UAAA 5K8UA 1W1WA 3ZLJA 4C7OB 1MO5A 1KDRA 3RNLA 5C4GB 2E87A 4NYJQ 4JLDA 1A2BA 5BYJA 2D3WA 4BLOA 5FTMA 4NP6A 3RABA 4OHWA 2D62A 1LW7A 2VEDA 3Q85A 4CT5A 3RS5A 3W9YA 3FHTA 1CS4C 2MMCA 3RVBA 4DDTA 5FI0B 4RFSA 3T5GA 4PHFA 4KFTA 3AP2A 5L3QA 3SQWA 1AKEA 1MRSA 4HAXA 4I1SA 2QAJA 2VA8A 3H2YA 2IWRA 2JATA 1G6OA 4BUJA 4ZIRA 3WBKA 1HY3A 2WPDA 1E1RA 3NDPA 4OI4A 4OK3A 2OUKA 3SE0A 1SKYE 3IHLA 1CTQA 1TTTA 4NTZA 1Z0IA 5FOVA 2O8CB 3DKPA 1N6RA 5LPNA 3PXGA 1QHIA 1XEXB 4ZDWA 3HYRA 3T15A 2ZRBA 4L16A 3M4YA 4F7WA 2ZVQX 2ZRNA 2VF8A 1OFHA 2QPTA 3RWOA 1QHGA 4V0LA 4C0SA 5IHPA 2CBZA 1Q3HA 3ZQ6A 5SZHB 1NKSA 2PMDA 3SR0A 2IYSA 3K09C 2O0KA 1ODFA 4RCYA 3PITA 3H86A 4TYNA 4L8GA 1FP7A 5EP1A 1Q57A 3ZVNA 3RS7A 5GVSA 4V0OA 3ICEA 3GLFB 4XTRA 3U60B 1PLJA 2W2XA 3TBKA 4JL6A 4Z8YA 4A6XA 2QMOA 4DVGA 2FDCA 2JJ2D 3CRQA 3B1VA 1DAHA 1E69A 5F3WB 3N2EA 1UDXA 1VMAA 4X8LA 4OQLA 1YZGA 4LYFA 5JFGA 3K70D 1W36D 4TSFD 1XTIA 5HKKA 2ERYA 5AJZA 1HEIA 3KJGA 4GOJA 4QHYA 3TH5A 4BLTA 4D0LB 4ZI2A 4DLVA 3VNUA 3L43A 1MKYA 3A1TA 3CH5A 3PUWA 2CL6X 1ZYUA 3OIUA 1RRFA 4MDFA 1J90A 1ZCBA 1R0YA 4A82A 3MWYW 4PC6A 1Z47A 1S1MA 1W0KD 3I62A 2IX3A 1E0AA 1KMHA 1E96A 2J7KA 2OEPA 1XRJA 1G3MA 2HYDA 3N70A 5EUQB 4AYWA 1W4CA 3IBYA 2V54A 2HJGA 1P72A 2Z83A 2GRJA 3AF1A 2J0VA 4NCHA 4PQFA 2FU5C 3TSWA 2PMKA 5FBWB 4B74A 1RC8A 1H8ED 4Z1MA 4KSCA 2JJ1A 2XOKA 2X8AA 1PLLA 1DAGA 2EFEB 1XWIA 1KAGA 1R0WA 3JZAA 4KXFB 2RMKA 2V6IA 4Y0AA 2J1LA 4Q1CA 1E0SA 4KU4A 4PPFA 3G5UA 1W46A 2RGCA 4P0TA 1HTWA 4DEXA 3UMFA 3K0CA 1GNRA 5GJWC 2KB0A 1N6NA 5EE3A 1HA3A 2RHMA 2PH1A 3SOPA 4IOMA 4FCTA 3L0IB 1UEIA 3BD9A 3CRRA 4UQOA 2YC4C 3FDIA 1E2KA 1VECA 3QXHA 1EFRA 1P60A 2CCKA 3T1TA 4DJTA 4UNQA 5FUXA 4F4JA 2AK2A 4D25A 1UM8A 1NBMD 4I1UA 1UKZA 4D82A 2VLIA 1CU1A 1SKQA 4DDWA 4W5HA 1G3QA 1QHHB 4M1TA 1M7BA 3CONA 5ANRB 4DSNA 1BMFD 1R8SA 2C95A 3LV8A 3I1FA 2J87A 1P3JA 4JYCA 4GDFA 1CR4A 3ADCA 2ZU0C 3GJ0A 1CEEA 1KO4A 1C1YA 3WNDA 4Q5IA 1CULC 2DFKB 5JJLA 4F4CA 1R6BX 2JCSA 1HV8A 1Z2AA 3A4MA 1BIFA 4D80A 1R4AA 2CNWD 3KTAB 3VHXA 1QG4A 3B2EA 4TL9A 2CEAA 5CYPA 3TW8B 5CITA 4XVRA 2R6DA 1TQ6A 1S96A 3GLIB 5GJBA 1KK1A 1UADA 3CPHA 2V8OA 2OFXA 2VHUA 1Z0FA 3LX8A 2RGDA 1BYIA 2QI9C 2XTZA 2CL0X 3L0PA 3P4XA 5EP3A 3UWOA 4DWJA 3CZPA 4DXAA 3FB4A 3IIKA 2GVDC 2QTVB 1QZXA 5JEDA 2AD5A 3V4RA 2PJRA 2KSQA 2FPLA 3AF3A 3FKQA 3BB3A 2P2LA 4IVRA 2YYZA 5C46F 4RD4A 2XB4A 2DB3A 4H9GA 1XPRA 3CRW1 3FWYA 5AUNB 2OM2A 2W58A 1ZM7A 2ZQ5A 4JL8A 3ZZTA 4C0BA 2IL1A 2WM9B 1GM5A 1G16A 1P5ZB 1KI7A 1TQDA 4ESVA 2QSZA 2OFOA 4CEHA 1E0JA 1UKYA 1QF9A 1NSTA 4OK5A 5LDDC 4AKIA 2QMHA 4US1R 4QGHA 1E2LA 1OH6A 2A3RA 3JVVA 5JWOA 4KO8A 3THYB 3TAUA 2D2EA 4Q18A 2OBLA 2GHIA 2WIBA 2HLDA 3IO3A 2O8FA 3UMSA 4CEIB 1VYUA 3GJ8A 1A5TA 1QHNA 1T8TA 2P67A 4MA4A 3RRYA 2XTMA 3HU3A 1OH7A 3BERA 5J4VA 1DVRA 3PCRB 4TYYA 1OXXK 2FH5B 3LBHA 5F98A 2XNDA 1AS2A 4Q4JA 4AKGA 1II8B 1K8RA 2WWIA 4L9WA 4B35A 4II7A 3SN6A 3G82C 2BMFA 1KIMA 2D7CA 5FL7A 4A0FA 1P2TA 2DFNA 2WJYA 1DAEA 1FW6A 5JS7A 3ZD7A 4QL3A 4A0HA 3DOEA 4JT2A 4P33A 4Q48A 3X1WA 4QG7A 2GZAA 1KSGA 4LYHA 3NBFA 1MO4A 5JJKA 4PO9A 3A1SA 3UMRA 2GAAA 4B76A 1XTRA 1CR0A 3QIAA 1US8B 4M53A 4ZDKA 4RD3A 3CO5A 4POAA 4URWR 1SVOA 2HXSA 4M0LA 1G5TA 2I1QA 2OILA 2JDID 2P0EA 3AP1A 3MWJA 5AUPB 4RD6A 1G7RA 2KE5A 4A9AA 3GLGB 4C9BA 1T9HA 2VYFA 2X2FA 5SZIA 3U7FB 2UVQA 2JLXA 3P4YA 5FUYA 4KVAA 4HUQA 4Q7LA 2CNWA 1R0XA 1CRPA 1FP6A 4MRSA 3REGA 1JJ7A 1UFQA 2BWJA 3WMEA 2IS2A 1P73A 4G5GA 2VP5A 4ZPXA 2ATVA 4MGKR 1XTSA 4QJ3A 1Y3AA 4C2UA 2XEXA 3VQTA 1MABA 4TTPA 1ZCAA 3THYA 1G64A 4DT1A 4LBVA 4TLEA 1NLFA 4IEIA 3BK7A 2ZYTX 4XD7A 5CB6A 2XXAA 4EPXA 1KKMA 1AN0A 4TYPA 1T3SA 4Q9HA 2J3EA 1G3UA 3EXAA 4OKSA 4D4MA 4OI2A 1TU4A 3U6BA 1W4RA 2ANBA 3F0TA 1XCMA 2C8VA 2PBRA 3B78A 3MGCA 1W49A 2GF9A 2P3SA 2GJ8A 3MUFA 2VP9A 3GLIE 1E1QD 3A1UA 1PJRA 1JAHA 1W36B 4LJAA 1RYHA 2EQBA 1CJMA 4O2RA 3ADDA 1GRRA 2OXCA 3CF0A 1AK2A 4TT3D 4M9ZA 2W6JD 1S2MA 3X1YA 2FFBA 3BFKA 4CZ2A 2PX0A 2QEQA 4XWKA 3PENA 4JYBA 1T3LA 2WKQA 2O8EB 2CHQA 3LDAA 4RJLA 4WBSA 1YJ5A 1G4AE 3TW4A 3EPLA 3LBNA 1EFCA 1X86B 3KQNA 3FTQA 4CRWB 4DIEA 3BIFA 4JLAA 4JBWA 1G6HA 3OIVA 4Z8XA 2Q3FA 3V4FA 5KPJA 4MGZR 5SZKB 1OXVA 2XITA 1N6HA 4JLMA 4K8OA 1U2RA 1Z6YA 3ZH9B 2P6RA 1MO3A 4J0QA 1CXZA 1GDDA 3GLGA 2BIFA 2WWGA 1L2TA 1UPTA 4PPNA 4BWYA 4X8HA 4AIIA 5KO2A 3QQ5A 3BFXA 1ESMA 2J0QA 2JDIA 2QAGB 2PCJA 3CB4A 1ANKA 3MJRA 1ZP6A 2NO1A 5L3RA 3AUXA 1QHSA 4NYMR 1WMSA 2OZEA 4TSFA 4EQ6B 1E2GA 5HKKD 3K0FB 4Y0VA 1RZ3A 2VTKA 1CF4A 1NF3A 1OIXA 2F1RA 4A6PA 1E2IA 4ZKEA 4Z1MD 2ZUDA 2W2TA 2C04A 4G5OA 2OAP1 5IF9A 1Z06A 3CX6A 1BO6A 2FSGA 4HSEA 4TT3A 1X8LA 5DNYB 1DAFA 3R20A 4LBZA 2ZRMA 4P4SA 1XEXA 1FX0B 5G3ZA 4B44A 1P2UA 3NKVA 2AXNA 3D6TB 1E1QA 1M2OB 1N0VC 3SBDA 2C9YA 5D3MB 2F1JA 2L0XA 2D7DA 2QPOA 1J8YF 2Q3HA 4PHGA 1U9IA 4AURA 3H1TA 4JVNA 2HT1A 2QQEA 1I2DA 2DFTA 4B3CA 2O8DA 2DWQA 3WP0A 3DL0A 4IVPA 5EQTA 2ZRIA 2A30A 2IF0A 4EPTA 3AVUA 3SFZA 4B3XA 1LVGA 2VHJA 3W3ZB 3O8CA 1KO8A 3I8XA 2J45A 4MGYR 1SGWA 2C77A 4TL6A 1WP9A 4ZDIA 3H0KA 3KUDA 1OSNA 1JXOA 5B64A 2C9OA 3EZ7A 3PEVA 3LD9A 3Q9LA 4AG5A 4BZXA 1G8HA 3A1WA 2RH5A 2G3YA 3KQKA 5EXXA 2FEMA 2J46A 4NDZA 2OCAA 5FFMA 4D0GA 1VTKA 1E2QA 4URYR 1KJYA 3KB1A 4A4DA 3RWMB 1XPUA 2QAGA 2YOFA 2A5YB 3QG1A 4Q1FA 4JLVA 2FFQA 4R2HA 1IJEA 1SVMA 4LI0A 4HATA 4JJZA 2QM7A 5E7JA 1ZM9A 4LJ4A 5HPYB 2OG2A 2IS4A 4HB0A 1RIFA 2JLSA 1F2TA 1D8TA 1JR3E 5KDLA 4Z51A 3B60A 1YR7A 2X1VA 2CCGA 3IILA 3MCAA 2YNMA 2QMUA 4BLPA 1OJLA 3U7EB 2R9VA 3WMFA 2P5SA 1LFDB 1R5OA 2WZQA 1T5IA 3ZDQA 3LAWA 4GZLA 1A4RA 3WRYC 5CM9C 1N0UA 1FX0A 2ZSFA 4EFNA 1DG1G 1X1RA 1XNJA 1N5LA 1II9A 3KFXA 4LOAA 3OAAD 1EWQA 2WVJA 1P4SA 4LJ7A 3THWB 4TMWA 2QG6A 2W83A 3I5YA 5EZ5A 1MOZA 4ZIRB 4NCJA 1TX4B 2WWWA 5FOWA 1GOTA 4FD2A 1OB5A 4LYJA 3LO5A 4URXR 4JVLA 1S9HA 1ZVQA 3HWSA 4PSVA 1OB2A 1AQUA 4KFSA 4FI3C 4LC0A 4M9SA 4GMXA 3WBJA 4B3DA 1T91A 4LHYA 2ZI9A 3LXXA 1U81A 4BE7B 1ZD1A 3VKHA 2QUZA 5JMTA 2TMKA 2WWXA 3TLXA 4ABYA 4RZXA 2AFIE 4HDQB 1NG9A 2F9LA 4RFVA 4YONB 1SKYB 4MYUA 1XB2A 1WDTA 2GETA 1G41A 1Z8FA 4DLXA 4Q4AB 4RSGA 5B58C 3P26A 3L0SA 2R6FA 1XDBA 4LRWA 3HR8A 3T34A 2P6NA 4HB3A 3R7WB 4ACAA 3D3QA 4TMXA 4ARZA 1YZNA 4AYTA 3KQUA 2ZSBA 3B7GA 2ANCA 2OXRA 1FFHA 2VSFA 4A36A 3BJIC 5FPYA 2IYWA 1YHNA 4G0NA 4Q19A 2NO0A 5J4YA 1QVRA 3VKGA 2CHGA 4CDGA 4AC9A 2VSXA 1ZNWA 3A1VA 3BB4A 4YQFA 1G21E 2BEJA 1P61B 3LY5A 1JECA 2C98A 1LB1B 4Q01A 3I3SR 2Z43A 1KKLA 3E1SA 3QY0A 3ZGXA 5FR2A 4MKFA 1KDPA 3AGQA 2AXPA 3QEJA 4GZMA 4B75A 3NC1C 3LLMA 5KNCA 4A2WA 3K0CC 1QBKC 3QXXA 4PTLA 2VSOA 5EUMA 4TQ9A 1ZM2A 1U9IC 2GCNA 2FMXA 1SZPA 2WHXA 5BN5A 1CJVC 2N46A 3RS2A 5FBLB 1IM2A 3GP8A 1IJFA 4UXJA 4BEJA 4AKEA 2BCGY 1ZUNB 4WVFA 4EDHA 4JBXA 1UKVY 3C5HA 2BCJQ 1Z6AA 2JGNA 2H5EA 2ZS9A 4YC7A 4PC7A 3NVAA 4M1OA 1DAKA 1WQ1R 3AKYA 4LBWA 1N25A 4EQ6A 1RKBA 4KFRA 1WCV1 1XZQA 5JBQA 3EZFA 2V3CC 1X3SA 2PJZA 1KMQA 3PUVA 4PQYA 4PQRA 4TQAA 4UNSA 1TEVA 2Z0MA 3I72A 5K8IA 1G3RA 1QDEA 3WNBA 4MUAA 3RDPA 4A8JA 1GL7A 2IA5A 1AZSC 2AFHE 2QORA 3OIWA 3Q5EA 4WOPA 1MT0A 4P4SB 2Q9AA 2HEIA 4FN5A 4ZO4A 3PUZA 3QBVA 2YWFA 5DYIA 3U5ZB 4O0MA 3AVYA 2HYIC 4QBFA 1UEJA 1M8PA 5CM8B 2DHRA 1R8QA 2GCOB 3GMTA 2FFHA 3MMPA 4A8JB 1NJFA 1X6VA 4PXAA 1J8MF 2EWVA 4U7DA 2FSFA 3AUYA 4PC1A 3OFNA 5JRJA 2QQ0A 3LRPA 3OEHD 2PZEA 1CR2A 1NVVR 2GTPA 2IS1A 1VIAA 1M74A 1ZU5A 5B30A 4B34A 1KYIA 3AKDA 2HLDD 4LJ9A 4UXIA 4DKXA 1DELA 4JS0A 1KDOA 4P32A 3T1OA 3GJ3A 5KSOA 4KLNA 3B8HA 4B33A 2A5DA 3EZ9A 3FFBA 1SXJD 2IBMA 3EW9A 5JI2E 4DIDA 3CRVA 3KJHA 2AD1A 2VF7A 2QTHA 3CKLA 5KYKA 4CEJB 5FPTA 2OE2A 2KBFA 2NTYC 2ODWA 5FL7D 3HPQA 2GBLA 1LV7A 4IDOA 1ZM4A 2GEVA 1SVLA 1E32A 1E2PA 1E9EA 1W2HA 3Q7QA 2ZAOA 4GOXA 5FUVA 3ZZ0A 4JLNA 4BRWA 4US2R 3U7HB 4ILEA 2QT0A 1E4VA 4AY2A 5LD2C 4LHVA 2RGXA 2G88A 2QPAA 4RD0A 4LZZA 1JAIA 3U44A 2ZI4A 4R71A 4D4JA 3BXZA 2EFHB 5CJ2A 2EFGA 1E2NA 1HT1E 1XMVA 4MDEA 4C4PA 3GJ5A 3THWA 3QKUA 3WYGA 2F3TA 3ZIAD 2IXGA 5CLLA 1FQKA 3GLHB 4DLUA 2X19A 3SYNA 2AKAB 1GZSA 5G3YA 2NO9A 2QE7D 2NZ8A 3MD0A 3LFUA 4LV8B 1DO0A 4BEBA 3TVDA 3EC1A 4URUR 1E9FA 1KO1A 2I3BA 1WE2A 4E22A 1N5JA 2WMNB 2QGNA 4L15A 2C2HA 1N6OA 1T8UA 2O0JA 1D2EA 3JZMA 4FWIB 1XXHB 3QKSB 3QUSA 4LK2A 5E3HA 4C0JA 1Z08A 4B32A 1QVAA 1U8YA 1T0HB 5DSZA 4U02A 4E07A 5G41A 4WZAE 3AV0B 2BM1A 4CEHB 2BEKA 3DZDA 4I81A 3Q8XB 3REFA 3VR5A 3HJNA 5TXGA 2Q21A 3BH7A 2F1HA 4HAUA 3FFAA 3ZZUA 2ZE8A 4B2PA 4F93B 2J41A 3B85A 4HZIA 2NQ2C 3O8DA 1RJ9B 2XGJA 3AH8A 5JHGB 3KQLA 4JLPA 3K0SA 1TUIA 2IXFA 4NZYA 4WZ6A 2N1BA 4B48A 2CL7X 2CVHA 1F60A 3GFOA 5L3SB 5SZJA 4Q66C 2ZVPX 1KI6B 1NVXQ 2ZJ5A 4NONA 4CW7A 1ZMXA 3FYHA 3SC3A 5JZVA 4GFDA 5KSPA 2WWYA 3IQXA 3DPUA 2NPFA 4W5JA 3K53A 1II8A 1RRGA 1CR1A 4URZR 4HDCA 3EZ2A 1R5NA 2HCBA 1E3MA 4E03A 2IC5A 1GP2A 2FEOA 1G7CA 3UK6A 721PA 1EFRD 1Z0AA 1KNQA 3LBIA 1XP8A 3P1JA 2DWOA 3FMFA 3WNCA 4M1YA 1M34E 4B3FX 2ZITA 1KO7A 3LW8A 3CNOA 2PZFA 3VU9A 1U94A 3OEED 3S1AB 4B73A 5CIWA 5K8TA 2JAQA 2ZRLA 1YR8A 3B1YA 2QBYB 2REXB 4LDJA 1VG1A 4DC9A 1Z28A 4RCZA 5FTLA 2ZEJA 4YDHB 3UANA 5CDFE 3CUEF 3K9HA 4URVR 2PEYA 3PG5A 4PO1A 1H8HD 1FUUA 4O2LA 3SS8A 4OBEA 3HU1A 1N0WA 3NEJA 1TF7A 3SJCA 3CLVA 2ZJYA 3A8TA 2H17A 4QBIA 2QZ4A 2NO6A 1F3OA 3X1XA 2ZRPA 4MGIR 5BN4A 2QN6A 4QFMA 4DCUA 5HE9A 2WJGA 4QM6A 4DHEA 3U3MA 1T5LA 3B9QA 4Q1AA 1CJKC 3WRXC 4DB4A 2J59A 4TTQA 2AHOA 2IK8A 1VPLA 4PHTA 2ZE6A 1A1VA 1BYUA 1UBFA 4IOKA 1F2UA 2A7QA 3BC1A 2EYUA 5TV2A 5KUTA 4OJKA 2PT7A 3VR3A 2AL7A 3GLIA 1OXSC 2NGRA 2NPIA 3WY9A 1GAJA 2GJ9A 4KITB 3P32A 1NVWQ 3RS4A 4OHZA 4ON9A 1GUAA 1UBGA 4LHXA 3LA6A 2O5VA 4Q9JA 1NY5A 1NVUQ 1IXRC 3GLHE 3L2OB 4ZKDA 2ZSEA 4KBGA 4BGDA 2J0SA 1XZPA 1E4YA 2B7BA 2CDNA 5F2EA 2A5JA 2IYRA 1Y63A 1NN3A 3MLEA 4EPWA 2CLCX 4JSYA 3VMFA 3AVTA 5H8WA 2OAQ1 5HTKA 4TMZA 4PAOA 3QKRB 4NL4H 3SDZA 2H1LA 2WIAA 2JLQA 5AR1A 4D81A 3PQCA 1R0ZA 5C18A 2ATXA 1GSIA 4V03A 1NIPA 5A5GA 3GLFA 3FMOB 1OKKD 2P5TB 4LYAA 4IHQA 5FPKA 5C2JB 4QNRA 5TB5A 4IDPA 2VQSA 2ZRFA 1S3SA 1HH4A 1OH5A 1Z6TA 4NYMQ 1NVVQ 3RRZA 1BS1A 4GRAA 2ZXUA 2WPDD 4KSBA 1KZ7B 2KJQA 3THXB 1JPNA 4FMBB 1JB1A 3K09A 1W47A 5A0FA 5DO9A 2OCYC 4EPYA 1DG3A 3W5IA 2GAOA 3EWSA 1DARA 1GL6A 1Z2CA 2XSZA 4DT1B 3TRFA 4WIAA 5FTNA 3QXJA 4A15A 4QKQA 2YOHA 2JJ8A 3AVVA 2A9KA 4R98A 1LS1A 1N6LA 1N6PA 2HDNB 3A36A 3THXA 3MJHA 2IYZA 5HR5A 5JRZA 2IS6A 3DDCA 1G8FA 3GFTA 2O8BB 3DKVA 1U0JA 4DEYA 3GLGE 4UJ3A 1NLYA 2LCFA 1EWRA 4F4IA 3EPKA 4V0KA 1Z0JA 2R44A 4JL5A 1WB9A 1U0LA 4QJ4A 2ZETA 3LLUA 4LC1A 1SXJA 2MSEB 3AVXA 1VDZA 2WWHA 3CF2A 3KKMA 1P75A 4I4LA 3E70C 1ZW6A 4IDHA 3QSYA 3B82A 5CK4A 4DLYA 3WYAA 4G3XA 1E6CA 3BS4A 3GJ4A 3OFND 4I1VA 4KFUA 4ASUD 2IHYA 1N6IA 4A8JC 2GJAA 2H16A 4DLSA 5TARA 3HU2A 3SI7A 1KI8A 1VHLA 5EE1A 1FNNA 3Q3JB 5C1BA 2J0UA 1KI2A 3BGWA 1AS3A 2QY9A 4Q47A 3PR1A 2GBLC 1OIVA 1ZD9A 3KJIA 1Q20A 4W9MC 1M7GA 2YC2C 4GBMA 4DCSA 4DLTA 4WW0A 1DO2A 4DDVA 1DAIA 1QRAA 4HLUC 4MITA 1KO5A 4HDOB 3OEHA 5EE0A 3HP1A 2I1VB 1XTQA 4G5SA 4HAYA 3TUZC 2VO1A 2ZJZA 3C7KA 1UKEA 5KDOA 1XJ0A 5JJIA 1XEWX 3B6EA 4NYIR 4UJ5A 3D8BA 1GNPA 4UNPA 2GA8A 2ZRJA 2B92A 3GD7A 2YVUA 5EJEA 1XXHA 3NBYC 3QKSA 4LUCA 3RHFA 1W0JA 3TVTA 3AVPA 5FOSA 2BOVA 2OLKA 1B23P 4TZ6A 1NN5A 2XNSA 4N0DA 2PL3A 3QPUA 5LD2B 2IUTA 1GNQA 2W00A 2FFAA 3QG5A 5IT5A 3ZD6A 4KHZA 5CDFA 4ERNA 4B3GA 4KODA 1G9XA 1X1SA 1L4YA 2GXUA 4C2TA 4KLZA 5AUQA 3AVWA 1E79D 4D6PA 1YVDA 2FGKA 4QHTA 2AN9A 5JSZB 4NHOA 1VYTA 1K6MA 1P9WA 1W5SA 3BOSA 4R7ZA 1FTNA 3DZ8A 4R9UC 2J7PA 1E9SA 2VH5R 2ZRCA 2ZJAA 3K1JA 5FL3A 5GVRA 4BFUA 4PSKA 1ZJ6A 4BFXA 4BLRA 4FW9A 2ZRGA 1XJQA 4M21A 1Q0UA 3U3KA 1ZU4A 3B5JA 3QBTA 2G77B 3ZS8A 3WHLA 4O3MA 1GKIA 4NBSA 3EX7C 1IXZA 1Q1ZA 4UNRA 2IF2A 3VTKA 4RZ3A 3E5HA 4Q7MB 4XJXA 3RYTC 4JJKA 4OI1A 1P9RA 2YINC 3EARA 2BDTA 3T5DA 1KDTA 1GG2A 2JLRA 4ZI3A 1MO6A 2WSSD 1WA5A 1KTVA 2ZU6A 2BJVA 2VP0A 5CYOA 4Z54A 1D5CA 4K81B 3EAQA 3OE7D 3TQCA 5HE8A 1YZLA 1NG1A 4GP7A 3CNLA 4KV9A 1S4QA 4PAQA 3PEWA 1ZIPA 2YJTD 4LGMA 2ZI3A 2F55A 4LCBA 4IXMA 3C14C 4HLQB 4ARZB 1JEDA 1V43A 4Q9KA 1XEWY 3TSZA 2Y8EA 3ICQB 4Q9IA 3TJZA 3U3RA 3IUYA 3IPYA 2CMKA 4Q4LA 3DEFA 4C3ZA 2EFCB 4DSOA 1XXHE 1KJZA 1TUEA 2AKYA 2CK3A 4M1WA 4OHXA 2O8BA 3NEYA 4RKEA 5TMPA 1GRNA 1OF1A 3EIQA 1EXMA 5KPDA 1IOZA 4IDNA 4M1MA 2GEDA 1CJTC 2GNOA 4XVQA 1XCGB 1OH8A 3QOFA 2BVNA 4TL7A 4OL0A 1P62B 1TEXA 5FH9A 3HR7A 5KNBA 4XSGA 4S2EA 2JIZD 4HUQB 5JSZA 3TAHA 1XMIA 2MMGA 1X8KA 3OAAA 3BH6A 4HEJA 3B1WA 2W6IA 1AA9A 2AK3A 2FX3A 4DSTA 5JHHB 5C4MA 2V6JA 1E2MA 1YR6A 2QA5A 4LPKA 4R2IA 4FMCB 5EXTA 4O25A 3W34A 4IVQA 4UXHA 1FQJA 4IRUB 4QC2A 3FMPB 2GZHA 4P3YA 2UZIR 4DRZA 2NZJA 1PZNA 4GMDA 4NPHA 4TWZA 4HAWA 3DO6A 3HYTA 4QGGA 1S8FA 2BHRA 1WBBA 3FVQA 2ZS7A 1IN6A 3QXSA 2BJWA 1WF3A 4NCKA 5AUOB 4OK6A 1R2QA 2B8TA 2CJWA 2ODBA 2V7QA 1LS6A 4JLOA 1E0KA 4OQXA 3IBGA 1M7HA 2OSBA 4HLCA 2B8WA 2GVZC 1CRQA 2WJIA 4YXWA 3VHLB 3KUCA 3I32A 3QF7A 3K8YA 3ZYCA 1JEEA 5H68A 4BRUA 4CYMA 3ADKA 1COWA 3GJ7A 2GWHA 1FMLA 2H8KA 3CH4B 3ONWA 3QPWA 4D4KA 3X1ZA 2WSSA 1SVWA 5FOUA 4B3BA 2BBWA 3IIJA 2ORIA 3R9IA 2ODNA 3WP1B 1AGPA 2ZYUX 3FKSD 2C99A 2ORWA 1E9BA 3KKOA 4PC2A 1E2DA 3WMGA 3CPEA 2V55B 3B9PA 1S3GA 4OJQA 4LSGA 3TMKA 3VR4A 1KY3A 4B43A 3QVVA 3QE0A 1Q21A 4A2PA 1NL3A 4M2LA 5DHAA 2QAGC 4PZYA 1GWNA 5DI3A 2LWIA 1WXQA 1B0UA 1S9DA 3NBZC 4QBHA 5DYGA 1XBTA 4ZCMA 4LWZA 4XTCS 3QVUA 5EP4A 3EASA 3OZXA 3KXLA 4CVNA 3U61B 2PZGA 1Q1BA 2O52A 3K0FA 4WXPA 2CE2X 4PPQA 1QHYA 3L0OA 3TKLA 4C0KA 3UWKA 3T61A 1FOEB 2ERXA 4XH9B 1XU4A 1PUIA 5P21A 3F3YA 3ZVMA 3PJRA 5CLQA 2V1UA 3AEZA 3AP3A 4GPTA 4RZ2A 3EA5A 2EU8A 3NIBA 4OHYA 4KBFA 4HUTA 2RCNA 4CT4B 3AVOA 2NIPA 1JQLB 2QU8A 2GILA 2QRZA 2ZYVX 4I99A 2FZLA 4M9XA 4EPRA 5CJPA 1OXTA 2JIZA 5CIQA 1ELOA 5FTJA 4EUNA 2JLWA 2ZRAA 3WHKA 4EJSA 2I4IA 4N1AA 1FZQA 1OV4A 2IUSA 3C15C 4U5XA 4BECA 2XXAB 3W90A 4BQSA 1NN0A 4CF7A 5EXSA 3CZQA 3PEUA 2OHFA 4PFSA 1ZD8A 2PX3A 5FPSA 3IPXA 2O8DB 1KAOA 2ZS8A 4RY2A 2GCPA 1Q12A 1I4TD 4KYUA 4ZDJA 2ECKA 2W0SA 3KKPA 1J7KA 2OCBA 4A2QA 3KFVA 3D7MA 3THOA 3I4LA 3UG7A 2OT3B 1OT3A 3ND8A 1V5WA 2F43B 2IYLD 2Z5FA 1ZNZA 4DBLC 1QHHA 1U90A 4TMTA 4PSAA 5E7IA 4OQNA 3PUXA 1HT2E 1KK2A 1KI4A 1DEKA 2ZI7A 3IGFA 1VCOA 4NE2A 2XZPA 3Q72A 1TQ4A 5JCZA 1RRCA 1MH1A 1SHZA 3QJYA 1FTSA 3SFVA 2R2AA 2W6JA 4LBYA 1R7RA 4QM7A 1I4LD 2WTUA 3DMDA 3CRMA 3NBXX 1OE0A 1KSHA 2ZRKA 2GK7A 3M6AA 2ZR7A 2WJVA 4B6EA 1E9AA 1XD2A 5FOTA 2BKUA 2DYKA 4N3NA 1IONA 4MYCA 4M1SA 5D3MA 2ZTSA 5BN3A 3SJBA 2WOJA 2G0NA 2GCOA 3EA0A 5AJYA 5JI3E 4AD8A 4YLGA 4NMMA 1OHHA 1GKYA 4XD7D 2YWGA 1Q44A 1N5KA 4BZPA 1DE0A 3BBPA 1GILA 4OHVA 2AR7A 2D2FA 4DB2A 1PVOA 1VG8A 1I4DD 3Q7PA 2WJHA 1EGAA 2QMEA 2WSMA 3UKDA 4GNKA 4ZV4A 1M1YE 1ZBDA 4NKRA 1U98A 2C5LA 2Q3MA 4LPSA 4Q7KA 4DDUA 5BW8A 1SXJC 5IDVA 2Q0HA 2RGNC 3IQWA 4NH0A 4Q1DA 3OESA 2FNAA 2QP4A 1FNMA 1OFIA 5G40A 2LKCA 1OFTA 2G1KA 1TF5A 1YZQA 1I2MA 3TR0A 4MRNA 5FI1B 4I1OA 4IEEA 3RS0A 4EJSC 2O8FB 1L8QA 1E9CA 3NHAA 4D26A 2GXSA 2EFDB 4RKFA 5DH9A 3AKCA 2WICA 4UKDA 4N0EA 2VRWA 1AKYA 3LW7A 1U8ZA 1SULA 4FMCF 3RS3A 5ELXA 2ASEA 2ZAMA 2R6AA 2XOKD 4FINA 1VKJA 5J4KA 2XZLA 3K9GA 4EAQA 1NMZA 3ECCA 4HYYA 1NBMA 3W6OA 1HURA 4Q7JB 1O87A 2E1RA 3SZRA 4TLBA 2J9RA 3CW2A 1XX6A 5AJWA 1RE0A 5FBVB 2ZREA 5KOYA 1QG2A 3I61A 1WRBA 1E2HA 5CK5A 3KQHA 2V1XA 2BKEA 4RD2A 4FCVA 3IKJA 4TYQA 2W6ID 3TNFA 8OHMA 1NY6A 3C41J 2QT1A 3N5CA 5FTKA 1Q1EA 4WXRA 4YMTA 1F5NA 3F5FA 4HAVA 4HLDA 4IJMA 1Z6XA 1YRAA 4RFSB 3AGPA 2W2VA 2G9NA 1W4BA 4B71A 1JJVA 3T1QA 4WAUA 1E94E 2FSHA 1C9KA 4PAMA 2F6RA 3LVQE 4XVUA 4RZUA 1G7SA 1IQPA 1G20E 2VBCA 3K0AA 3W6PA 2ZRHA 3M0EA 1TPZA 4TMKA 1CP2A 4HB2A 5GJCA 2J0UB 1OLOA 2JA1A 3BH0A 4P31A 3OE7A 4BLSA 1KZGB 1T6NA 4MH0R 2IUUA 1YKSA 2ZI5A 1EFTA 5IRCD 4KJZA 2NG1A 1NIJA 2FSIA 2QROA 3AVQA 1UJ2A 2Q9CA 2VP6A 3H4MA 5JWRA 4ZCLA 1VYVA 4Q4AA 2VIIA 3T1VA 1KI3A 3B1ZA 5TVKA 2O8EA 2RAPA 3NC0C 2ONKA 3UG6A 4KI0A 4V0ME 2ZYWX 4AWXA 3CPJB 2QBYA 3TUIC 1MABB 3L82B 1EESA 4E09A 1TAGA 4EIWA 4NCNA 2DPXA 1KMHB 3SHWA 2DFLA 3RC8A 1OHHD 3LNCA 4JSTA 1JR3D 3WYFA 1XPOA 3KZ1E 1GRQA 4FMDB 3F8TA 3IHWA 4F91B 3I73A 5FBQB 5F9HA 3RRNA 1J99A 4LJ6A 3EIEA 4DSUA 2QP9X 1A82A 3LXRA 4AYXA 1E79A 2FG5A 2QSYA 3CWQA 4KVGA 1FPMA 3CBQA 4AKHA 1SVIA 3BAFA 3X2SA 4FIDA 6Q21A 5DISB 1W4AA 1Q1QA 1R10A 1COWD 4YMVA 4MKGA 2EWWA 1EK0A 2Z6VA 2YWEA 1KOFA 1HE8B 1G17A 1W0JD 1F2UB 2PLFA 4A0RA 1IY2A 2O0HA 2LKDA 1IBRA 4A92A 1KI9A 3EPJA 1D2MA 2ZANA 2FE4A 5E4FA 4DCVA 5KSZA 2V7QD 1H8HA 2UZ3A 2J7PD 2ZIAA 4NYJR 2XX3A 4MRVA 4YDSA 3FKSA 3GJ6A 3A4LA 3QPVA 1Q3TA 4OQFA 421PA 4BFSA 2FPMA 2CLSA 1RVDA 2JEOA 5FOXA 3UPUA 3UATA 3MAAC 2JJ1D 4HAZA 4Q02A 4W7SA 1N3BA 2AWOA 3NTUA 1AGRA 3AKEA 1KJWA 4EPVA 4M4SA 1MV5A 1W44A 4TLCA 3J81k 2OBNA 3O8BA 3I5XA 4FXPA 2G0TA 3U4QB 1E9RA 2VHCA 3R8CA 1IN4A 4Q03A 1KI6A 3BORA 4Q1BA 2ZR0A 1G5PA 1G291 3QKRA 1JR3A 2NOAA 2PCLA 2DY1A 4TLDA 4YMUA 4ITRC 1RRPA 3LH5A 1RYFA 1ZM3A 2WV9A 4G1UC 1BMFA 2ZUBA 2JLYA 1XTJA 2JASA 1FUKA 3BFVA 4HI0E 1TU3A 1TMKA 2WJJA 2G1JA 3AM1A 3VNVA 3U7GA 5FBRB 2IYVA 1H8EA 3ZVRA 3FE2A 3KB2A 5D3QA 4F38A 1DTSA 3O47A 2IEYA 2IYUA 1J70A 5IK2A 3W5JA 2RGGA 1KGDA 4D0NA 1QHXA 2ZJ8A 1IXSB 1R5BA 1GIAA 3TK1A 3TUJC 3U2QA 3S1AA 1AS0A 2RGAA 3OF5A 2PT5A 2EVWX 1NMXA 5CB8A 3FPAA 2CK3D 1E2FA 4UNNA 4WZBE 4QGFA 1CKEA 1ZNXA 2IYXA 1ZAKA 3CF6R 3PUYA 5DHFA 3NDBB 4JZKA 2ODEA 5GJVC 4ZCIA 1VIYA 1LF5A 3MWLA 4JLBA 1RFLA 2DWPA 3GLHA 5EXPA 5GADl 3D31A 2HXYA 3VX4A 2R8RA 3QKTA 4DLRA 1F2TB 3GJXC 2CLDX 2OLJA 1EFHA 5K8LA 4YMSA 4GL2A 3CR7A 3W3AA 5JECA 1KK0A 4LJYA 3H84A 3CM0A 1EFUA 1Z0DA 4S35A 4C0AC 3RLFA 4JIMA 2ONJA 4JMPA 3LQQA 4Q00A 4QOSA 3L8YA 2YHSA 2WOOA 1OPXA 3HDTA 4G5QA 4EFMA 3FOZA 3BRWD 2AX4A 4TYWA 1ZC4A 4LJ8A 1FMJA 2IEZA 1EX7A 4BASA 2ZM5A 2Z4SA 4TQUS 1JXMA 2WMOB 4JBYA 3VR2A 3ND9A 3I92A 2QP3A 2HUPA 3A37A 4HB4A 1ONBA 2H92A 3SYKA 4QRHA 1NI3A 1NP6A 4XIGS 2XTNA 2RGEA 3OEEA 1D9XA 3GPLA 2A5GA 2ZSAA 1AQYA 3E2IA 3Q5DA 3I8SA 1NBME 4BFZA 5J5CA 1HQCA 1S1CA 2A78A 2FZ4A 1TL7C 4XOIA 1CIPA 2ZE5A 2DR3A 2QE7A 1HQYE 1IAQA 4M1KA 1PV4A 1G3IA 2P6UA 2ZI6A 2NMVA 3T35A 4IOLA 4C0QC 4NCIA 4Q9LA 2D74A 1JQJC 3R9XA 3C4JA 1CBUA 2HCJB 2QGZA 1E2JA 2RGBA 1TF2A 4A0GA 3MRSA 4IOJA 2O8CA 2RKOA 4H1VA 4PHHA 4JT4A 2DCUA 5BYKA 4D4LA 2N42A 1RW4A 3KKNA 4LV5B 3VX3A 2GXAA 1XMSA 2HJVA 4IW3B 5JEEA 4V0NA 3ASYA 2WWFA 3AF2A 1Z3IX 1NMYA 2OESA 3TSOA 4NU0A 2FJUA 2C03A 2CXXA 4TN1A 2ZPTX 1XF9A 1SQ5A 2YOGA 1UBEA 1LY1A 4AG6A 2A5FA 3RSOA 2CJWB 4YMWA 1US8A 2C78A 3IEUA 2B7CA 5DIFA 3NWJA 3W8NA 4FCWA 5HZKA 3LWNA 2H18A 3EG5A 3ASZA 4TTRA 3B1XA 3RSLA 2KI5A 4ACBA 4E5UA 1PUJA 1EX6A 4L9SA 5FPHA 1G5RA 1GFIA 1VHTA 5JCPA 2JLVA 1E99A 1KSJA 2AWNA 1Z29A 1YQTA 3KL4A 1KNXA 2QTFA 1XJCA 3AQ4A 3P20A 4KYIB 4QGAA 5HCNA 2OFWA 2R6CA 1J2JA 5E95A 1A7JA 3DM9B 4C30A 5KDDA 1JI0A 1A2KC 2IYQA 1P2VA 3N2IA 5DN6A 1U99A 2ZRDA 4OQMA 4EJSB 1DOAA 3GFPA 4QXAA 2Q6TA 3K0AB 3WXMA 5L3VA 1PLKA 3V00A 5IK2D 2ZSDA 4JVMA 5KNDA 4QHSA 4AK9A 3SU8A 2EYQA 4LV6A 3OIYA 4G5RA 3SEAA 1JNYA 2J5XA 4JKIA 5JWHA 3RANA 2YV5A 4MRRA 4LJ5A 4MKHA 1NN1A 5EZ6B 1T3HA 1G4UR 1TQ2A 4V0MA 3T06B 3X1DA 1YR9A 3QF4B 1VCNA 1RJ9A 5LB2A 3RC3A 3U3JA 4PPGA 4QNMA 1ESNA 1LNZA 2BBTA 2BMJA 2G83A 1OYYA 1UF9A 3ZJYA 1E2EA 2DBYA 4XSHA 2IT1A 2OV2A 4BLQA 3SQXA 4NYIQ 821PA 1G18A 2RB4A 2XSZD 1U0HC 1IY0A 3TR5A 1DPFA 1ZNYA 1ZUHA 2GK6A 4B2IA 4K46A 4Q21A 1IHUA 1M6NA 1T0JB 3R7WA 1OYWA 2V9PA 3GQBA 3QF4A 3DMNA 4PANA 3NH6A 4H1UA 3KX2A 1YU9A 4M9QA 1F48A 2EW1A 5DE3A 3TQFA 3KDSE 4L5BA 1Z6GA 3ZVLA 5KU1A 3A4NA 2A2ZA 1E98A 1VG9B 5H1YA 5DLQC 4DCTA 2CHVA 2H57A 2IXEA 1JBKA 4D2IA 2BMEA 5AJVB 2IW3A 121PA 2W0MA 4JVSB 2CVFA 2RHDA 2FPKA 5G53C 1G8PA 2MSDB 3EZ6A 1LF0A 2OO7A 1NNEA 1FL9A 1KK3A 3DOFA 2BM0A 4U00A 5HZHA 4Q1EA 5DI3B 1DBSA 5BXQC 1ZUIA 4BFVA 2GEUA 2XNDD 1ZRHA 2CCJA 1H65A 2ZR9A 3FHCB 3PVSA 1IN8A 221PA 5KSYA 1S0UA 1G19A 2GZDA 2X77A 1XCPA 2BBOA 3IEVA 2BBSA 5F9FA 3QI2A 5J4HA 1MRNA 4GI7A 3A58B 2QENA 2VPPA 3W6NA 2RGNA 3DM5A 2FWRA 4RVCA 4F92B 4OI0A 1XEFA 3VKWA 2H7VA 1OKKA 3BWDD 3SJAA 1C4OA 3K0EA 3RRMA 2VL7A 1BOFA 1ZC3A 4P4UA 4QBGB 1XD8A 2VP2A 2XAUA 3C16C 1SHKA 1Z5ZA 3VFDA 5AK0A 3LVRE 4XWAA 2WBLC 4ASUA 3ADBA 1SXJB 1BKDR 2HV8A 5KHOC 1VCMA 1E1RD 2Q9BA 1W5TA 1GVNB 4HZUA 4DCNA 1EG7A 1AIPA 5HCIA 5KTYA 2XB2A 1DS6A 2JJ2A 1Z07A 4MRPA 4QJ5A 3DHWC 4XWOA 1HE1C 4PR0A 2IYYA 3G0HA 4DUGD 3RAPR 3MSXA 4JLJA 2ZJ2A 1HYQA 3MG9A 3KKQA 1ETUA 5UKDA 4MYTA 1XTKA 3T12A 2ZJBA 1YZUA 3CWZA 1G1MA 1P6XA 4PC3A 2GDJA 1GL9B 1ZIOA 2QRNA 1JALA 4IFBA 1W0KA 4GT1A 3PV0A 3V9PA 4IDQA 4JLKA 2REBA 1U8AA 1OXUA 1P7CA 5A4JA 2JLZA 3O8RA 4Q4JB 1CJUC 3M1IA 2X2EA 5TDHA 3TE6A 2R62A 5BQ5A 1D9ZA 2HT6A 1G8YA 1W2GA 4LX0A 5L8VA 1VG0B 3U44B 4X8MA 3QEOA 1G8GA 3TGPA 1ZINA 4FMDF 4W5WA 4CGZA 1IN5A 2ZROA 1Q22A 2OBMA 3CX7A 2FOLA 4CIDA 4DZZA 5BWMA 4TL8A 3EIHA 3C8UA 1NLZA 4EFLA 1MR3F 5EE9A 4TZ0A 3PFIA 5L3SA 3SBEA 4C0LA 1JR6A 3SYLA 2FA9A 3KJEA 2REOA 3OHMA 3VAAA 1IN7A 2GXQA 1YZKA 1DADA 1YZTA 2FN4A 4IXNA 2WAYA 4MKIA 5LBIA 2C9CA 5EP2A 2FV8A 1P9NA 1RPZA 4TLAA 4PX9A 1NJGA 3LQRA 1Z83A 3MWKA 3SHFA 1UBCA 3UXMA 4A1FA 2FGJA 3P27A 1NRJB 2WKRA 4US0R 2YKGA 2E9SA 521PA 1Z63A 1E9DA 1KY2A 3PIRA 5J4LA 2XZOA 4HZUB 3AF0A 5AWFC 1XD9A 2GESA 2ZUCA 2MSCB 3FHOA 3EC2A 4BFWA 1N5IA 2G6BA 5EE5B 4B6FA 2PLRA 3AB3A 4MYHA 2OCPA 3BE4A 5E7MA 1NKTA 2QM8A 1D2NA 5AJXA 3GCGA 2F7SA 1G7TA 2SHKA 2V4ZA 4C0HA 3K70C 1Z0KA 1WBDA 3NG1A 1HUQA 1W36C 3NXSA 2GJKA 5FR1A 2KWIA 5FUWA 2P65A 1XMJA 1NSFA 3KXKA 4RD1A 4BPBA 4FWTA 3QENA 2HF8A 4MQBA 2YZ2A 3CR8A 4LHZA 4OYHA 1SVKA 2ZE7A 3ZS9A 4Q4HB 2IWHA 1AM4D 1LTQA 4BFTA 3SJZA 3NHBA 2ORVA 3B13B 4TMVA 3ZIAA 4V02A 4L4UA 1II0A 3ETLA 2VHQA 3GLFE 2XJ4A 1AZTA 2UKDA 1KI1A 4IKEA 1GTVA 2YWHA 2BV3A 2WKPA 4ESHA 3MFYA 3QNUA 1OFUX 4PZZA 3VU9B 1X8JA 3U4QA 1N2CE 1O3YA 3L8ZA 2KBEA 2XJ9A 3R8FA 1D6JA 5B57C 2IYTA 621PA 2D06A 3C5CA 4WA7A 3K70B 4DLZA 3JVUA 1SXJE 3TIFA 3VR1A 5JS8A 3NH9A 3DVLA 3W8RA 2GKSA 3R9WA 3UIEA 2JLUA 3QXCA 2BMDA 2F9MA 3CX8A 3CNNA 1JPJA 3FGNA 5DI9A 3AF4A 3EPHA 2VP4A 5J47A 3A6PC 1AJEA 5H70A 1KSFX 4DUGA 1BH2A 3CIOA 2R6GA 3SNHA 1IY1A 1VCIA 2K5UA 5DN6D 5DGXA 2CE7A 4CEJA 4CEIA 1L4UA 1SVSA 1K5DA 2NO7A 2QNRA 2WAXA 1P2SA 1T4GA 3K9LA 4IFEA 2D4HA 3ZQJA 3KTAA 3K9NA 3IDQA 3PEYA 1XD2B 1XFAA 3GEHA 4GP6A 4M22A 1DAMA 1YRBA 4GSYA 5M04A 1W48A 2PEZA 1OIWA 3HPRA 4PZLA 3FMIA 1KHTA 3VR6A 3BB1A 3GEEA 2GF0A 3LX5A 4JKYA 4PO8A 1Z22A 2GJSA 4X8OA 1GITA 4KAXA 4DLWA 2IHBA 4HLUA 1CLUA 2BC9A 1TADA 1GKUB 1OW3B 1W7AA 2FF7A 4Q4HA 2B6HA 5TY0A 4C7OA 2R65A 4AI6A 2VHTA 2F1IA 2HF9A 4P4TA 2QL6A 5JLJA 3U6KA 1L7VC 4BFYA 1TNDA 2Z4RA 3EWAA 3IO5A 4GOKA 2F3RA 4LHWA 4MUBA 3GEIA 3U3OA 4B2LA 1YE8A 2F43A 5LB4A 1K5GA 5J40A 1N6KA 5B2ZA 4G01B 4B47A 2C96A 1UDWA 4EKDA 1F6BA 4BZQA 5L3QB 3IIMA
chains in the Genus database with same CATH superfamily
2B21A 2CYBA 1ZUD1 4IYRA 3NO4A 1Q50A 1KAQA 2BKLA 3DW1X 4DLNA 2J3MA 2ZJOA 4JNCA 1UAAA 2AVDA 2QG4A 4QUHA 1FS4A 1MO5A 2JJMA 4EHAA 2QN7A 3VR4D 2JIQA 2W6MA 3QEKA 5HK8A 3H97A 1CDZA 2E87A 1N8NA 4W5NA 3I0ZA 3MWEA 1V8DA 3S6JA 1Z7GA 4ND2A 2VEDA 1BVHA 2WF9A 5BMVF 5AVUA 4OG2A 3KOXA 1O54A 4FZRA 3WZMA 4DDTA 4B3MB 2AR9A 3FI9A 3G5LA 3VC3A 2C92A 3VZBA 4Z4QA 4PLGA 5BN3B 2ADFA 1X1BA 4OBBA 2QAJA 3IBFA 4KLAA 1IBCA 2IHVA 3AONB 3D4LA 5HF9A 4EI8A 2SCUB 3WBKA 1HWYA 1QFYA 2XUZA 5FWXA 1E1RA 3RRBA 4OI4A 1MQ8B 2OUKA 4NOMA 1V2GA 1R6XA 2Y1EA 5C4IA 3E7FA 1WTCA 2VHVA 3OPVA 2O8CB 3DTNA 2O3TA 1FRFS 3BRSA 4DQXA 3PXGA 2FE1A 1SQSA 1V8PA 3B3AA 4D0SA 2J5KA 1KFBB 1YHYA 5JNSA 1GPNA 2CC2A 3T15A 3ZJUA 2HSDA 1HL3A 1K3FA 2K2WA 1XPJA 3ENQA 4JT9A 3M4YA 3OCYA 2QB5A 4L16A 1D7AA 5CHYA 1Y6FA 2QVZX 2BI7A 1ADGA 4MUXA 3MJTA 4OLHA 1OFHA 2QPTA 4ONEA 2WFZA 1QHGA 4MJLA 1X7HA 2CBZA 4BB0A 4LGYA 4PGHA 2PMDA 4NS1A 2IYSA 5KKCA 4LF8B 1ODFA 2JA2A 2NU7B 2I1LA 2PLWA 3SS7X 2AOUB 4L8GA 1PN3A 2AG8A 3VPDA 1FP7A 1P74A 3IUSA 4L08A 3ZVNA 2DH5A 3RS7A 3HMQA 1SAYA 4JR2A 3O4GA 3U60B 3WGQA 3C3EA 1OQAA 1QCCA 5U4XA 4O59O 2BDEA 1NT2A 2JJ2D 3CRQA 821PA 1CUAA 3PCXA 5DASA 5DHPA 4QAJA 5BV7A 3NPAA 5JFGA 3K70D 4C7BA 1W36D 4HDMA 3EOAI 1Y42X 3GZNA 4TSFD 2ERYA 4UUPA 1HEIA 1S2OA 3RLIA 3WJ2A 2V3WA 2IPLA 4FFOA 3L43A 1MKYA 3GFRA 1H2RS 4NOLA 3PYMA 3OIUA 3EBPA 2P2ZA 3WDKA 1VFNA 3HN6A 1J90A 5IJ9A 1ZCBA 4RENA 2XMSA 3DBLB 2YY7A 3MWYW 4TXJA 1Z47A 4A82A 3GT7A 4HUJA 3WRYA 1C1XA 1E7MA 1P8AA 3I62A 1SB8A 2XAAA 2FRXA 1E96A 3H8WA 5DCWA 5C32A 4M8IA 2RDMA 5ICSA 1G3MA 1B2RA 1SXIA 4TVKA 1V8FA 1IBSA 1LBIA 2Y93A 4LRXA 5EUQB 5G1PA 4AYWA 2V54A 2C3OA 2A86A 2QXUA 3AF1A 5IP5A 2WC1A 2ZT6A 2VUUA 5FO0A 3PC4A 1ARZA 4HH4A 3GT3A 3F2IA 4YREA 4HFNA 4BVBA 1S3IA 4KR9A 5FBWB 4DC1A 4UAVA 1NBIA 3BTUA 3HKDB 1WZNA 3P9NA 1KPGA 3B6JA 2Q6OA 1EA5A 1HFKA 2Q6IA 1RXSA 4EEXA 1DAGA 2EFEB 1WCIA 4MUEA 4E94A 2J9GA 4HDSA 4KXFB 2RMKA 4Y0AA 3P2JA 2J1LA 4HPWA 1DCMA 1Z18A 2FUKA 1AKMA 1W46A 1R27A 2FWMX 3D9QX 5ECWA 2QMQA 5A6SB 3STYA 2NYRA 2XA2A 1Q17A 1A9YA 4CL8A 4RMIA 3PHBE 1KYXA 1GKLA 1WVIA 4ZCPA 3T3IA 5LQAA 2ET6A 2R3SA 3KM0A 1FBTA 1VMIA 1ZXBA 3AR6A 3HC7A 3SOPA 3N58A 1EP2B 3TI7A 5DB4A 4D6XA 3BD9A 4MPDA 2OZLA 1SQ0A 3CRRA 4Q93A 3QXHA 2HWWA 1EFRA 2V0GA 3DMHA 3T1TA 1V96A 3IE2A 4G07A 1QE0A 3PNYA 4UNQA 2AK2A 3ZU3A 2C8KA 3AETA 1ZOPA 3GRFA 4S05A 1YBHA 3DXXA 1UKZA 1IDN1 2UZAA 1CU1A 4TS4A 1NMEA 4Q9AA 1R6VA 5K8VA 1PE0A 4L76A 4M1TA 2J3HA 1NAHA 3A32A 5ANRB 4ZMRA 3SC4A 1R8SA 3QU4A 5K6AA 4BTVA 2G76A 1P3JA 2I6TA 3HFGA 4JYCA 3C5EA 2KLHA 3RUAA 3WYBA 3RKSA 4HWRA 5JAIA 2DXIA 2J33A 1VKZA 4MV4A 3GJ0A 1U9YA 1EAYA 1Y5RA 3DNMA 3JD4A 4KO4S 3WZ2A 3QYPA 4CG3A 1CEEA 1Y9ZA 3E22A 1DIAA 1PR6A 1WCXA 3FOCA 3NAZA 2B0JA 4KB5A 4CQMA 3IL2A 5JJLA 2JCSA 4ZEVA 1HV8A 3L07A 3ZW8A 4KWCA 1M0EA 1BN6A 1E59A 4INZA 3KTAB 3VHXA 3U2QA 2PK3A 3DBRA 4NJOA 5CYPA 5T4BA 2SBTA 3WGHA 5JXGA 1Y6GA 4EK9A 1U0NA 2WHEA 4EZIA 1X92A 4R84A 3RBZA 3AYZB 4MW2A 4IGAA 3T4PA 3PPWA 5GJBA 4L95C 1BAPA 2Q9UA 3UW1A 4AMVA 3GRYA 2CSXA 3O1JC 2RGDA 3B6ZA 4B40A 4FI3F 2FR1A 3C3WA 5HQ3A 2BHTA 1B0PA 3IIKA 3UH1A 2AD5A 1LD3A 2PJRA 2ZBUA 1AURA 4O4LB 4JY7A 4YECA 3OKAA 1GPMA 1L5QA 3OUUA 3KBBA 1KP2A 3CRW1 4DVJA 5AUNB 3PXBA 4ZOCA 4WXYB 4CM9D 4YK7A 3D1JA 2FFRA 2IL1A 1PT9A 2WM9B 3GHHA 5B36A 2IGTA 1CJSA 1NQWA 4G0PA 1B1AA 1C3EA 1Y81A 3E3LA 3H9UA 1E0JA 1UKYA 4D96A 3EWIA 5JCJD 3OI7A 1DMRA 4US1R 5LDDC 2BR5A 4QGHA 1I1OA 1E2LA 1YULA 2R6ZA 4ER5A 5HJ2A 4PG4A 2HA7A 4IL5A 2W8BA 5A62A 2OBBA 3GGCA 3GDHA 3THYB 2YIVX 4OGGA 2D2EA 2QX7A 2OBLA 2XQFA 2GHIA 3EDRA 2Z3ZA 2HLDA 1U8CB 1E1LA 1ZD4A 4MEBA 1XDUA 5CCBA 1VYUA 1YDMA 2WB2A 1N78A 3I5MA 3FKJA 3DP9A 3UJPA 1T8TA 2DP4E 4XJTA 1LBSA 4E1BA 2XBMA 4R0MA 4HQ0A 4ZQCB 3WTBA 1Z26A 2PUDA 3MTBA 5A7FA 3R9XB 1MC1A 3VVLA 1TKBA 5KOHA 3PCRB 4TYYA 1Z4KA 3KKLA 3PC2A 2IKQA 4WESB 1AS2A 5BWBA 4Q4JA 4AKGA 1NJ6A 1K8RA 5IFKA 1J8DA 1PK8A 4RXMA 4K6HA 1GSHA 1O2DA 1QQTA 2NUBA 3FCUB 3K32A 4MB2A 4OTZA 3WQHA 4HLNA 3GNQA 3E9MA 1KVQA 3NYWA 1A71A 2H0QA 2WJYA 2ZYGA 2I5PO 2QTRA 4HX5A 4Y2RA 5DLDA 1SUAA 3I58A 1A69A 3FRHA 2AI1A 4KPYA 1DTEA 3AZPA 3X1WA 1KSGA 4YN3A 1RRMA 5H80A 4LYHA 3KQQA 3H87A 3GJZA 3NBFA 2UUPA 3O83A 4YQEA 5A1JA 1Z2OX 4E5KA 3BFJA 1QP4A 3V8NA 2XVAA 4FQ8A 2ON6A 3HZHA 4QELA 1US8B 2CLKB 2ZT8A 3EH1A 1SBQA 4I1YA 1EVYA 1Z4QA 4RD3A 1OAKA 3U62A 1L7OA 2PRZA 4G5HA 4JHXA 4QEKA 2PL5A 3KQSA 2MHCA 4M0LA 1WPXA 2PHZA 3DOUA 3O03A 3TLJA 1U04A 2GLXA 2I1QA 2OILA 3MWJA 3SXJA 3TCNA 3OJFA 4PYNA 3WKBA 4CM3A 2HD4A 1G7RA 1E7WA 4ENQA 1V8BA 1F06A 4GGOA 3AXTA 1TA9A 2X2FA 5SZIA 1PS8A 2C4HA 1W35A 4TS1A 1TA0A 2LRHA 3RTBA 2HHLA 1QTIA 1ZJWA 3KOUA 1MCZA 1S2NA 3D0RA 4M0CA 2LE0A 1HOTA 2CNWA 1MPXA 1R0XA 2ZZMA 1JBQA 1PZEA 2YXNA 4AY3A 4G0YA 3REGA 1P1BA 2ID8A 3UT5A 3TIVA 3VMMA 1AKVA 1JG2A 1FQOA 1TQHA 3GGOA 4L4YA 4MGKR 2O8DB 3QLVC 4NX2A 1VFPA 2FZKA 4XIJA 4QSHA 1MABA 3VQTA 3THYA 4IINA 3S55A 5DCLA 2Q2NA 1M73E 2QLMA 2R8OA 3PVZA 1X0XA 2VAVA 2WTBA 1L3CA 1NW7A 4E13A 1CY4A 1XDGA 2AA3A 1J1UA 2ZYTX 3E9NA 3ETCA 2FXIA 4G1MB 4LVCA 1DJLA 3MS7A 4F9FA 1XRSB 4EWLA 4TYPA 4Z49A 1O8CA 1H1TA 3DMTA 3DGEC 3K0HA 4KRFA 1W4RA 2ANBA 3E6AA 3B78A 1RAHA 3MXOA 3AFOA 3SNKA 4UMEA 2P3SA 2OA0A 3OTOB 1E1QD 3A1UA 1QFMA 1GTZA 2XMGA 3P9CA 5ITZA 3QOXA 2C3PA 3VGJA 2JZCA 4P4GA 4O2RA 1U4NA 3TO5A 3WJAA 5LFAA 1A9XA 3ADDA 1KZ6A 4PLZA 2Z2JA 3F3SA 2ECPA 5CTAA 5ENVA 2UYHA 4M9ZA 3BVPA 1S2MA 4B6SA 4H0CA 2QEQA 3R75A 1REQB 2PIAA 2FR8A 4KMOA 4TGLA 3VPGA 2NLOA 3ZNPA 4UM8B 3WO1A 3H18A 4B7ZA 3LDAA 1IEQA 4TWIA 4W5RA 3EPLA 4DFDA 1PG0A 2VWPA 1RPJA 4C0XA 3DQZA 1ATZA 2IOQA 4BNXA 1VRVA 5A9SB 2C4WA 2X0DA 1UEXC 4BP3A 2X7JA 4QNNA 3IULA 1Y7HA 2BM9A 3KYBA 3ZV4A 3LLVA 4MGZR 2F1KA 5SZKB 1YONA 1NXWA 1NONA 1F8FA 2C8JA 1Z45A 2XITA 4RKWA 5BNWA 4AJ4A 1K0UA 4K8OA 1JTEA 1T24A 1TA4A 3D5EA 3VVCA 1U2RA 1Z6YA 1MO3A 1CXZA 4LMPA 2GO7A 4QBKA 2NUPB 2Q27A 4PPNA 1THTA 3BSWA 1VJ1A 1O77A 1TGVA 1XUOA 5A0TA 5I8WA 3GARA 4Q6WA 2BSAA 2JDIA 2YW2A 2AQHA 2OGUA 4JJIA 2EFJA 4HWTA 1ANKA 4WCFB 2OLEA 3SBXA 5IFLA 4MK4A 1MORA 3JQ7B 4LDAA 4C1BA 4G4SP 1IM5A 3GW8A 4YJHB 5GOZA 1UZMA 2A92A 1DXOA 4RETA 5EYPA 3NHPA 3TAXA 3H5OA 4LISA 3BUSA 3N2GA 4ZKEA 1QQBA 2WFAA 4ZAWA 3K94A 1VA4A 2CXPA 4ND3A 2YJ6A 1X7XB 3CBGA 3BGVA 3C5VA 5IF9A 1OZGA 1OBCA 1Q7RA 3DUFB 4FHEA 4RE6A 2MU1A 5D3ZA 1X8LA 2FN7A 2XWPA 4LBZA 4RY9A 5HW0A 1YH3A 1FX0B 1JQ5A 3PTZA 3I09A 4B44A 4XDGA 4O1HA 1P2UA 3LXMA 3NKVA 1U6KA 2AXNA 3LCVB 4FR5A 4WDQA 4DHWA 3SBDA 5U9CA 4PYMA 2VKQA 2ZW9A 4MWZA 3UOGA 1L8XA 5ADHA 1A27A 1DIGA 3QMVA 2UYGA 4L8VA 3FCAA 4LI3X 5MHTA 2QD5A 2C5GA 1T5HX 5TQJA 1W0CA 4JVNA 2CD9A 4CLDA 5LBTA 1EX9A 2CNOA 1A8UA 4DJAA 5BR8B 2A14A 3A28A 3DL0A 4MGHA 5K0GA 3DEHA 1GPKA 5T3UA 1JFLA 3UJCA 3SG0A 4WXHA 2B82A 4WUVA 3NB0A 2EIXA 1S2LA 3QOYA 5H0IA 4B3XA 2TSYB 1H69A 4QUGA 1KO8A 4JUCA 1MRZA 2C77A 3AERA 3WGZA 4ZDIA 3RC7A 5L7WA 2N1MA 2C9OA 2RK4A 2REQB 4H7DA 3B52X 3LD9A 4AG5A 1VRWA 4N5IX 1HNWB 1G8HA 3TCXB 1EP1B 3CLSC 5PNTA 1DWQA 4DWWA 1P5JA 1SXHA 2G3YA 4NDZA 4YR9A 3IVAA 4QYIA 5LMZA 3HQ4O 3IESA 4O08A 5FUQA 1E2BA 1ZGJA 4X44A 2E2WA 2FRVA 3ABZA 1QR6A 4WY8A 1E2QA 5ICEA 3RSQA 3WS7A 3NUZA 3RWMB 3I2GA 2QAGA 4MQLA 4MVXA 4MW1A 4Q1FA 1ISJA 3BE6A 3IR6A 3RJTA 2C54A 4BUCA 5D5QA 5F64A 3QVXA 4LI0A 4HATA 2GD1O 4C5BA 4OYLA 1LPBB 5B3JC 4BCDA 5E7JA 3EYAA 1L4NA 4ITVA 2AMJA 1ZRMA 2YXLA 3ZCVA 4TS9A 4PBSA 2GPTA 1RIFA 4EG0A 2J5RA 3IE1A 1JR3E 4Z51A 4K3VA 3JATB 1C3OA 3L0DA 2CCGA 3AIOA 3FBTA 4FGJA 1OJ7A 3CNBA 5KTSA 3U7EB 5CHEA 5TQ0A 3E4CA 1R5OA 2AC7A 5CG1A 3QMMA 4UEJA 1K3TA 2IUYA 3LAWA 4EI9A 5KNDD 1BE1A 4HQOA 1N0UA 4K26A 1G0OA 1K8XB 1FX0A 3G17A 4KXNA 4X65B 1F8XA 3AHEA 1VHJA 3DLBA 3SIWA 3OAAD 2ZSKA 1XAGA 3DA8A 5LM3A 3GXOA 1A97A 4TMWA 4M60A 3KDPA 3JS5A 2NU8A 3EGEA 4PCVA 2WWWA 2HA5A 2ZBRA 4H6XA 1OB5A 5DRYA 4R7GA 2IEGA 2ZB4A 3L8HA 1ZVQA 3HWSA 3KZVA 2Q7OE 3V1MA 4DNQA 2PDAA 4G24A 2PX2A 1OB2A 1X7ZA 1VSTA 4Z9YA 5AVQA 3PDJA 4LHYA 1Z75A 1U81A 3CKMA 4BE7B 2QRJA 1GZUA 5D01A 2ZTVA 2QUZA 2WWXA 1Y6RA 4DA7A 4LXGA 1YT5A 4RZXA 3GJTA 2BR4A 1P17A 1WXHA 1PTJC 1I7PA 1YQDA 3DXFA 1VPEA 3I2YX 4RFVA 1M34A 4YONB 4QPZA 1HC7A 3B6KA 2FVYA 3OPQA 3FLAA 3HJGA 1OTXA 1EDBA 5B58C 1RZVA 3P96A 4EMBA 4LRWA 1NV8A 3GVPA 4AT1A 5CFMA 3R7WB 4TMXA 1ACJA 2ZSBA 1JSLA 1EA7A 2Y67A 2ZSIA 3MINB 1L6IA 2OXRA 2G0AA 2B99A 2FQXA 2APJA 3AR9A 5JC1A 5DTQA 3WQBA 2J9YB 1RP1A 4D3XA 3W9SA 2Q62A 5I4KA 3IT2A 5FPYA 3HB4X 3LJKA 2IYWA 4G0NA 3UBTA 2NO0A 3G5MA 5J4YA 3MWEB 1TYEB 4Y2YA 4QRIA 4RVGA 3URKA 4FB5A 1NR1A 3JWPA 4PN3A 2RHCA 4YQFA 2FCRA 2BEJA 2W6QA 2H07A 2H1RA 4KQ1A 3I3SR 4RLQA 2Z43A 7REQA 4IJUA 2H00A 1HZZA 3GAMA 4KR0A 4MKFA 5AK3A 4GZMA 5ALDA 1B8UA 4OLFA 4W1PA 4X54A 3D1VA 4O63O 4X3CA 5HS4A 1WCWA 4QX6A 4A2WA 1F17A 5SY4A 3VC7A 3PRJA 4C4AA 3BMOB 4PTLA 2VSOA 4F6CA 3DAPA 3ROZA 2BD0A 3K2EA 1XRRA 1QANA 4JA2A 3QVWA 3UHAA 3TTSA 1PDOA 1CJVC 2N46A 2WKWA 3RS2A 3JQEA 5B3AA 4DBLE 3GP8A 4TS3A 4RJ2A 4L0MA 4WVFA 4ECEA 1CE8A 5J63A 5AM0A 1Y3HA 4QQKA 2JGNA 1C9NA 2PS3A 4YP0A 4BQFA 1CRWG 2DU8A 4JJ8A 1SOMA 4KL8S 4P9NA 4PC7A 5EPOA 1EINA 1JEYA 1X7ZB 1LZLA 1Y5LA 4LBWA 1N25A 1RKBA 1M9NA 3LFTA 3QELB 1SHLA 3HKEB 1UWCA 1Z36A 3MGBA 4IDAA 4TLLB 1NLMA 3IUMA 4MLDA 5EESA 1KMQA 4Y6SA 4B31A 4AUMA 2JCGA 3GO4A 3O31A 4KOAA 4RAQA 4KXUA 3FWNA 2XHEA 5CIYA 4F96A 2Z0MA 4J94A 1NW6A 4ZEOA 4JDPA 2QX4A 5ALFA 2FZVA 1WNFA 3TQRA 5DT9A 2WNHA 4MUAA 4RYLA 3N1UA 2IA5A 1AZSC 3REOA 3U49A 3G0GA 1MT0A 1YZ3A 4FN5A 4ZO4A 5BSFA 5CH5A 4K6GA 1TFUA 5HUJA 1QU3A 3N87A 3DTVB 4O0MA 3K6KA 5H59A 3V3KA 4MUYA 3P0FA 2ZUFA 2Q2QA 4FBMA 1BQEA 3NV7A 1SMKA 2C4NA 2WA1A 1UEJA 2WD8A 3EJWA 2DSTA 2V98A 3F7NA 3I23A 4RS4A 3FFTA 1JE1A 4RVOA 5CM8B 5EXEA 4EOGA 1R8QA 2GCOB 3GUZA 1ZH8A 3HM2A 2JHAA 5K8JB 4QWWA 1M8FA 2BEVA 1J8MF 4EKGA 4LJRA 1CFZA 2EWVA 4F6RB 1QTNA 4U7DA 4X41A 1Y34E 3T9FA 2EW2A 1LBQA 2H65A 2M1ZA 2W2OA 3IERA 1H66A 1UCFA 2V7VA 6ABPA 3AUYA 10MHA 4LECA 4PC1A 2XOEA 3OFNA 5IXYA 2BFBA 2H9YA 2JFNA 3LRPA 1IYZA 2PZEA 3JQQA 4X20A 5KVCA 1OZHA 4CTJA 2GTPA 4ZOLA 3CURA 5KAMA 4P6VF 1DMSA 1ZU5A 1BRTA 4BWGA 4UZFA 4C0WA 2QMZA 3MFQA 4H7FA 1DELA 4KEAA 3COWA 2JL1A 3G13A 2QJWA 4B33A 1RKXA 1XEAA 2R5FA 2VLBA 3B8HA 4OXKA 3FYDA 4YUYA 3FFBA 2AN5A 1SXJD 2DY0A 2J9ZB 2PGDA 3KJHA 4F3YA 2BZ1A 2VF7A 3CKLA 2FN9A 3EEFA 2GWRA 3AJDA 5FPTA 2KBFA 3JRXA 2H52A 5CBKA 2ODWA 2FMTA 3HPQA 3V1KA 2QJTA 4RPGA 1LV7A 3RPEA 3E7DA 2HMUA 3IP3A 5HBGA 1TIPA 2GEVA 1SVLA 2I0FA 3Q10A 3Q7QA 4LJLA 5KS2A 2ZAOA 3Q12A 4BRWA 1W76A 2HRRA 2PKQO 3WL3A 5B12A 3U7HB 4MRMA 3HE3A 4BXOA 4RTNA 2WA2A 3IAXA 2SCUA 3B12A 5LD2C 3KSZO 2VAXA 3DWIA 4JK3A 2O3UA 2G88A 2QPAA 4GC9A 2IU3A 4OQQA 2G9VA 4LFAB 4LZZA 1JVBA 3ZVKA 3V1UA 3ROTA 3JALA 5G0VA 4DCCA 1SKUA 3FPEA 1YBFA 2P8JA 4K0RA 3UJ9A 1ATIA 3W8FA 3UM9A 5FOQA 4J43A 1AKTA 2I8LA 3OQIB 4H7KA 4FJ2A 3HVUA 3AEXA 4MIYA 1JVNA 3HJRA 1FLNA 2V65A 3CNQS 2YV3A 5YASA 1AZLA 4HGOA 3THWA 2JVJA 4XGNA 2F3TA 2F17A 2IXGA 5ALOA 1OLUB 2CF6A 4X7PA 1FQKA 2RHRA 3GLHB 2X19A 3SYNA 2AKAB 1RAAA 2VF4X 4UTXA 1V6CA 1QYWA 4GMFA 3LFUA 1VLLA 3ECAA 5DX8A 5BRAA 3ZJTA 1BZYA 4BEBA 2C4KA 3FUTA 2I3BA 2VHZA 5IKXA 4W5QA 2Q50A 1O97D 4G25A 1M2NA 4CODB 3I4FA 4DRXB 2WMNB 3PQ8A 2QGNA 4L15A 1EU1A 2C2HA 1USVA 1DRKA 3WB0A 1T8UA 2O0JA 4LXUA 1XXHB 1TMGE 2BFMA 4LK2A 4C0JA 1TMOA 2VAPA 3BE5A 3HB5X 4KK3A 1V9CA 3D6VA 4DLAA 3BZWA 1GPJA 5DSZA 4ER7A 2BM1A 2G08A 3ELBA 4B82A 4I81A 2PUCA 3FNHA 3JQGA 4R8SA 2YN4A 4YUWA 3Q8XB 4H7PA 2Q5OA 2V7UA 2A4MA 2PGJA 3T5PA 2D8MA 1JFFB 5KHAA 3TLZA 3Q6MA 5CA0B 2J41A 4G36A 2C7RA 4RPLA 1ZGBA 1N92A 4IIYA 3KQLA 4JLPA 5TEVA 1CUBA 2IXFA 1EAMA 2IYNA 3C8HA 4HX9A 4NZYA 2CL7X 3PKIA 4RKQA 4Y18A 4B48A 1DRWA 1F12A 1CETA 4Q66C 4P83A 4TX1A 2AX3A 2GUWA 1UKCA 1F0NA 5JASA 3R0JA 1ZMXA 3ICEA 1F51E 2L18A 3FGZA 4XLLA 3OE1A 4GFDA 1LDEA 2O9JA 3DPUA 4EW3A 3K53A 3H5AA 1BDBA 3G88A 4HNAA 4WESA 5H3HA 1WUIS 5K3CA 1FNSA 2X6RA 1II8A 2YUTA 3ZV6A 3UTDA 1GFWA 1KS9A 3V4LA 4OLAA 3EGCA 3CNHA 2GR9A 1VIMA 4FCCA 3S8MA 1GP2A 2FEOA 4KN5A 5BNFA 3UK6A 1EFRD 1NWCA 1GNTA 4X6XA 1ZITA 1DQPA 4TV8F 4OBXA 1JFSA 1QX4A 3P1JA 3T95A 2DWOA 5ESRA 3GYGA 2JVIA 3WNCA 4OHPA 2NTVA 4ARIA 4B3FX 3C43A 2EX1A 3VU9A 2D59A 3PSHA 1U94A 3OEED 3VDNB 3VDQA 3PGXA 1XYGA 1Z9BA 2QRHA 3WE7A 2ZRLA 1YR8A 1P7PA 3C1TA 2QBYB 3I2JA 1HDCA 2REXB 4R8RA 3ZV5A 4RCZA 1AO0A 3OP1A 1CUYA 1SHUX 2ZEJA 4YDHB 4NI5A 3RU2A 3CUEF 3PIDA 5FLEX 3PG5A 4XIYA 4URVR 4NE9A 1FUUA 2JFOA 3C3DA 3JW8A 2XGOA 1UT8A 3KRTA 2VTDA 3SEFA 5CB4B 3SJCA 3CLVA 1GGVA 1P4HA 2H17A 2ZJYA 2VQFB 4QFBA 1XQ1A 3FNBA 2QZ4A 4XLTA 5FRDA 5GIOE 4MGIR 2XMPA 5CT6A 1O6FA 1SWVA 2WJGA 3S2UA 3VI3B 1KQGA 1V3TA 3NP7A 3EIOA 5GINE 4CKWA 1AMUA 1ABEA 3JYNA 2GNAA 4IBOA 2AHOA 3MPUA 4TTQA 4HDAA 4M49A 1A1VA 5K0EA 1NQXA 3FCEA 5FDFA 3LP8A 3SIPA 3BC1A 3V2UA 2CLMB 4NJEB 1MEJA 5TV2A 1U1CA 5KUTA 2QQGA 4YJ2F 3VR3A 1K92A 5AKXA 2WB4A 2NGRA 1ECJA 3CMCO 3WY9A 4TWBA 2PUVA 3EGWA 3TLKA 3ZZMA 1UAYA 3ZHCA 5JSUA 3A0RB 5IDXA 5JH7B 3S7TA 2FZ5A 4OGFA 1WCYA 3C45A 4MVJA 4OHZA 1KARA 1R37A 2BYTA 3WLMA 1UBGA 5KVQA 4B7CA 3AC0A 4RHCA 4N8SA 4CKXA 1PFKA 3HGQA 1GARA 3N8NA 3K20A 3RV4A 3BIWA 5HMMA 1UDBA 2O5VA 1ECCA 3JD0A 2WVHA 4KG7A 4Q9JA 5G0UA 3RGGA 1NULA 4AROA 3KYDA 1IXRC 3GLHE 1MJFA 3G1WA 3L2OB 4CIAA 1VOTA 4C89A 4BGDA 1E4YA 1T0PA 1DP4A 2IYRA 4NG5A 4V0RA 1N1DA 1C3LA 2GEFA 1YDEA 1FSZA 1LK7A 3E58A 1TRKA 3DHYA 3FR8A 4GVXA 3TB4A 3VMFA 5H8WA 2RAFA 4XUEA 4PAOA 4PIVA 3SDZA 1U7XA 4NF2A 2ZB8A 2WIAA 3PNPA 4DNOA 2R2GA 1L5SA 3Q2IA 1ZXLA 4ZQIA 4D81A 3NP9A 4ZO7A 2R7MA 5C18A 1GSIA 1W2WB 2AHRA 5IBCA 2CGEA 5A5GA 3GLFA 5ERYA 4NV3A 4G1VA 4YAEA 5K45A 1KZYC 1W75A 3BX1A 3IQIX 3KYDB 1ECBA 3FMOB 5CW1A 3V6MA 2QYHA 4IHQA 2PZJA 1GFZA 1W8IA 4QNRA 2VQSA 5NLLA 1P7ZA 1OH5A 1M66A 3CPSA 3E0XA 3L49A 4I5EA 1FF9A 3HN2A 1WETA 3DQPA 4IRMA 3DUWA 5JLAA 4E46A 2O23A 1E3WB 1T5OA 1P91A 1V1RA 4NBLA 4DLLA 4PS1A 1KZ7B 2J6IA 5KOHB 4XM2A 1AG9A 4XCXA 1L3BA 4BZWA 1ACMA 2W48A 3K09A 5A0FA 3R7AA 4IUBS 4D56A 4U7HA 3TIGA 1R4MA 2GAOA 1JZQA 1M1UA 1UZNA 3KB6A 3AR2A 1DARA 4U7GA 3COJA 1Z2CA 2XSZA 4DT1B 1SUBA 3DDZX 3TRFA 5FAXA 3OBIA 4ARVA 1RM3A 5EL0A 2YOHA 5JVDF 3E1KA 3C6BA 4NG4A 4RSMA 5IWCA 4BVHA 4Z7OB 5H3LA 5BOVA 1SBNE 2A9KA 1KBOA 1LS1A 1UQRA 1N6PA 1WXEA 2HDNB 2Q07A 2VDRB 3GBPA 2IZ7A 4P92A 2WD7B 3MJHA 4BQNA 5ES3A 2O19A 2IIQA 2GYYA 1UJBA 3CX3A 7GPBA 3GJRA 1G8FA 3GFTA 2VPIA 4QASA 3T0FA 3OQ6A 1FFAA 3C6XA 1H2WA 3WWYA 4UJ3A 1PX2A 2QGFA 2ZJ7A 1FZTA 1PFQA 2LCFA 3M9XA 4XGKA 5GONF 3WNZA 4F06A 4F2HA 1S5PA 3KD2A 1CY8A 4JZYA 4E4YA 1DBWA 2AR0A 3GRPA 1ZJYA 3HJHA 4FYVA 3T7TA 1U0LA 1WB9A 2ZETA 2B5OA 4GQIA 1Q7GA 3RE1A 3I9NA 1YS1X 4IDEA 3ZWVA 1SOWA 3CF2A 1OV6A 3KKMA 4I4LA 1T1IA 1WUJS 2RAVA 3F47A 1SQ6A 1ZW6A 5SV2A 2O57A 4KO1S 3QSYA 1E3JA 1L7XA 2VXYA 2XLCA 4TUYF 3V1YA 4OMDA 1WAMA 3M81A 4N39A 1P19A 4J3JA 5F76A 3H04A 2WYHA 1EE1A 3A10A 2H16A 4MJ7A 3DAFA 3MOGA 1KI8A 4FEGA 1VHLA 4B4WA 5FFFA 4AZTA 1E6LA 1E4OA 1EVEA 2L82A 3IVGA 4C6TB 3GAAA 1O57A 1K63A 2B9EA 4D74A 5C1BA 4CKZA 5H7XA 1KL7A 3T8YA 2EZ8A 5KNBH 5B2FA 1AS3A 4YJKA 3HRHA 4Q47A 4A5OA 4RIEA 2GBLC 2GZMA 3F5SA 2PRJA 4X0EA 3D7NA 1MVLA 1Q20A 3OCWA 4L8WB 4ZJZA 3SSAA 4DCSA 3KDAA 4WW0A 1DO2A 3LZCA 2OGZA 4ZANA 4EMSA 1JX6A 4GPBA 2VF5X 3V1LA 1DAIA 3ZWPA 4DDVA 3SHWA 4UDXX 4AUKA 5B7PA 1I3NA 5C31A 1YJQA 5EEGA 3RKUA 3OEHA 3HP1A 2I1VB 3HBLA 4KQFA 2VHEA 2VO1A 3ACCA 1M76A 3B6EA 2NSJA 2YFYA 3DL4A 1OUMA 1N2IA 3GZTB 1GNPA 4QJIA 4UJ5A 4UNPA 1WPQA 5KQSA 3EGIA 1NLUA 3F5DA 4WFQA 3CKYA 3CLTD 4LUCA 4B81A 5LL6P 1B23P 2OLKA 1F3LA 3M8KA 5F5LA 1NN5A 3IAM6 4MB0A 4JNKA 4N0DA 1NVDA 2F1OA 3UCEA 3HM9A 4CCAA 2W00A 2BEUB 2FFAA 3BMCB 3WLRA 1LSOA 4MI9A 4JSRA 4B3RB 4ZTBA 2X2OA 3EVDA 1X1SA 5KVAA 3FNQA 3Q7SA 4NCAA 2H3EA 2A9JA 1E79D 5AUQA 3AVWA 3NM4A 5BSHA 3O74A 4QHTA 2AN9A 3HKEA 1VYTA 1K6MA 1P9WA 2AZMA 3IR7A 3WIVA 1SUIA 2H08A 1KQPA 2C7QA 5LQRA 3LYHA 2ZRCA 2H48A 3N74A 3MGKA 3SLRA 1JAXA 4J1TC 4TWJA 4Z9BA 2BHNA 2ZRQA 4PSKA 1E3DA 1ZJ6A 3N05A 3WMXA 3ZGNA 3ZQKA 4BLRA 1XJQA 4M21A 3U3KA 2VPTA 4WK4B 3B5JA 1MLDA 3QBTA 1L4KA 3UENA 3ZS8A 1GKIA 1POWA 4NBSA 4EENA 3M4JA 1IXZA 1HNZB 2IF2A 1JLKA 3OLYA 3JQBA 3E5HA 2CNDA 5BYAA 1QRSA 4JJKA 1HDXA 2XUJA 4CCSA 1MO6A 4KGVA 2OV1A 4C22A 2GS9A 1WS6A 4CMHA 1FY2A 5AKZA 2VP0A 4LSWA 4MV6A 3T7JA 1T5SA 1D5CA 4K81B 2XI4A 4G23A 3LNTA 5D87A 3TQCA 3OC0A 3FVVA 1YZLA 3WWDA 1C7QA 3CY6A 3W2EA 2Z1NA 3PGKA 4EO9A 2G7ZA 4QYIB 1NG1A 4KV9A 4OYYA 1OBHA 2GNPA 4PAQA 4AO8A 3VNBA 4UHBA 1B6TA 3PEWA 2B20A 4LGMA 2ZI3A 2JGEA 4JU8A 4B5KA 5DM70 3LY9A 5KQLA 1JEDA 3AI2A 1YDHA 3UUGA 5CNIA 4F6RA 2QRPA 2ARKA 2A33A 3KSBC 1XNRB 4PRYA 4H0NA 5JV5A 5H83A 3JSXA 2JS7A 3IDAA 2XRZA 3DEFA 4C3ZA 5IC5A 5LUAA 2G8LA 1OC4A 1EB9A 2RKBA 1XXHE 1DWPA 3ZDCA 1KJZA 2CFIA 2VATA 3PQ3A 3LC0A 4D6YA 4I55F 4IQFA 1XRMA 3TOXA 4CMIB 4RF3A 2ZSUA 2VAMA 3TLMA 5KQPA 1NBOA 1Y9EA 4F1JA 2W6OA 3NVMB 1GRNA 4DF3A 3LKVA 5I47A 3T3EA 4UNIA 2EG9A 3M4ZA 3NT4A 4I55A 1DQYA 3ZYZA 2GEDA 4DMKA 4JP8A 2QD3A 2VJCA 1B2LA 2VPWA 4M38A 4WKNA 3H0EA 3QOFA 2B2CA 3FSGA 1SRQA 2A9RA 3PICA 1P7WA 2O7QA 1P62B 3OX2A 3D6UA 3LHIA 4XYLA 1BRMA 3KQYA 4OGKA 2X8JB 3TSAA 3ADOA 3TAHA 1XMIA 2HKIA 5BV0A 4LA4A 3ZW7A 2W42A 1L5NA 1RJWA 3H2IA 3TZ6A 2VDJA 2LD4A 4BMDA 2G8NA 2P4QA 3M6IA 3VXKA 2W6IA 3CLUD 3GQVA 1AA9A 2AK3A 2CUNA 3LQFA 4JN6B 4GQBA 4MUNA 5JHHB 2ACWA 2EC5A 4OJTA 5K7SA 1E2MA 1YR6A 3GPBA 3QEBZ 1E18A 1GNLA 5EXTA 2MYNA 3LBAA 3MXTA 2X4GA 3F98A 2G1UA 4A26A 4QC2A 5FUMA 3KQOA 3WAJA 4P3YA 4TXNA 4DRZA 1H0RA 3UMMA 4GKKB 3WLFA 1GUZA 3IXMA 3L7OA 5CT8A 3U4GA 4MP3A 4I6EA 1XYYA 2J3LA 4TWZA 1MEOA 1QJCA 2WU3A 1WBBA 3SIRA 3FVQA 3H05A 2OQVA 4J8PA 2DX7A 1IN6A 4D9IA 1JWLA 1TRHA 2KQUA 2ZJFA 2BJWA 1WF3A 4P5EA 3ZJ5A 2FPOA 1PNQA 3K2IA 1S8OA 3KEMA 2QUHA 1ICEA 1Q2XA 4K9NA 1B3RA 1LS6A 4OQXA 1E0KA 1PFYA 1QYXA 1QOZA 3D8UA 3I6BA 3IBGA 3IVCA 2XKJE 3M6XA 4ZEWA 1H2XA 2WJIA 4MJXA 4BE9A 4F2GA 1GT6A 3ICOA 4ID3A 1W93A 3KJZA 1G20A 2GUGA 3I32A 3KUCA 3QF7A 3N6XA 4FFBB 1JEEA 1JHPA 1NTRA 2J31A 3UCFA 3GUYA 3ADKA 1K7XB 1L5HB 5KYVA 4BRUA 4LCJA 1UFVA 2O20A 2OD7A 1FMLA 4MVJF 3RV3A 4C9BA 4DCJA 1UUFA 2O48X 4NEQA 2EP5A 4D4KA 4DQDA 4YRGA 2WSSA 3CF4A 5FOUA 1YI0A 1LFAA 4RFLA