1VG9B

The crystal structures of the rep-1 protein in complex with c-terminally truncated rab7 protein
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
174
structure length
169
Chain Sequence
b'KVLLKVIILGDSGVGKTSLMNQYVNKKFSNIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab proteins geranylgeranyltransferase component A 1
publication title Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding/protein transport
total genus 60
structure length 169
sequence length 174
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vg9B00
2BMFA 1XCMA 2O8FB 2HJVA 2ZRKA 1WE2A 1N5JA 3T61A 1QHIA 1E9RA 1II8A 4URWR 3TUIC 3QKRA 4A6XA 2MSDB 3QKSB 4S2EA 1PV4A 2GA8A 4PPGA 1QVRA 2AXPA 4QJ4A 1GFIA 1YR6A 2VLIA 3UWKA 4P31A 4P0TA 1NY5A 1OXXK 1RE0A 1YR9A 2NZ8A 4HZIA 4LJ9A 5JCPA 2QMEA 4QBFA 3QXHA 3E2IA 3F0TA 3HR8A 1ZM3A 2JLXA 3VR2A 4DSNA 1UFQA 4E03A 5B30A 3B85A 2CEAA 1CBUA 4NCKA 3MAAC 1E2PA 3HPQA 2VP9A 1OW3B 3EA5A 3P26A 2YC4C 3GJ7A 3RS7A 2IT1A 2PCLA 2YV5A 4ON9A 1XTQA 4JLDA 1E2GA 1KKLA 2ZU6A 3OIVA 3MCAA 3K9GA 4C9BA 4M8NE 4IFEA 3U3OA 1CJVC 1KK2A 2ECKA 2OT3B 4NYIR 5KNBA 1ZP6A 4LDJA 2PEYA 1HQYE 3A4NA 3IHLA 821PA 4URZR 4AKHA 5E4FA 3ND8A 3WY9A 1T3LA 2N1BA 4AY2A 1CF4A 1E1QA 3QXJA 3K0AA 1Q1ZA 5E7MA 3RYTC 2ZYWX 4JJKA 5D3MA 4ZIRA 2ZRFA 1DAGA 1Q1QA 2XNDD 3W8RA 3THOA 3A6PC 3N2IA 1K5GA 3EPJA 2C8VA 4PO1A 3PG5A 3SNHA 2G6BA 3RAPR 5JCZA 4IEIA 1W0JA 3JVUA 1GKUB 2P67A 4QKQA 1OSNA 1D6JA 1II8B 3BBPA 2ZXUA 3GFTA 2K5UA 4BPBA 1Z29A 2ZRPA 4US0R 2BBOA 3QJYA 3I4LA 1X86B 3Q9LA 4Q7MB 5BN5A 1XDBA 1Z28A 3L0PA 1IY0A 5FBQB 5CYOA 1ZD8A 1XWIA 2HF9A 2GZHA 3CF6R 3L43A 4C2UA 3VU9B 5LB4A 1QHHA 2WMNB 3LVRE 2J45A 1G8FA 3A8TA 1G5RA 1R5NA 1XZQA 4A0GA 5FL7A 2JASA 3SYNA 4IXMA 1ZUNB 4F92B 3SYLA 2OFXA 1E2KA 1JEDA 2MSCB 3O8BA 5CLLA 5EZ5A 3M4YA 4I81A 1ZC4A 1L7VC 3PJRA 5IT5A 5J4HA 2QUZA 2XSZA 3CKLA 5C1BA 1VCMA 2TMKA 3B2EA 3TW4A 1T91A 4RKFA 1OIWA 4I99A 2R44A 4M1KA 2CCKA 3ADKA 3OZXA 4TMWA 1DTSA 2UVQA 1GOTA 721PA 3FE2A 2RH5A 3IKJA 3L82B 5DE3A 5DI9A 3W34A 1GIAA 3K0AB 3THWA 5SZKB 3W6OA 2GJSA 3JVVA 4HI0E 3I8XA 4ZCLA 5DHFA 2RGNA 1G7SA 1VHTA 3LQRA 5D3MB 2IYXA 3GJ5A 1G6OA 1MABA 2CE2X 2Q6TA 5TB5A 2QSZA 3WRYC 1J70A 5JRJA 1NG9A 5J4KA 2YNMA 3Q72A 4NCNA 4BZQA 1IN6A 1G21E 3B78A 1RFLA 2XTZA 3TSZA 3AVYA 1QF9A 3EZ9A 2ZRCA 3UANA 4GZLA 2G0TA 4WIAA 1X8KA 3ZZUA 1EFUA 4S35A 1JXOA 5FI1B 3PEUA 4RCYA 2JJ8A 2RGGA 1Z63A 2RGDA 5AK0A 4DLSA 3QPWA 4JYBA 1XPUA 3MWYW 3VMFA 1X8LA 2DR3A 2P6UA 1GM5A 1KNQA 4Z8YA 2FX3A 4B2PA 4FCTA 5K8IA 2QRZA 2ZE5A 1FUUA 2UKDA 2OFWA 3TQCA 4B3XA 2P5TB 1YVDA 1KZGB 1DEKA 4B48A 4HAZA 2GZDA 4NONA 5EZ6B 2Q3HA 3UMFA 1GZSA 2IF2A 1NSTA 1W47A 2VRWA 4Q9HA 5FFMA 4MYCA 1DE0A 5F98A 2JIZA 3LBIA 1P2SA 1ZNXA 1SXJD 3HJNA 5KSOA 5IK2A 3I5YA 2BJVA 2GJAA 3OESA 2EFCB 1R7RA 5JS8A 4HZUB 2A5GA 2Z83A 5TMPA 3CX7A 1MO5A 2D06A 2F43A 3E70C 4D4LA 1U0JA 3SJAA 1P73A 3WNDA 2OCBA 4EPWA 1Z0IA 3LY5A 2J0UA 4XIGS 2OLKA 2OBNA 3W90A 4CT5A 1E9BA 1HH4A 1NSFA 1EG7A 3QVUA 4GI7A 2FA9A 2ZSDA 1KI3A 2QAGA 2CLSA 4MUAA 5DI3A 1O3YA 5FPHA 2ZJOA 4QRHA 4TYQA 3THWB 1MOZA 1GNRA 1W5SA 2GXQA 4ZI2A 2C78A 2WHXA 3ICQB 3Q5DA 2YJTD 4MRNA 1D5CA 3LFUA 1HQCA 1KO1A 2I1QA 1WCV1 3KXIA 3SJCA 4F4IA 1Z07A 4RFVA 1Q20A 4HLDA 4X8LA 4AYTA 2QPOA 3A58B 4ZDIA 2J3EA 5EUMA 4OHWA 4EQ6A 1U94A 4L9SA 2XJ9A 1W44A 2J7KA 4LBVA 5A4JA 5TDHA 3RDPA 3OE7D 3FVQA 4V0MA 3KKMA 2NO9A 4NMMA 1IXSB 2XOKD 2VHCA 3QVVA 2PMDA 2AWNA 3A4MA 4DT1A 3QKUA 3U7HB 3MG9A 2HUPA 4PZLA 1GWNA 1G6HA 1I4LD 1KAGA 1OYYA 4L5BA 1KMQA 2F9LA 1AS0A 3PUWA 4MGKR 3A36A 1NBMD 2V9PA 5DN6A 1KK1A 2Z4RA 3HR7A 1KSFX 3LQQA 4B73A 1CJKC 1P9RA 3QF4B 4HDCA 3GFOA 2A30A 4LRWA 4PO8A 3BXZA 2F43B 2FSIA 3GLGE 1W36B 4Y0AA 2R2AA 2KBEA 5CB6A 3SR0A 2A78A 5G41A 1G8GA 2J0UB 2ZAOA 5LD2C 1FMLA 3RC8A 1E9EA 3ZZ0A 3O8RA 1ONBA 1GL9B 2BC9A 1CU1A 1R0YA 3CO5A 3AVUA 1YHNA 4JIMA 2ZQ5A 5DI3B 2X77A 2QAGB 3NG1A 4AD8A 4B76A 4QOSA 3CUEF 2HXSA 1Q3HA 4YMTA 2VHUA 1AIPA 2J7PA 1KK0A 2ZU0C 1I2DA 2CJWA 4HAXA 4BLQA 2P3SA 3L8YA 2PX0A 1RRCA 1FQJA 1RC8A 1PZNA 3WXMA 4G1UC 4EQ6B 3V4FA 1X6VA 1XJCA 1KHTA 1E9DA 1TUIA 3ZVNA 1RPZA 4PSKA 4NTZA 5JECA 1P2TA 4NKRA 4H1UA 3B5JA 4Q1DA 4OQFA 2V7QA 4QGFA 5AJYA 3B1XA 4DT1B 3TGPA 2ZJZA 2P2LA 4DLUA 2IWHA 4MDEA 1LY1A 1YZNA 4M2LA 4TMTA 5FBVB 3WMFA 4ZIRB 3AF1A 2O8CA 1N6OA 3BD9A 2V3CC 4BFYA 5FOVA 4L9WA 4DSOA 2ZRLA 1GL6A 1Q1BA 3TMKA 2QBYA 5LB2A 1ANKA 2YWHA 4PSAA 2IYSA 2B8WA 4IEEA 1XP8A 2DWPA 1CIPA 2J41A 1W5TA 3L0IB 3NEJA 4RFSB 4ZDWA 4FCVA 4WW0A 4DDUA 4B2LA 3WMEA 3AH8A 3DHWC 1JALA 4IHQA 2NO1A 3REGA 3EW9A 5AUQA 3SYKA 3PUYA 4FCWA 5DLQC 1G5TA 1Y63A 2IC5A 2B8TA 1OFIA 1ZM9A 1KSGA 2VP6A 4PHTA 1OXVA 1N5KA 2IYLD 2PJZA 4O2RA 4Q9KA 4ZDJA 2PLRA 2XGJA 3RWMB 2WBLC 2CJWB 1TL7C 4WXPA 4O2LA 2P5SA 1E6CA 2IXFA 5CM8B 2JA1A 5AJVB 4PC7A 4GT1A 5H70A 1BMFA 1NN1A 4B34A 3QY0A 2G3YA 1LF0A 2DPXA 2G77B 1NY6A 4ACAA 621PA 4A8JC 4OI0A 1DAMA 1E79A 1EWRA 2ZS9A 4IXNA 4PANA 4UXHA 1E9AA 5FI0B 5FTLA 4FWTA 4CEHA 2WJGA 2GF9A 3MWJA 4PQYA 1G20E 4J0QA 4C0SA 4AKGA 1FUKA 3BB4A 1YR7A 4PR0A 4YQFA 1Y3AA 2XNDA 3LX8A 1NJFA 2ZSEA 3B9QA 4IOLA 1U90A 2J0QA 2O8CB 1LS1A 1CR1A 1CRPA 1SVOA 1VCOA 2V6IA 1KYIA 4Z54A 4MKIA 2YKGA 3AP1A 3FKSD 1JAHA 5HE8A 2GAOA 1BYIA 2H16A 3K9NA 3THXA 3WBJA 3GJ8A 3VX4A 1SVSA 4I1UA 4JT2A 5FOUA 3GPLA 3X1WA 5JI3E 2ZSAA 2FZ4A 2Z6VA 1FNMA 1PJRA 4Q47A 3ADBA 1K5DA 3ETLA 4NYMR 4PSVA 2RHDA 2XB2A 2CHQA 4LJ5A 4BFWA 4DRZA 4ESVA 1T9HA 2J59A 1XCPA 4XTRA 2OSBA 2FJUA 1TEVA 2R8RA 1U8ZA 1IJEA 2F9MA 3FOZA 3DVLA 3K70D 1QDEA 1Q44A 3T1VA 4M21A 4B44A 2GDJA 1U2RA 2HJGA 5FH9A 1XEFA 2C5LA 1IY2A 4DLRA 1NP6A 2KE5A 1OB2A 4NYJQ 4Q48A 3R9XA 3D8BA 1XB2A 2YHSA 2WJJA 2IXEA 3PCRB 1E69A 4MA4A 3QG5A 2V8OA 2NO0A 5CLQA 4DCVA 2HYIC 1UADA 1II0A 2IBMA 2CDNA 5AUNB 3I92A 5FL3A 2WKPA 3IBGA 3NBZC 3PV0A 4QM6A 4CEHB 4NE2A 3FKQA 3SBEA 2YOGA 1JNYA 1SGWA 2JCSA 4YXWA 2BV3A 2PT5A 4JSTA 3KKNA 4M1MA 2YWGA 4PO9A 3U6KA 3MMPA 2PBRA 1WQ1R 1XMIA 3X1XA 1VHLA 4FMBB 3G82C 1X3SA 4JS0A 5EUQB 4BGDA 2ANBA 1LTQA 1XTJA 4MRSA 4LBYA 2BIFA 3W6PA 3ZYCA 1KDTA 1Z0JA 3IGFA 2JLVA 3U2QA 4JVNA 4OJKA 4EPYA 3BIFA 1G3QA 2G1KA 4Q9JA 2EFHB 2XZLA 4QGAA 3VTKA 1IN4A 4DVGA 1VYUA 3THXB 4ZCIA 1WRBA 5AUOB 1VIAA 2JEOA 4YLGA 2QN6A 3OHMA 2C03A 2ORVA 4MITA 2B7CA 4M4SA 1XXHB 5GJCA 3ZVLA 1NIJA 2IYQA 3A4LA 1IN5A 1VG1A 1G7TA 2IHYA 3BFXA 5BN4A 3F5FA 1TAGA 1EK0A 1U0HC 1XD9A 3R8FA 3GLFA 3SFVA 2YWFA 4MGIR 3W5JA 1IXZA 2ZEJA 1OH5A 4CF7A 2FSFA 3DM9B 2AHOA 2OCAA 4TMVA 2RB4A 2AKAB 2AXNA 4G3XA 2I1VB 3I8SA 3CLVA 4M1WA 1R0ZA 2P6RA 3U44A 3CR8A 1OHHA 2ONKA 2OE2A 3RABA 2JJ2D 2YWEA 3QSYA 2ZRAA 1DAEA 5FOTA 3AKDA 3EC2A 3RS2A 2ZI9A 2YVUA 4XVQA 2V54A 4MGYR 2CE7A 4WVFA 1EFRD 1UDXA 4BLPA 5EJEA 1ESMA 3VHXA 3B1WA 2NPFA 2UZ3A 1MRSA 2ZVPX 1FQKA 4GRAA 4XD7D 2ERXA 2J9RA 4KSCA 3WMGA 3NC1C 5EP1A 1UBFA 1L4YA 5KHOC 1G8YA 3WRXC 1SVKA 2ORWA 2XZPA 2HCBA 4LYHA 2VSXA 3SJBA 4DEXA 2L0XA 1Z2CA 1E9SA 1JEEA 4QGHA 4Q1BA 3QUSA 2CVFA 4G5QA 4KV9A 2CNWD 2WAXA 4LI0A 3WNCA 4A2PA 4DLWA 2R6CA 4U7DA 1CP2A 1W2HA 3EASA 2GCPA 2QMHA 4JKYA 1SVIA 4QHTA 2F1RA 3AGPA 1P2UA 1T3SA 3R8CA 2KJQA 3X1DA 4M9ZA 2GRJA 3T12A 1HURA 3B60A 2AX4A 4M1TA 1KO7A 4AKEA 1L8QA 3PENA 1N6PA 3BERA 3LLUA 4PXAA 4RZ2A 4B3CA 3GLFB 2IA5A 2KB0A 2FSGA 2ONJA 1CR2A 2AD1A 4JVSB 4UXIA 2C2HA 2O8FA 2DFKB 5G40A 4X8OA 2N42A 4Q00A 3DL0A 2IUSA 3U3MA 5HCIA 3B6EA 3A1TA 2AKYA 3CH4B 4B43A 2IYZA 1FP6A 1HTWA 3P20A 2F55A 4IFBA 4P32A 3KFXA 2JJ1D 2VPPA 3V4RA 4GFDA 2HLDD 2IS1A 3O47A 4GOJA 4N0DA 3RRZA 2W6JD 1NG1A 2P6NA 4LSGA 3AKCA 2VIIA 5KPJA 3EPKA 2O0JA 1MKYA 1G1MA 3BE4A 1Q0UA 1S3GA 1AQUA 4HB4A 4JLKA 2FFBA 4OI2A 3TR0A 1Q21A 4M9QA 5EP2A 1N6HA 1G4AE 1I4TD 1T0HB 2PT7A 4JL5A 4N3NA 5HKKD 1QHXA 3U3KA 2NOAA 1OKKD 4HLCA 4W5WA 4RVCA 4C4PA 4JSYA 2VO1A 4ZO4A 4M1YA 1QHNA 1A5TA 3TAUA 5DNYB 2FDCA 4W5HA 4EPTA 3A1VA 1JR6A 5FUYA 4FI3C 4LOAA 4QNRA 4DLYA 5K8LA 4BEJA 4Z8XA 1E2EA 3B1ZA 4QHYA 1W49A 3GMTA 4MYUA 4V0ME 5KDDA 1R5BA 4DCSA 3FMIA 1NMXA 3VX3A 4TMXA 3IEVA 4B6FA 1NLZA 1G18A 4QXAA 4D4KA 3SQXA 2DFNA 2DWQA 1F5NA 3H1TA 3KUCA 2NZJA 4WZBE 3SBDA 2PZEA 4IOKA 2RGNC 1OF1A 1U9IA 2FGJA 4W7SA 1NL3A 2HXYA 4DBLC 4A15A 2GK7A 3VKGA 1F2TA 2MMCA 2WV9A 1LS6A 4WAUA 4Q01A 2IEZA 1IN8A 3QQ5A 4NZYA 2JLWA 1QG4A 1E2MA 5KOYA 1XTRA 4EFNA 4A9AA 3P27A 2GVDC 2LKDA 2GWHA 5JJLA 3EPLA 3F8TA 1YZUA 3C5CA 2UZIR 1KJWA 4C0HA 3CRMA 3KJIA 3DEFA 2FEOA 1JR3D 3VU9A 1HT2E 4B33A 3GCGA 1G3MA 3QBTA 4A0RA 2FG5A 1HV8A 1G291 4AKIA 1MT0A 2Q3MA 3VAAA 3P1JA 3ZZTA 1Q1EA 4ABYA 2PMKA 3GD7A 2HT1A 1ZIPA 4IOMA 4BFXA 2QY9A 3DKVA 2X2EA 1Z8FA 2FOLA 3BOSA 2JLRA 2ZR9A 4D4MA 4DCUA 2RCNA 1COWA 1M7HA 1UKYA 3I73A 2FN4A 3QKTA 2O0HA 4RZ3A 4WA7A 4OBEA 3SC3A 1BKDR 1KI8A 1XTSA 3GJ4A 5LBIA 3EIEA 3Q8XB 1EFCA 1VG0B 3S1AB 1R0WA 1W36C 2E1RA 4LJ7A 3CZPA 4BLSA 2I3BA 4FMCF 3R9IA 2DYKA 4OL0A 4RD4A 1E32A 2XAUA 2WSSD 1T5IA 3N2EA 1SQ5A 4JJZA 1XZPA 3UG7A 4BUJA 5FBWB 4KSBA 3THYA 2QI9C 5FTJA 2QAGC 3K8YA 3MFYA 4PQRA 5CIWA 5BYKA 3KXKA 1YQTA 2ZRBA 2IL1A 3P4YA 2C9OA 1YRBA 4UJ3A 1AZSC 1F48A 2F1IA 3I1FA 2IS6A 2GBLA 1AGPA 3TNFA 1W2GA 2GEVA 3F3YA 4D81A 4M22A 1F2TB 4EKDA 1D8TA 5F3WB 3SE0A 4XOIA 5IHPA 2FU5C 1R0XA 1ZRHA 3ND9A 6Q21A 1ZJ6A 2D7DA 1DADA 2G83A 4TYYA 2C04A 2VBCA 3EA0A 4WXRA 4EFLA 3ZS8A 4BFUA 4LK2A 4URYR 2O52A 1H8EA 1TUEA 3CNLA 4QC2A 3EIHA 3AVQA 2WJHA 3TVTA 3IO5A 1T6NA 5ELXA 3BB3A 1E99A 4JT4A 5TY0A 2H1LA 4KVAA 1OIVA 1TQDA 4MGZR 1EFTA 3W3AA 1ZVQA 4IDPA 2ASEA 3GJ0A 2IWRA 4I1VA 4HZUA 5JJKA 4AYWA 4TLCA 2DB3A 4C0AC 5L3RA 3KZ1E 1B0UA 2EFGA 1A7JA 4KHZA 1Z6XA 2EQBA 1E0JA 1ZUHA 5DISB 3TIFA 1CRQA 2Q0HA 4OHXA 3WBKA 4ARZB 1RYFA 1SVWA 2FWRA 1VG9B 2GILA 3GEHA 3TW8B 3ZIAD 4F38A 2IS4A 2VHJA 1J7KA 1HE8B 2VF8A 1DAKA 1E0SA 3VHLB 4URXR 4UQOA 5FPTA 5F2EA 1KI4A 5J47A 3QF7A 1L4UA 4IVRA 1Z47A 3K0FB 4YMSA 3UPUA 3PUXA 1PLKA 1E3MA 1VTKA 5JZVA 2DBYA 1S9DA 3THYB 1ZYUA 3EIQA 1EESA 4JLBA 4N1AA 2QTFA 3B1VA 1NF3A 4DIDA 5L3QA 1BO6A 4HAUA 4D0LB 3BH7A 2DHRA 1AQYA 1U99A 4MQBA 4LUCA 4UNSA 1W4RA 1Z06A 2ZROA 4JKIA 2RGXA 4NCIA 2D4HA 5FPYA 3SFZA 1PVOA 4PQFA 3UIEA 1SULA 4QGGA 1N6IA 3UXMA 3QXSA 4CW7A 1TF5A 3NVAA 4DUGA 4GBMA 4HYYA 4KU4A 3IIMA 1RRFA 4JL6A 1XXHE 1VCNA 3CRW1 1U0LA 2FPLA 1GL7A 1ZNYA 2GEDA 3AEZA 5IF9A 3BORA 4CGZA 1ETUA 4OK6A 2H92A 4GNKA 4B71A 2AR7A 2NO6A 1NLFA 3NBYC 3KL4A 4BLTA 1LF5A 1ZU5A 2W6ID 3EZ2A 4IDHA 3PFIA 4G5SA 3N5CA 1CS4C 4JYCA 3OAAA 3K70B 1AS3A 1P6XA 1T5LA 4TYNA 1P4SA 2PX3A 3QF4A 1OH7A 3WHKA 2D2FA 2CK3D 2OHFA 3CRQA 3E5HA 2QE7D 3RSLA 2EU8A 2YYZA 3CPEA 1T8UA 2WVJA 5J4LA 2JJ2A 2PL3A 5F9FA 2VSOA 4JBWA 4Q1CA 3FGNA 4ZI3A 1WB9A 2ZANA 1FPMA 5KU1A 2ZE7A 3TJZA 2RGBA 3CH5A 2PZGA 5L3VA 5KO2A 2VF7A 1P3JA 3Q85A 1VIYA 1FOEB 3AVWA 1Z6YA 2IX3A 2G88A 1Q3TA 1E1RD 1RVDA 1UBEA 3GQBA 3K09A 2BCJQ 2XB4A 3EZFA 2HCJB 4HB3A 4UNQA 1FNNA 4GOXA 1G8PA 1K8RA 2YINC 1K6MA 3RC3A 1RKBA 2OAP1 4Z51A 4B3DA 2ZM5A 1QHYA 3FPAA 2W83A 5L3QB 1WBDA 2OZEA 4PC1A 2IYVA 4QFMA 1OXTA 3A1UA 4MYTA 3UMSA 4LV6A 5H1YA 1Q57A 2CCJA 1NN3A 2AFHE 2ZJ5A 4LJAA 2WIAA 1H8HD 1HYQA 2WOOA 1M7BA 5KNDA 2V1UA 1ZD1A 1P60A 2ZITA 4G5OA 3SS8A 3KUDA 3OIWA 1R8SA 4TSFA 1SKQA 4LV5B 3LW8A 1XTIA 4LYJA 1GKYA 1JPNA 2G0NA 2W2TA 2O8EA 1OB5A 4V0OA 3GLFE 2JATA 1F2UA 3TUJC 3ZLJA 1A2KC 4H1VA 1R10A 2IK8A 4HAVA 3RLFA 1KTVA 1KI6A 1D2EA 1I4DD 1W1WA 4UNRA 3GLIA 3U7GA 2ZUBA 2Q9AA 1W0KD 1NVVR 2ZJ2A 2B21A 1EWQA 2ZAMA 1GAJA 5EP3A 4RFSA 1XEXA 4RD0A 4FW9A 121PA 2HLDA 4Z1MD 4LBWA 5EE3A 2ZR7A 2RHMA 5FUXA 5LPNA 1Q22A 1AS2A 4LHVA 3CB4A 5B2ZA 5EXTA 1R6BX 1GVNB 5JRZA 1KI9A 4YDHB 4ASUD 3KQLA 2JDID 2NG1A 4FD2A 4LC0A 2RMKA 2MSEB 1W4CA 1FMJA 4R2IA 3VFDA 2D3WA 4NYIQ 1OKKA 4US2R 1E4VA 2A5YB 3X1YA 5SZJA 4XWOA 1S9HA 2QTHA 2WPDD 4TT3A 1NN5A 1J8MF 1HUQA 3CWQA 2BM0A 3DZ8A 4TQAA 1JI0A 1S3SA 4TL8A 3KJHA 4JMPA 4F93B 4F4CA 3T15A 4PAQA 3IUYA 4TLAA 5TV2A 4C0JA 4C2TA 1IY1A 1E0KA 2GCNA 2F7SA 1SVLA 3KXLA 1OXUA 3WYFA 3K9LA 1W46A 3K0EA 1P61B 1G4UR 2DFLA 1V43A 1NVWQ 2Z0MA 2OCYC 3FHOA 3IILA 3MWKA 3EPHA 5E7JA 1NRJB 5L3SB 2C96A 2GEUA 2O8EB 5SZHB 4ZDKA 4XSGA 4D26A 1P2VA 2A2ZA 2WJIA 5DYGA 3TKLA 1F2UB 3TSWA 3VR3A 4EDHA 3ZVMA 2GXAA 5FPKA 1A4RA 5C4MA 1KI6B 1U98A 2RGAA 1VYVA 3QENA 1SHZA 3GLIB 1KIMA 5GADl 4LCBA 4LGMA 5FOWA 1WP9A 1AKEA 4NDZA 4B47A 4KCGA 1EX6A 2FFAA 3KQUA 3OFND 2XTNA 2GESA 5JWOA 1XEXB 2XEXA 4CZ2A 5CJPA 2KI5A 4BZXA 1ZBDA 3LBHA 3H86A 3IQXA 1BIFA 4K46A 4HSEA 4DDVA 1G3IA 1AM4D 3KTAA 2GNOA 5TVKA 1AA9A 1PLJA 4Q66C 3LW7A 1N2CE 3MGCA 2RGCA 2OG2A 5CYPA 4MDFA 1E96A 1Z3IX 2AN9A 2WWGA 2ZRHA 2OXRA 3AKYA 3AGQA 1S8FA 3ECCA 4Q4HA 1T3HA 2AFIE 2RGEA 4DC9A 1MR3F 3RRNA 2FZLA 2FMXA 3SEAA 2WTUA 1ZNWA 2FPMA 5FTNA 3FFAA 4TWZA 5TXGA 1V5WA 1WDTA 2FNAA 3T1OA 1N6NA 4XVUA 3LAWA 3ZD6A 1JBKA 1U8AA 2WKQA 4TLDA 1XCGB 2W2VA 1XMJA 1II9A 1VPLA 2CBZA 1P9WA 4A36A 1JQLB 4BFZA 3B1YA 1ELOA 3U7EB 1F6BA 2BCGY 3LO5A 4LZZA 2XX3A 3AP3A 2WKRA 4H9GA 1ZM2A 1G41A 2ANCA 2ZPTX 1M1YE 2REXB 3TUZC 1YJ5A 3LX5A 3QNUA 1UF9A 4PX9A 3CRVA 3MJRA 4FMCB 5AJZA 4Q9LA 3ADDA 1N6RA 1TQ4A 4QNMA 4UXJA 2BBSA 4QM7A 2REBA 2BKEA 3HDTA 5HZHA 2VP2A 1E1QD 3E1SA 2F3RA 4WBSA 2Z43A 1E2LA 3J81k 2EVWX 3AV0B 3KKOA 2XXAA 3GLHA 1SZPA 3QEOA 4I1SA 1XXHA 1G8HA 2KWIA 2WSMA 3QIAA 1IHUA 3Q5EA 1DO2A 5FPSA 3RS5A 2NPIA 3PQCA 1XTKA 1UM8A 1Z0KA 1Z0FA 1P5ZB 1ZAKA 4PZZA 4TQUS 3QOFA 5C46F 3KTAB 1QZXA 2QP9X 1W0JD 4Q7KA 5JSZA 2EW1A 1WA5A 1QHSA 1QVAA 1ZCBA 3C15C 3IO3A 5B58C 1UEIA 1TEXA 1BYUA 3TE6A 5M04A 2R65A 2JLYA 4UKDA 2O8BA 3LVQE 4Q4HB 3NWJA 5KNCA 3REFA 4PAMA 4O3MA 4BRWA 3LNCA 2YC2C 4EIWA 1H65A 1M6NA 1TU3A 2A5FA 2QQ0A 2ZSFA 3TSOA 2CLCX 4UNPA 3ZS9A 1KKMA 5A5GA 4LY6A 3KJEA 4DLVA 4B2IA 2EWVA 4A92A 1WBBA 2QZ4A 3IPXA 4BLOA 1T0JB 5FL7D 1O87A 1UKZA 2NMVA 1KI7A 1M2OB 1PLLA 4D0NA 3WYGA 1AGRA 4EFMA 4CEJA 1P75A 3D31A 2XSZD 2IW3A 4DLZA 3OF5A 2CCGA 2YZ2A 2WWHA 1KMHA 1US8A 3GJXC 3LRPA 1KK3A 4EPVA 3RS4A 4L16A 3BAFA 2GKSA 3PEVA 2VHTA 1YZQA 3AUXA 1XRJA 5HCNA 3SZRA 5EE9A 3KQNA 3ADCA 3M6AA 3DPUA 2EFDB 2O8DB 3BGWA 4AG6A 2O0KA 3KX2A 1GRRA 2H7VA 4XWKA 5GJBA 1KDRA 3GLHB 2XXAB 4TZ6A 5CB8A 2QMUA 4Q21A 4OI1A 4MRRA 5JWHA 1CULC 4HLQB 4PC6A 2J87A 4F91B 5JSZB 4NU0A 1DO0A 3HYTA 1C4OA 1Z08A 1SXJA 1U9IC 4M1OA 2H18A 1S0UA 1XMSA 1PUIA 2O8BB 2QNRA 4Q7JB 2P65A 3KJGA 4RCZA 4DLTA 2WAYA 4TL9A 3BH6A 1GRQA 3GJ6A 4PAOA 4LV8B 3PEYA 2DWOA 2WWWA 4Q19A 4MH0R 3HU3A 1OFUX 1T8TA 4DSTA 4ZV4A 4NCJA 3WNBA 1TMKA 4WZAE 1FFHA 2YOFA 3KFVA 4P3YA 4OJQA 3FWYA 2ZYVX 3NDPA 5GVRA 2JIZD 3EC1A 2V6JA 1GKIA 4KO8A 4W5JA 3U60B 1CJTC 4JVMA 1AK2A 4AK9A 1MO4A 2BMJA 1TF7A 2WOJA 4JLPA 4KLNA 1MO3A 1TU4A 4MYHA 1M8PA 4P4TA 4BZPA 4CEJB 2EYQA 2WJVA 4W9MC 3AF2A 1W36D 5IRCD 1XD2A 3EZ7A 1NKTA 3T5GA 2A5JA 1XMVA 1KMHB 1US8B 4Y0VA 2N46A 3EAQA 1WMSA 5EP4A 4C3ZA 1ZD9A 1UDWA 4POAA 5AJXA 4BEBA 3H2YA 5C4GB 3OE7A 4LC1A 1OXSC 3BJIC 1DS6A 1P9NA 3CF2A 3FB4A 1LFDB 4NBSA 5GVSA 2D7CA 4BWYA 2XOKA 3MWLA 5H8WA 3W8NA 4XSHA 3C4JA 4D6PA 4KBFA 4V0LA 4KYUA 4YMUA 1DAFA 3LV8A 4LJYA 1HT1E 1G64A 2ZUDA 5KYKA 5KTYA 3U6BA 3ZH9B 3MJHA 1NBMA 5IDVA 4P4UA 5AJWA 1SXJB 1IAQA 3C16C 1G19A 4OHYA 3KDSE 2NGRA 5JI2E 3QEJA 2ZI7A 2GBLC 4JZKA 3LH5A 4OI4A 3G0HA 1DAHA 2OBLA 3T06B 1N5IA 2HEIA 3AB3A 1AN0A 2QORA 4A1FA 1Z83A 3VNUA 5UKDA 1KZ7B 2VYFA 3PR1A 5C18A 1TX4B 1XEWX 1GITA 3NH9A 3KQKA 1N25A 1IM2A 1AZTA 2ZETA 5F9HA 1KSJA 5JBQA 1GILA 1OH8A 4MKHA 4TMZA 5DN6D 3LBNA 4A4DA 4D80A 3FMPB 5DO9A 4LHZA 1DBSA 3AF0A 1D2NA 1DG1G 2JLQA 3R20A 5AWFC 2QPTA 2CMKA 4HEJA 3SDZA 1QRAA 5CM9C 3I3SR 1GSIA 1XD2B 3CZQA 1HEIA 4FINA 4R9UC 3U5ZB 1EFHA 1GNPA 4HAYA 4X8MA 4DWJA 4TYWA 4UNNA 3KB2A 3SI7A 3S1AA 2C99A 3DZDA 1LV7A 1OT3A 4WOPA 1W7AA 2QAJA 1S96A 2QM7A 1YR8A 3JZMA 4BASA 2GJ8A 4FN5A 1Q12A 3ONWA 3FDIA 2ODEA 5P21A 4RSGA 2NIPA 4DB2A 1KDOA 2J7PD 2VSFA 1VDZA 2R6AA 3K0SA 2W58A 1EXMA 4EJSA 3ASYA 3OIUA 4GOKA 4B32A 2EFEB 3D7MA 4M53A 4Q4LA 2PH1A 3ZGXA 1YZGA 4GMDA 4KVGA 1S4QA 2REOA 1IXRC 3LXXA 4KLZA 4OYHA 5EQTA 1OIXA 4V02A 5CK4A 3PUZA 4I4LA 1UBCA 3O8DA 4R2HA 3GLIE 1DPFA 3NDBB 5FBRB 1G3UA 4I1OA 4TYPA 4TTQA 2OLJA 4DDWA 2ZIAA 3SHFA 4HLUA 5BQ5A 5BW8A 4URVR 2V7QD 1YKSA 2ZE6A 3OFNA 1R5OA 3UKDA 2WWYA 3UWOA 4PTLA 3SOPA 2IF0A 4KXFB 4LX0A 1LW7A 1UKVY 3B7GA 1MO6A 4RD3A 1E2DA 2OUKA 4JLOA 2OM2A 5FR1A 4P4SA 1VYTA 1XBTA 2FGKA 3PXGA 1DOAA 2OILA 2Q9BA 4XVRA 1Z6AA 3GJ3A 2KBFA 5E3HA 1X1RA 1RW4A 4MKFA 2BKUA 2IYWA 2CL0X 3CWZA 3LD9A 5DH9A 3AVOA 2FE4A 2ODNA 2ZRNA 4JBXA 2IHBA 5JFGA 4MKGA 1E2FA 1GTVA 4E5UA 3GFPA 1TF2A 3U7FB 3NHBA 4ARZA 2FSHA 2BJWA 3AQ4A 5EXSA 2ZTSA 1Z22A 4G0NA 5JS7A 2QEQA 4KBGA 4BECA 1OFTA 3K0CA 4Q4JA 5EE1A 3K0FA 3B82A 5FUWA 2Q9CA 1UBGA 3NH6A 2FF7A 1OPXA 1Z6GA 2GJKA 1VG8A 1HA3A 4EJSB 5GJWC 3B9PA 1YZLA 4LBZA 3K09C 4RD6A 1FTNA 4IDOA 1W48A 1BMFD 3I72A 4DLXA 2ZREA 5CIQA 4YONB 2QU8A 2BBWA 2ZR0A 3BS4A 3CX6A 3IEUA 4KFRA 5FTMA 3ZDQA 3NC0C 2GZAA 2X2FA 1G17A 2HYDA 3FKSA 2W0SA 1E79D 2QP4A 5G53C 5FTKA 4GMXA 4PC3A 5DIFA 1CLUA 1GUAA 4B35A 4LJ4A 5TARA 1G3RA 3QBVA 3WP0A 1P72A 4PPFA 2G9NA 5C2JB 3DOFA 4IVPA 1IBRA 2WIBA 1NIPA 3KKQA 1RRPA 1TNDA 4YC7A 3A1SA 1JR3E 1JECA 2IYYA 3P4XA 4P4SB 2JGNA 4LYFA 4F7WA 4AYXA 3TBKA 4JLMA 3SJZA 3FMOB 4ZKEA 1KNXA 1KY3A 4TZ0A 4CYMA 4LJ6A 3QKRB 4L8GA 2WJYA 2QPAA 4NH0A 3LA6A 2HT6A 2FFHA 3OIYA 4TL6A 1NLYA 4NL4H 2F6RA 4P33A 1Z0AA 1C1YA 2GXUA 1KJYA 1KY2A 1S2MA 3LLMA 1DVRA 2ZI4A 1XEWY 3W3ZB 1N6LA 2D62A 3L0SA 2J5XA 4KYIB 4OQXA 4JLNA 2ORIA 1W4BA 2CL7X 1HY3A 3LWNA 3L0OA 4Q4JB 3TLXA 5KDOA 2QT0A 2A5DA 4V0KA 1UAAA 4HUTA 521PA 4TLBA 1GG2A 2ZJBA 2PCJA 2PZFA 1NNEA 3RS0A 4A2WA 4TL7A 2F1JA 4U00A 3UG6A 3Q7QA 2BMEA 1HE1C 1KI1A 4Q5IA 1TADA 3KB1A 1E2NA 3BC1A 1UPTA 1ZINA 4QBHA 3AVTA 4OKSA 4FWIB 3EZ6A 1J90A 2CHVA 2Z4SA 2PEZA 3QPVA 1A2BA 3QG1A 4X8HA 2ZI3A 4U02A 4JLAA 4YXWD 3GLHE 3R9WA 4PFSA 3AKEA 1KSHA 1LNZA 4YMWA 4IRUB 3ASZA 4V0NA 3PIRA 2OXCA 4AIIA 3B13B 2GAAA 2X1VA 3CONA 3U3RA 3CNNA 4HDOB 5ANRB 5G3YA 2QMOA 3DMNA 1WXQA 4CEIA 3L8ZA 3PUVA 3NTUA 3VQTA 1LB1B 3MRSA 1J99A 2PJRA 3W5IA 2H5EA 4B74A 1ZM7A 2OV2A 3VNVA 3ZQJA 3K1JA 4IW3B 5B57C 5E7IA 1IQPA 2Z5FA 4CDGA 4M1SA 4KJZA 4KITB 1G5PA 5EE5B 1QHHB 4DCTA 4R98A 4KFUA 1N6KA 1EFRA 1XPOA 4KFTA 4DEYA 3IDQA 3MUFA 4Q03A 4XD7A 3DO6A 2RAPA 3A1WA 4D82A 2ZRGA 2BM1A 2DCUA 4QBIA 4C0LA 1DELA 1OHHD 2LCFA 5FOSA 221PA 1CKEA 4NP6A 1E9FA 4F4JA 4NYJR 4DXAA 5FUVA 2LWIA 1XX6A 1VCIA 5EXPA 3KQHA 2CNWA 1CJUC 2IYTA 1N0VC 3CW2A 2ZS8A 3KKPA 5KUTA 3FTQA 1E2IA 2F3TA 1MABB 2ERYA 2ZRIA 3B8HA 5AUPB 3FFBA 5L3SA 2ZJYA 1OLOA 4PHHA 1ZNZA 3UATA 1E2JA 4HUQA 4II7A 3PVSA 2GTPA 4NCHA 1PUJA 1RRGA 2R6FA 3P32A 2XITA 1KGDA 2QL6A 1F3OA 1DG3A 5FR2A 1KJZA 5DSZA 1OYWA 4B3FX 1CR0A 1SXJE 2J0SA 4AWXA 4CEIB 4KAXA 3TVDA 1GDDA 1E2QA 1GNQA 3I32A 4DKXA 4K81B 3WP1B 3I62A 2QSYA 3GEEA 1XPRA 4FMDB 1NKSA 4ESHA 4QJ5A 2VTKA 4PPQA 3R7WA 3ICEA 4RJLA 4QJ3A 3VR4A 2JJ1A 1EX7A 4D0GA 4K8OA 2ODBA 3V00A 3SQWA 5CK5A 3UK6A 2W6JA 3LDAA 3OEED 4JL8A 1VKJA 2BDTA 1SKYB 3X1ZA 5CDFE 2H8KA 1KO4A 3X2SA 5J4VA 5JWRA 1E0AA 4MRVA 1JQJC 3DM5A 2V1XA 4DZZA 3U3JA 1N0WA 2WWFA 3MLEA 5HKKA 4LPKA 1TTTA 3H4MA 1A1VA 2BHRA 1NMZA 4Q1FA 2AL7A 2G1JA 4DHEA 1OE0A 2AD5A 1D9XA 1OV4A 2CLDX 3MSXA 4C7OA 2ZRDA 4G5RA 5DHAA 4B6EA 3EARA 2DFTA 3BH0A 4LYAA 2BMDA 4GSYA 3BB1A 1S1MA 3VKWA 5A0FA 3RWOA 4MRPA 4LPSA 4HDQB 4V03A 4ZKDA 4R71A 1G16A 4LHYA 3AVXA 2EWWA 5KPDA 1GRNA 1KAOA 3D6TB 4HUQB 3CM0A 3OEHD 4DDTA 5JHHB 4BLRA 4Q7LA 4R7ZA 2AK3A 3RVBA 1GP2A 1NBME 3BFVA 2XZOA 3TQFA 4O0MA 1KO5A 2IXGA 1ZW6A 5J40A 1JJVA 3I61A 3AM1A 2XNSA 3RSOA 4JVLA 3A37A 1LVGA 2V55B 1M74A 5K8UA 3R7WB 5FBLB 3IBYA 4RD2A 2XTMA 2HV8A 2JLSA 1EGAA 2KSQA 3T35A 4KFSA 5EE0A 2ZI6A 3NBFA 3NEYA 1IJFA 3PEWA 1XJQA 4PC2A 1FW6A 3AF4A 1JR3A 4HAWA 3DOEA 4DSUA 2IYRA 2AK2A 5HPYB 4DIEA 2BWJA 1MH1A 2ZVQX 5JEEA 2E9SA 5BYJA 3U4QA 3UMRA 2J0VA 2OFOA 1E98A 2R6DA 2R9VA 4RZUA 1YZTA 4FIDA 4QBGB 1BOFA 1NI3A 4Q18A 4RZXA 3V9PA 3CPHA 1ESNA 2XJ4A 1SXJC 2QRNA 1B23P 4D2IA 1T4GA 2BVNA 5JEDA 3QXXA 2ODWA 3JZAA 1ZM4A 1AJEA 4AC9A 1XNJA 3SHWA 1C9KA 1W4AA 4DB4A 4C7OB 4IOJA 3AP2A 4BFTA 2WWIA 3TK1A 2WMOB 2ATXA 2BBTA 2F1HA 4QL3A 5CJ2A 2WWXA 4RD1A 2DY1A 4Q4AA 1YRAA 4L4UA 1X1SA 2QGNA 2WSSA 4HB2A 2QGZA 4IVQA 4XH9B 2CVHA 1UKEA 1XU4A 2WICA 3C7KA 5SZIA 3ZQ6A 4TTRA 4JBYA 5FOXA 2JAQA 2VH5R 2Q3FA 1KI2A 4TTPA 2VP5A 4GPTA 2GXSA 4C30A 1COWD 1JJ7A 3DKPA 4BE7B 2QG6A 2W00A 8OHMA 2R62A 5KSYA 1D9ZA 4G01B 1IONA 1UEJA 1FL9A 3AF3A 4OQNA 1CTQA 4PZYA 2VQSA 1M7GA 1N3BA 4GDFA 4NHOA 3MD0A 3W9YA 2O8DA 2H17A 3AUYA 5DGXA 2IUUA 1N5LA 4M9SA 4YMVA 2VP0A 2MMGA 1JB1A 1KDPA 1ZU4A 2B7BA 5HR5A 4Q1AA 2VEDA 5AR1A 4BQSA 4B3GA 3TAHA 4CVNA 3ZJYA 2LKCA 1NVXQ 2IUTA 4ITRC 4CIDA 4QG7A 3C5HA 2QBYB 5KSPA 3T5DA 1Z5ZA 4ILEA 1Z6TA 2OO7A 4U5XA 5HTKA 3U4QB 4IDNA 4D25A 1VECA 1TQ2A 2C95A 3HPRA 2GK6A 4HB0A 1ZCAA 3IIKA 5H68A 3NBXX 4E07A 3QI2A 4OQMA 1FZQA 4B3BA 2PLFA 5BXQC 4AURA 1VMAA 2A3RA 2FPKA 3ZIAA 4G5GA 1H8ED 2QA5A 2E87A 4DJTA 2RKOA 3NKVA 4GP7A 4Q1EA 4Q4AB 2VA8A 4EPRA 1ODFA 5BN3A 2D2EA 3IIJA 2JLZA 2OBMA 4OHZA 2IYUA 3W6NA 3TR5A 1A82A 4TN1A 1QG2A 1IOZA 4JLJA 2QT1A 1CJMA 2ATVA 4OK5A 4TQ9A 2ZSBA 2ZUCA 1KO8A 3EG5A 2IS2A 1MV5A 2SHKA 3K53A 1NN0A 3RNLA 1E2HA 2FFQA 2GETA 2ZRMA 4KI0A 4XJXA 3VR1A 4C0BA 4TLEA 4TMKA 2GHIA 1RJ9A 1XFAA 5KSZA 3L2OB 3PITA 2QTVB 3GEIA 1RYHA 2GVZC 3M1IA 2FV8A 5KDLA 2VL7A 5GJVC 2W2XA 3BWDD 2AWOA 5EXXA 1J8YF 1G9XA 3CX8A 5E95A 4EPXA 2VP4A 4A82A 1IN7A 5JHGB 4ERNA 4EJSC 1NVVQ 5JMTA 2W6IA 3IQWA 2J1LA 4ACBA 4CRWB 5B64A 4O25A 2FEMA 1AKYA 5L8VA 4C0KA 1QBKC 2QROA 1UJ2A 5LD2B 4MUBA 3RRMA 4CT4B 4DUGD 2CK3A 3CBQA 3O8CA 3BK7A 3VKHA 2P0EA 2ZJ8A 3U61B 1G7CA 2QE7A 1NJGA 5HZKA 4UJ5A 4M0LA 1E4YA 1TQ6A 2ZJAA 3DDCA 4US1R 4B75A 1ZC3A 2WZQA 2HDNB 4HLUC 2VHQA 4LHXA 4LHWA 3I5XA 2A7QA 2O5VA 1YU9A 4E22A 4AI6A 4BFSA 4EUNA 3NHAA 3BFKA 1RIFA 3HYRA 1DAIA 3OAAD 5CDFA 4GP6A 4D4JA 2BOVA 1FTSA 1E1RA 3C14C 5IK2D 3WYAA 1TPZA 2I4IA 2OCPA 1OH6A 1E94E 3RRYA 4OHVA 2OEPA 3FHTA 2CHGA 2IEYA 2QENA 3D3QA 5JLJA 2ZI5A 3GLGA 4A8JA 4PHGA 3CPJB 3HU1A 2GCOA 2QM8A 2R6GA 1NVUQ 3BRWD 3FHCB 2ZE8A 3FMFA 1R2QA 3EX7C 2X8AA 5J5CA 2W0MA 1FP7A 2OESA 2ZYTX 3C8UA 1ZMXA 4KODA 3HWSA 1H8HA 2YOHA 2Y8EA 4N0EA 4GZMA 4FXPA 4PHFA 2CL6X 2BEJA 1KOFA 1P7CA 1NMYA 1RJ9B 2BEKA 3Q3JB 4Q9IA 3RS3A 1U8YA 3VR5A 4EAQA 2GF0A 3QPUA 4A0FA 1SHKA 3K0CC 1I2MA 3QXCA 1CXZA 1XF9A 1S1CA 1M34E 4FMDF 2ZRJA 4XWAA 1CR4A 4JLVA 1XD8A 3EWAA 4A0HA 1CEEA 5BWMA 2C9CA 4IKEA 4ZPXA 2HF8A 1D2MA 4DCNA 3VR6A 4BFVA 4C0QC 1U81A 3GP8A 1W0KA 3ZD7A 2J46A 2NO7A 5JJIA 1ZUIA 1G7RA 4TSFD 2QP3A 1FX0A 3CRRA 3K9HA 3ZVRA 421PA 5J4YA 1RZ3A 4Z1MA 1L2TA 1BH2A 2ZYUX 4RKEA 2JLUA 3WHLA 3OEEA 1SKYE 1E9CA 3DMDA 2C77A 3LXRA 1Z0DA 1J2JA 4ASUA 2GJ9A 2JDIA 3Q7PA 3HP1A 3NXSA 3HU2A 4GL2A 4PPNA 4AG5A 2EYUA 1MRNA 4IDQA 4WZ6A 3QKSA 3AVVA 2B6HA 4XTCS 3IPYA 1YE8A 1ZIOA 2C98A 2WPDA 3K70C 3U44B 4ZCMA 4YDSA 4A8JB 1JXMA 3GLGB 3G5UA 1YZKA 2A9KA 2NQ2C 1N0UA 3RANA 2GCOB 3TH5A 3CF0A 3TRFA 4A2QA 1P62B 3SN6A 1SVMA 3SU8A 4L15A 5CITA 1X8JA 4URUR 1F60A 4E09A 3T1TA 1R4AA 3EXAA 1Z2AA 3T34A 1OJLA 5HE9A 5K8TA 4LJ8A 3H84A 5D3QA 2B92A 3IHWA 3QE0A 2CXXA 5DYIA 4NPHA 3M0EA 4TT3D 3RHFA 2Q21A 4M9XA 1JAIA 2X19A 3T1QA 2D74A 4OQLA 2H57A 3OEHA 1OFHA 2NTYC 3CR7A 4A6PA 3CIOA 4IJMA 1R8QA 4OK3A 2QQEA 4LWZA 1WF3A 2OAQ1 3H0KA 5LDDC 5G3ZA 4RY2A 1QHGA 2V4ZA 3C41J 3FYHA 2C9YA 3NIBA 1DARA 1FX0B 4NYMQ 4HATA 3EWSA 2ZS7A 3AVPA 4Q02A 1JPJA 2WM9B 4BRUA 2FH5B 3CNOA 1XJ0A 1BS1A 3N70A 4QHSA
chains in the Genus database with same CATH superfamily
4AMGA 4K9OA 1TAHA 4TWRA 3VSBA 4YRGA 4L3VA 2ZRKA 2Q6OA 2E1PA 3T61A 1L7AA 4EB0A 4K03A 3C97A 5C8YA 1II8A 5U4QA 4WEQA 4CTNA 3H2BA 3CB2A 1U1EA 2R6HA 3QNMA 5FV7A 1J5XA 3E84A 4N40A 1P1IA 4JQYA 1QVRA 3HL0A 1A69A 2XNKA 4MWGA 1F14A 4P31A 1OXXK 1TKCA 1RE0A 4LJ9A 3OOYA 5JCPA 3ZWCA 4KQWA 3F0TA 1P1HA 4CIAA 3QXGA 3V34A 3BEDA 4EHJA 5L7WA 2CC2A 4QIHA 3MT7A 3Q8LA 1T5BA 4QYXA 4CTKA 3MAAC 4OREX 1VPVA 4RSMA 3FSGD 3GO4A 4OQYA 1IOWA 4CTOA 3EA5A 3P26A 10MHA 3A6JA 2XYHA 3JD3A 3ZXYA 1NW7A 3HU5A 1AXGA 1GZ5A 1H1LB 3T8YA 3IBTA 1RHUA 1YB7A 3MGBA 4E13A 1BDBA 2E3JA 1FF9A 2JIRA 3BZUA 3OIVA 5KVCA 4C9BA 4DR5B 3QA9A 16PKA 4IFEA 1KVUA 3U3OA 2OT3B 5LNK6 4RULA 2GYUA 3P0RA 4PYRA 3DAOA 4Y1EA 2WVGA 1R6VA 3RREA 2VJNA 3SNKA 1HQYE 3A4NA 821PA 4KUHA 4URZR 3IMFA 5I3ZA 1HEUA 5E4FA 3UO8B 2VS1A 3K5IA 3BCHA 2FWNA 2N1BA 4EJMA 2HDOA 4OTZA 3RVJA 3VKFA 1CF4A 1WTAA 3QXJA 3CNBA 3K0AA 5ALOA 3ZLUA 3AY6A 4GO1A 5AM1A 5M29A 5HUQA 5BNIA 4B4UA 1SIUA 5JS2A 3DQQA 3GRAA 3PCTA 5CH5A 1UBJS 3PPIA 2EFJA 4BJHB 1R9NA 3W8RA 4X94A 3THOA 3N74A 4PLPA 5AKHA 1U3FA 4PO1A 4U2CA 1R0CA 5DGCA 3PQ7A 3LJKA 3SNHA 3VPSA 1OLSA 2G6BA 2BAGA 3FTPA 1ULZA 3ROTA 4RWZA 4IEIA 1W0JA 3JVUA 3AIKA 4H17A 2GARA 3AHFA 5IUKC 1P19A 4YRKA 1QP7A 1TM1E 1DV2A 2ZXUA 3WNVA 2WYOA 4NV1A 2QRMA 2K5UA 2F3PA 2XUKA 4R1LA 3WKBA 5FX2A 3ZDCA 3AR3A 4FDLA 1P9OA 1AUOA 4KKXB 4US0R 4BBPA 3ISVA 4Q7MB 3QJYA 1RCTE 1X86B 1UL1X 5BN5A 3I3OA 3P5BA 2PU7A 1XDBA 2Q5LA 1J07A 1Z28A 1QCDA 3ZHBA 5I7UA 1M6VB 4TXNA 2HF9A 3L43A 5HKLA 2D0OB 4JP2A 5LB4A 3LVRE 4U39A 2UVPA 4IIHA 3QM1A 3A8TA 3TLEA 2JL1A 5K4AA 1E8DA 1JT2A 4BX8A 1CZNA 4DGSA 4RPJA 1Y1QA 1RKUA 4IXMA 1KPIA 1ZUNB 5I5GA 3SYNA 2OFXA 4F92B 3LP6A 2MSCB 3HBFA 5PGMA 1B73A 1NMEA 1PL6A 2OGSA 2P2GA 2HM7A 3KXPA 1L7VC 3W1EA 5IT5A 5DX1A 4AICA 5LBUA 3ZDFA 2I80A 1HE2A 1M6HA 3D1JA 5H59A 1OWOA 5DX8A 3TW4A 3QV2A 1AXRA 4F2HA 2DFDA 2I6GA 1X9HA 3O4RA 4GKBA 5HFAA 4M1KA 3TLAA 2CCKA 5A03A 3KZMA 4TMWA 3F7NA 3LQ1A 3UK1A 3HVIA 4H1WA 2PUDA 3TMAA 2B5OA 721PA 3K30A 2PRSA 3QP9A 1GIAA 1PBTA 2H1SA 2WNSA 1QQ7A 1E3DA 4Q37A 3JVVA 3MOGA 4L76A 5DHFA 2WT9A 4ZCLA 5KTNA 3FPGA 3LQRA 2JRCA 3MZ0A 3E7FA 1WD5A 3GJ5A 4M9RA 3W78A 4BX2A 3L1KA 4M8KA 1NR7A 3FWHA 2YNMA 4EG7A 4NCNA 1Y6QA 2Q4RA 1Z13A 3KCNA 3BMQB 1IIBA 3KT3A 3F67A 2JFZA 4EY4A 1E4OA 3AR4A 4X3OA 3VYRB 3ZV5A 1M34A 2DG2A 3LT2A 1R3UA 4E5KA 4Y6QA 4ZT6A 2G0TA 3ZZUA 3LOUA 2DOKA 3QX8A 1SCNE 4XQEA 4RCYA 1Z63A 2HNAA 3EGDB 3JX9A 1YWGO 3DDHA 5AK0A 5IKEA 2BD0A 3QPWA 4JYBA 2A14A 5FD8A 1XPUA 1RKXA 4MUNA 3IUNA 1WULS 4LDQA 1KNQA 4Z8YA 1PZFA 2OD2A 2Q8NA 3CG0A 4N3GA 1R0RE 1KETA 1KJNA 1W30A 2AYYA 2ZE5A 5KX5A 3L8DA 4JI0B 2OFWA 1PFQA 3PNSA 4RXUA 4B3XA 2P5TB 1R6UA 5DK4A 1DEKA 2GLTA 2AJDA 2GZDA 3H9EO 4KXMA 3JQ7B 2Q3HA 2SCUB 5D85A 1W47A 2VRWA 4Q9HA 4BVAA 1FBTA 4AMBA 4DC1A 4E5DA 2JIZA 1ORTA 1VL6A 2Q4OA 3PB3A 4IRXA 5HGXA 5I9SA 4CIWA 4PVDA 1SBQA 4LRQA 1SG6A 2HA5A 2IY7A 4FYPA 4B0PA 1KVSA 4UOZA 3TDNA 2GJAA 3WYDA 2EFCB 1R7RA 3A4TA 1U04A 2FEWB 2OHVA 1RSZA 4O59O 4RYDA 3CX7A 1MO5A 2F43A 3E70C 1LNQA 3WNDA 3G59A 4EPWA 3KHSA 1Z0IA 3G9XA 2J0UA 4Y8VA 4YCBA 4QWWA 1ID8A 2IOYA 2WLTA 5BSVA 2ZKIA 2AR0A 4OSOA 1BHQ1 2VFAA 3F9RA 4C6TA 3UJNA 1JKIA 1E9BA 2WE8A 4JFAA 1HH4A 1NSFA 2EZ4A 3LHKA 1SOUA 4BKOA 2ZK7A 2FA9A 4MUAA 2QAGA 5FPHA 4HVLA 5AO9A 2WZDA 2ZJOA 4TYQA 1AU9A 2JB9A 1E5TA 1RACA 3A6KA 2CSXA 3VU3A 4RY0A 2C78A 3Q5DA 1XAGA 2YJTD 4XWYA 3B2QA 2WT4A 3CVVA 1X2EA 1WHSA 2I1QA 4UUPA 3SJCA 1P33A 2DY0A 3JWPA 3ZKWB 1Q3KA 4P0PB 3LIIA 1Q20A 2DGDA 1EYZA 1D4FA 5IT9A 1N3LA 2OWDA 1YDWA 3A58B 4ZDIA 1RYYA 2J3EA 4EFKA 1FJHA 4EQ6A 1MJGA 4DA4A 4GD3Q 2UZ4A 2FSPA 4K2HA 1Z39A 3Q3GE 4JQZA 4AZ3A 4F2GA 1JIIA 1I9CA 3EFHA 1N2OA 2ZCUA 4AJEA 1RQPA 3ED5A 1YBAA 2OZVA 2XOKD 3CW9A 3BCSA 4LX8A 4QYWA 5SYNA 4LDPA 5A3QA 3UJBA 3HBAA 3GDGA 3EIOA 1GT6A 1BROA 3SC2B 1O94D 1Y3IA 2ATCA 2FX5A 4JASB 3WBBA 4LFBB 2ZIWB 1B8VA 3MM4A 1ODCA 3RV3A 3VSEA 1I4LD 4IIJB 5B5SA 2XMSA 2XMDA 4IUDS 4UDXX 1KAGA 3E7WA 1C9YA 3IPLA 4Y30A 5FXMA 1CRWG 1OYYA 3LZCA 1KMQA 3G9TA 3IVCA 3WADA 4D57A 2HN9A 4FOSA 1KFBB 3GYGA 4MPPA 1Q7CA 1ZVKA 3CLUD 3MJCA 4OEHA 1NBMD 5A3SA 4O33A 1T6XA 4WK0B 4AMVA 4ALLA 4BKMA 4ESOA 1C7RA 3LQQA 4KZPA 3M3HA 2EGHA 4WUVA 1UQRA 3L4JA 2NQ8A 4B3SB 3FAZA 1N32B 2AZMA 4KH0A 4W8HA 5TQ2B 1NT2A 2E4VA 3EGEA 3EPPA 1TCBA 3QYFA 2VJCA 5FI5A 4F5DA 4Y0AA 2CF5A 2R2AA 3I09A 4NF2A 2KBEA 3A4YA 3O83A 4RZHA 4UUBA 2X0KA 5DTMA 1M72A 1QZTA 3GD5A 1G8GA 2ZAOA 5EYPA 5G41A 2IUYA 1V11A 5LMNB 5LD2C 4KRGA 4WNAA 3HJFA 5IJAA 4QXOA 4L5IA 3ZZ0A 1VJTA 1DC6A 5DASA 2ZBUA 3AVUA 3EVAA 3CO5A 2W6MA 3L6DA 4JIMA 1TOAA 4IX9A 3TQIA 4B3HA 2ERCA 4RVGA 4YP7A 2ZQ5A 2IP1A 3EXEA 4IY1A 3H18A 3NG1A 1L7PA 4O2AA 4QOSA 3CUEF 3I01M 4OMDA 3HUTA 3V8RA 3WK6A 2FETA 5DYTA 4MV1A 1KK0A 3C6QA 3QZUA 2ZM6B 3JYOA 4N76A 4LWQA 4HAXA 1A77A 3F3KA 1PEKE 3L8YA 1CDEA 1SG0A 3SP1A 4DA9A 1L5VA 2PRKA 3TUZC 3RIGA 4XVHA 4GKKB 1PHRA 2PYDA 2VZ9A 4JUIA 4KWEA 4V0QA 1LPAB 1XCLA 2C8KA 4JC5A 1VJDA 5DBEX 3DO8A 1KHTA 3ZVNA 3RVKA 5G1PA 3KYDB 2AOUB 4PSKA 2R1VB 2ZPAA 5JECA 1YUNA 5G0VA 4DDMA 4H1UA 3ZVKA 3GVCA 5K0NA 4GXQA 3OT1B 2QLJA 1XVVA 4KR7A 3HKEB 1AHIA 1WMDA 4CQMB 1M0WA 1TRHA 2CKMA 4A5SA 1I7NA 1G2PA 1FYVA 2HIHA 3OTWA 3AX6A 4DLUA 4R8SA 5D84A 2IWHA 4AU1A 4M2LA 1B0AA 3M4XA 1DGQA 2YZKA 1BTOA 3AEUA 5I9MA 2O8CA 3HJTA 4PGMA 3STHA 4EUKA 1EXVA 4UOQA 1OY1A 1WVMA 4LQCA 2B3DA 4L9WA 3L06A 2ZPUA 4ZREA 1XMPA 1CX9B 4JT9A 1WP4A 2ZRLA 2CLEB 4TGLA 1ESCA 4BO3A 2XQJA 4G1MB 3S28A 2W37A 2A9JA 2W6PA 1UPXA 2YJ3A 2B8WA 2JHFA 3NJ4A 4IEEA 4CTJA 2JK0A 3FPSA 4ZQFA 1OREA 3TNDA 4AJ4A 1SQ0A 2J41A 4RH3A 3ZTTA 2QXTA 3VZCA 4YJ2B 4OUDA 2I2XB 4U0JA 3LKZA 3BMNB 5BRAA 2DVMA 3DHWC 5F21A 2CMDA 4OM7A 1SELA 4S0XA 1CIVA 4QOGA 4MR7A 3IP7A 2H08A 1CNEA 1NE2A 1T1EA 3F6EX 3UOGA 2XZTA 3ROKA 3L6BA 1OI2A 3THSA 3ZJTA 5DLQC 1G5TA 2PSDA 5LYJF 2VSNA 2B8TA 4YJ3F 2I4TA 3FWPA 5ECGC 5FJJA 1ISIA 2VP6A 1KSGA 4PHTA 3FGOA 4HBGA 3FN4A 2IXBA 5HEKA 3QLVA 3VPAA 4XYBA 4O2RA 2PLRA 2REQB 3K16A 3M82A 4D45A 4TKUB 1BEZA 2O6LA 5I8PA 3C3YA 3TQQA 1POWA 4D9KA 1CF2O 1E6CA 3MWEB 1G0OA 1HK7A 3RSQA 2AH5A 1QGUB 2JCBA 2VXBA 4YB8A 4B34A 1GYPA 4R68A 4I3GA 3G1UA 1HSZA 3A1FA 5KCMA 1BXKA 1MIHA 1U02A 3A70A 3GRCA 3O4JA 5EKXA 1DAMA 1EWRA 4A8JC 4ACAA 4ZTUB 1XZCA 4FWTA 3LI2A 2DJIA 4QASA 1A7AA 2QZSA 5CFZA 3DDWA 3HCBA 2WJGA 2AR9A 4MAAA 3MWJA 1QGAA 3BGVA 3DOUA 4PQYA 7MHTA 4J0QA 4C0SA 1YCGA 2ZSHA 4YQFA 4DA7A 5AVVA 4U7HA 4JI5B 1NJFA 1V8DA 2P4EA 4DMCA 3B9QA 4IOLA 2J0QA 2Y1EA 4ZOAA 4EGSA 3S8YA 1Z5GA 3DOIA 5CT5A 3F7OA 1P18A 1SVOA 1ORVA 5JSKA 5IH7A 2V6IA 1R12A 4JI1B 1T36B 1TFRA 1VE5A 2B1IA 5I51A 2MYPA 3OLCX 3T9CA 2V5VA 5DPMA 1NA5A 1C50A 2GPTA 4I4NA 3U1VA 4DIBA 5BR4A 2R5NA 1U8FO 3MTBA 1WIWA 2H16A 3WBJA 3GYBA 2GCEA 2JH9A 2G8LA 1PT8A 4I1UA 1LPMA 3ILSA 4IJKA 4KIUA 2JFQA 5BY2A 2R8OA 4ER7A 1BZYA 1DBQA 4YCMA 2G70A 9GPBA 1ICIA 3OIDA 4DQKA 5I4KA 4CEIA 1PJRA 1Q7GA 4HDMA 4MHSA 3ADBA 1TZBA 1UBMS 5IVPA 4BFWA 1S2OA 3GCDA 4XTRA 1XALA 5LCXA 4KR3A 1EGHA 1CZRA 1N1GA 4QT0A 3ZHSA 2NU6A 1JQ5A 3C3PA 4B44A 3AR8A 2GDJA 1E64A 3ROEA 1T4CA 4ZFNA 3OTOB 1IY2A 4DLRA 3SXUB 4C88A 3K9FC 5GQSA 1UXJA 3VPHA 3PQEA 2WD8A 2Q5JA 4NYJQ 4C2AA 1T8YA 2IZ5A 2M6LA 2PE5A 2C9DA 3H1PA 4R1MA 3D8BA 1XB2A 3D3KA 3KVNA 1E69A 4UE3S 5CLQA 2V8OA 1VBNA 2AN4A 1XQVA 4QUIA 2JVIA 3RYIB 4ZGWA 2G1PA 3IPRA 2PMBA 3TB6A 1IPHA 2YV4A 3I92A 3KSDO 4GUAA 4IYRA 4RUKA 1VL0A 3EUAA 4QM6A 5ALVA 1KAQA 4TTAA 1HE5A 1TFUA 2FMFA 5JC8A 1BCSA 2ZQZA 1N3YA 1QH1A 2BV3A 1T0BA 4K9LA 2FZWA 3K7EA 4KPEC 3M7IA 5AIBA 3F73A 5KJ6A 1WQ1R 2XCSB 3X1XA 2Q46A 4M6WB 4WPGA 3G82C 3RODA 1X3SA 4JS0A 5JOQA 3DE2X 2Q4DA 1CQPA 2QWXA 3H9CA 2JGAA 1XNHA 5IH3A 4CODB 1I5RA 3CVUA 1D03A 3EIXA 3LRTA 4MRSA 4YJDA 4DA6A 2VI5A 5D1HA 4LA4A 4YX9A 1Z0JA 4BKQA 3U2QA 1WZIA 3LY7A 1KTIA 1BWQA 5EMHA 1FYDA 3G8BA 3DZFA 4U1RA 4WLUA 1IN4A 5LQCA 1YQEA 4WERA 4BWVA 4E94A 4NENA 4DIMA 1Z4KA 2XXBA 1FYEA 1WRBA 2AC2A 4FYIA 1ISFA 3SMVA 3GFRA 3ORFA 5F4BA 2ZAYA 4X90A 4M4SA 4XX0B 4GX2A 3EF1A 2PFSA 1T9CA 1O9BA 1Z38A 4PU0A 5GJCA 3R6LA 2IYQA 2EW2A 2XTAA 4FZ5A 3JQPA 4HRXA 4RPHA 4EMSA 2B3TA 5BN4A 3DXFA 3F5FA 3QV1A 1EK0A 4GRIA 2B4KA 1XD9A 3LQ4A 1N9ZA 3GLFA 1BW9B 3W5JA 4Z1OA 3CUUA 4HDAA 4JOSA 1OH5A 2BGJA 4HRAA 3EHDA 2YV1A 5DSXA 1YC2A 3QH4A 3G1WA 2J6IA 1J0DA 5M5BA 2BZGA 1R4ZA 1SB8A 1JGTA 3AB8A 4JEHA 4O0LA 4C6SA 4DLPA 4G3XA 2I1VB 3CUVA 3H9UA 1LEHA 2IITA 2DE0X 1PJQA 3DLAA 1XK6A 2AG1A 1MB4A 3P52A 2DH6A 4G84A 3U44A 1Y9JA 1OHHA 3O3NB 3D3WA 4GL4A 2JJ2D 3CH7A 4RANA 2VTBA 5A0TA 2ZUEA 1DAEA 5FOTA 2EX4A 1UBSB 2ZI9A 4I4TB 5HKAA 1M73E 5KI6A 4DQVA 1LDEA 2RHJA 5HMMA 2V54A 2X4GA 2OMKA 3T9DA 1UMBB 2CE7A 3I6YA 3IVRA 3VHXA 2QTAA 3B1WA 1DHTA 1MRSA 1RWWA 4L5AA 4MW5A 4BNLA 4KDRA 4O02B 1G5FA 2IIVA 4PHCA 3CVOA 4F4UA 1KEPA 3K15A 4MI6A 3WLPA 4FGZA 4F6RB 2ERXA 3EH1A 3NC1C 5EP1A 1UBFA 1NULA 1SBTA 4DM7A 5IX8A 5E6RA 4BE4A 3O4HA 3U48A 3MGGA 3HQ4O 3WRXC 1X7GA 2XZPA 1AX9A 4LYHA 2W7TA 1L5SA 4M87A 5ARDA 3SJBA 2L0XA 4JJFA 5EN4A 3UN1A 6ABPA 3TXYA 2GYVA 2NYVA 1E9SA 2B35A 4Q1BA 1K5PA 1UMDA 3OJFA 1AB5A 5LYYA 4QTXA 3HKDB 4NIMA 4LI0A 3TW6A 1FUYB 3OX4A 1LA2A 2Y1XA 4A2PA 3DHYA 1HL3A 3ZHQA 4BTEA 1QRUA 4D9JA 3IXMA 4G65A 3UF0A 1JKJB 4XB2A 1X80B 2OBBA 1SVIA 2WB4A 3PC8C 4JKYA 3UK0A 1YB5A 3AGPA 1D2CA 3UUGA 4HJRA 3IV9A 1EJ0A 4GVXA 2HSGA 5LN1A 1XRRA 4M9ZA 2GRJA 3JYNA 3S99A 1HURA 2AX4A 4M1TA 4RGQA 1KO7A 3HVKA 1N6PA 2PGXA 5D3ZA 2V7WA 4HFJA 1Y6FA 3ES9A 1ISMA 4KDCA 2KB0A 1JXQA 3LRXA 3WL8A 5JDIA 2AD1A 4JVSB 4UXIA 2C2HA 5ES4B 3UAYA 4JQSA 2DQKA 1U5BB 2O8FA 2AMVA 4EMUA 1U4SA 4G63A 4DCGA 5JJ5A 2YS6A 3DL0A 4Q00A 2VTDA 4X00A 2IUSA 2PSFA 3WSVA 3A1TA 1IATA 2AKYA 5JZOA 3MT8A 1Y3HA 2GNPA 4I55B 4NZOA 5E3JA 4ZEWA 1K7FB 1XTPA 2NV6A 4HVAA 3P20A 2OQVA 5CVTA 5GINE 4IFBA 4IG9A 3UAVA 4C01A 5BSRA 4LTNA 3W7VA 4N0DA 1FRNA 1D0VA 3GUVA 2OO5A 1JZQA 1ODKA 2W6JD 3BIWA 5HF8A 3RRZA 4AL4A 1PS9A 2BHLA 2BSAA 1NBIA 1EI9A 5IKXA 1MKYA 4A6EA 5CNIA 1HDYA 4K6OA 1AQUA 3OQOA 3GDHA 2QR2A 4QYIA 5EERA 1T0HB 1NUUA 1YCHA 2GEFA 2QTRA 1D4AA 3EOZA 3I5AA 3IV6A 3JAKA 3MPUA 3GBVA 4HLCA 4W5WA 2Q5QA 1K0FA 1KE2A 4C4PA 4EZBA 1Z4JA 4JSYA 3OQNA 2BFAA 3ZWAA 4RH1A 4DGQA 3OU6A 1VIDA 1BD3A 2O1WA 3LYUA 1VL8A 1QYVA 4W5HA 4PGGA 4HDSA 4EPTA 1JR6A 1YRQA 1FSFA 4LOAA 4QNRA 5K7SA 3CBGA 5TJHA 3KBOA 2EATA 3IR5A 1W49A 3GMTA 4Y6LA 1L5LA 1XQYA 2XBLA 3FMIA 3TTTA 3VX3A 3PL1A 4C76A 1IBCA 2FWIA 5BURA 4B6FA 2AW3A 1NLZA 2C5GA 4HRVA 5AI8A 5AK4A 1Z36A 4QXAA 4GDMA 5CDGA 2JF0A 2P9BA 2XI4A 4KRXA 4YRMA 1IHDA 2NZJA 3SBDA 5FLXA 2PZEA 2DJ5A 3LZ6A 2F8TA 3N8DA 3NPAA 1RPTA 4D6XA 4W7SA 3UCFA 1EWYA 4Z9BA 4ENQA 2DWCA 3BK2A 3I9V1 2HXYA 4XLZA 2C5SA 2CXTA 1JA1A 1IG3A 4A15A 2GK7A 2B1JA 3OKPA 4RQUA 1QK5A 2MMCA 2WV9A 3RGWS 5H4GA 4KREA 1KQGA 2FR8C 1LDNA 3IOYA 3KEFA 2JGDB 4LNHA 4Q01A 4HNVA 5JYDA 4R01A 5I7OA 4AS1A 4NZYA 1NRWA 1E2MA 4FDTA 4PZ0A 2OFFA 4RHUA 4BATA 5KOYA 3RS8A 4ZT4A 4A5OA 4ZYUA 1DX4A 2JFBA 3K8ZA 3P27A 4G67A 2GVDC 4KNVA 2LKDA 5EI5A 2BHNA 5BR1A 1Y3DE 5TNXA 3EPLA 2QE6A 3F8TA 3C5CA 1KJWA 3F71A 2RH4A 1MX9A 2HF7A 1NTRA 1YZHA 2ATEA 1H6AA 2HFJA 3GCXA 4TZKA 4Q39A 3JYHA 1N2SA 2GERA 2P91A 1F4PA 1HV8A 1JR4A 1SBHA 2FG5A 3G7UA 3FPBA 3JWEA 3LDHA 4XM0A 3O4FA 1MT0A 4AKIA 1N2CB 1SOAA 2YVAA 4FT4A 2HA0A 2O2GA 4RK1A 4XPIB 3VAAA 2JHAA 2PMKA 1MW9X 5BMOA 1QDUA 1ZIPA 1Z2NX 4O4HF 3FY4A 1L7DA 2QY9A 3I34X 1OX5A 5JO9A 2C3YA 1L5OA 2VVTA 1Z8FA 2G8NA 3O2SB 1JLLB 1WEKA 4BNIA 3BOSA 2G63A 4RA6A 1V8BA 1I7DA 4RZ3A 4XWTA 3RK1A 2FN4A 3SC3A 5BN1A 1U2GC 2GTHA 4L50A 3GJ4A 3CLKA 3EIEA 4PRYA 3KDAA 1EFCA 5FA5A 2H1RA 2GO7A 4YP5A 5DFAA 4RJIA 2XR1A 4IHJF 4R69A 3E15A 1P3DA 4YRRA 2I3BA 3M70A 4ZCSA 2X8JA 2X7HA 4FMCF 4FB4A 2DYKA 3FYUC 2IPOA 1E32A 1ZJ5A 2BFBA 2IEDA 4BC0A 2OAEA 5D87A 3DE7X 1VHJA 3N2EA 5EJMA 3SSOA 3UG7A 2VQEB 4W5OA 4KSBA 2ADFA 3KHTA 4NJMA 3KU4A 5FTJA 3SLKA 1YR3A 2O57A 2WJ4A 3K8YA 9LDBA 5CIWA 2D59A 2XE7A 2OXEA 3CLRC 4O63O 1CEYA 1AHPA 2YRFA 2W93A 1H3NA 5NULA 2IL1A 5LP1A 2WTEA 3FJYA 2WA2A 1DXYA 2GD2A 1YRBA 4UJ3A 3TL3A 4DXDA 1F48A 2MJLA 2R8BA 1Q83A 5GGYA 5THXA 4BVGA 2GBLA 5A3RA 4NJEB 3VJRA 3URMA 1N34B 3O0DA 4LDZA 2YY5A 3SS7X 2G1AA 1F0YA 5F3WB 3JQGB 1QUFA 3ORSA 5H3CA 4E5VA 1NLUA 3AJEA 2WF6A 3MWDA 4HQFA 1C14A 4QLBA 5BW4A 5IHPA 2VJOA 3OWHA 3DFIA 2FPGA 2GZSA 1KZ6A 3EGXA 2D7DA 3F90A 1ZJ6A 2JGFA 4INJA 3B3QA 5BO5A 3KR0A 3L7OA 3WYBA 1M10A 2C04A 4TYYA 3B89A 3T52A 3U4HA 5CCXA 3X2EA 2WABA 2VT7A 4URYR 4LN1A 1UZUA 1SC9A 4MWCA 3W04A 2O52A 2A1TS 1JIJA 3CNLA 4QC2A 1HI9A 1Y8CA 1U7UA 3AVQA 4C4YA 2XT9A 5KMGA 2C7RA 4NZZA 5ENVA 3BB3A 4U9UA 3MHTA 1GA1A 5JQGA 4CFYA 4MGZR 2PD4A 1IK6A 2R85A 2DLDA 3I4FA 4K6KA 1GPH1 1ZVQA 2ASEA 3GJ0A 1JYFA 4IF4A 4Y18A 2IWRA 4AYWA 3SVTA 2I03A 1SKAA 2Z8YA 4FUTA 3DE3X 1H93A 4V2IA 2JFUA 1V48A 2GX6A 5B58T 1Z6XA 2EQBA 4EG4A 2PGAA 2RHHA 4G0VA 4JYZA 3ORYA 1BDMA 1RYFA 2VUIB 1A71A 4QU5A 4TUYA 4ZEXA 3RNOA 2IS4A 1WL8A 4LW8A 3ZWQA 3ENKA 3HWWA 1HE8B 4F38A 1Y37A 2WU4A 2L17A 4UTPA 3ETGA 5L4NA 3FTDA 4BO8A 3NWOA 1H2HA 3JWJA 4UQOA 2IFTA 5AT1A 1OWLA 2PH7A 5FPTA 4A16A 4EW1A 1K06A 1Z47A 2Z8ZA 5D01A 1SOVA 4Y2YA 4CV1A 2XVZA 3ESDA 1SCJA 2AMLA 4HFRA 4M7WA 2C29D 4P7GA 2NO4A 1V6CA 4WWHA 3THYB 2O48X 4JLBA 1O97D 3AETB 3P0EA 1NF3A 4OQ4A 4R51A 3FHJA 4DIDA 1BO6A 5L3QA 1AY0A 3VTFA 1GZ6A 2PVSA 1XDSA 3OZAA 4G4SO 1VRVA 3F46A 3NS7A 4K9KA 2VDVE 4ZRNA 5EWLA 1FTGA 4FFDA 3E3AA 1W4RA 3TD9A 3MMNA 4BWGA 1PVDA 1Z06A 5A4FS 3NIDB 1QORA 1H2BA 4NCIA 3SFZA 1PVOA 1OAOC 3OD1A 5ALFA 4RGBA 2HGZA 5GV8A 1N6IA 1V4BA 3QXSA 4MI9A 4O4IB 4XCXA 4U9IS 5TS2A 4GBMA 3V4SA 3V6MA 4CQLB 1PWZA 4DM4A 1VCNA 3WG9A 1E9VA 4HWKA 3V1NA 2CYCA 2FPLA 2HBZA 4MUFA 2GEDA 2Z6QA 4B8ZA 4OK6A 3VYSB 2V74B 2XCUA 2WD7A 1IN1A 3WQRA 1ZY2A 3NBYC 2J4FA 2NN3C 3GJSA 3KL4A 5GGXA 1PJSA 5IDYA 3IKVA 1X7WB 2ZZMA 3EZ2A 4OAPA 4UAJA 3RH0A 4U7TB 1CS4C 3MCUA 4CLOB 3K70B 2I4RA 2VYVD 1GV0A 1T5LA 5HOQA 2R25B 1P4SA 2YL2A 3QF4A 3QK7A 4Y2GA 3WHKA 1MHTA 3C8DA 3AUKA 3CRQA 4LZAA 4RZSA 2CFSA 3E5HA 4FHFA 1J0CA 3PFGA 1E7SA 3R8XA 1T8UA 4YRPA 3S2UA 4YWJA 2Z2IA 1M3SA 1ISRA 4OQEA 1G2IA 3G2JA 3WB1A 3CH5A 1QLHA 1QNLA 4WZAB 3V3KA 1VIYA 1TM2A 3ZTYA 1Z6YA 1DMSA 1KYXA 5LZ4A 2QGFA 1Q3TA 1RVDA 3NOXA 4UNQA 3FVVA 2BCJQ 1QO9A 1JH8A 2YIVX 1RXSA 4HYTA 4NOJA 1K6MA 2IZZA 2W2MA 3QOWA 2FWAA 4LC0A 4Y9UA 1STOA 2OAP1 4J0GA 2ZM5A 4FKMA 5BVHB 2W83A 2OZEA 3ABRB 3TRDA 2NM0A 3U56A 2ASVA 1CUIA 2CCJA 3LY8A 2WG1A 2AFHE 1PYGA 4B3TB 2WIAA 2YYYA 3D64A 1H8HD 1NBEA 4C5AA 1HZZC 1C9EA 1XI2A 5AW1A 2FFJA 4JR2A 1AZWA 1YJBA 5KVSA 4HTFB 3B3GA 1QRRA 3GAZA 1LLUA 1XTIA 5MN4A 1JPNA 1V1RB 4MQFA 1XR3A 4E3WA 1OB5A 2O8EA 2FDXA 1PW5A 4KZKA 1GHTA 1OR8A 2BKXA 2E0IA 2GVNA 2J5BA 3BIXA 3SEQA 3TUJC 1SZDA 3TKYA 1FLDA 3BXFA 2NX2A 4HAVA 3RLFA 4AO6A 4HV4A 1KI6A 1N5MA 2PK3A 1HGXA 3G88A 4GMFA 4ZOLF 2YV2A 1QTIA 4KVFA 3U7GA 2ZUBA 2Q9AA 4KLCA 5KJ1A 4EG1A 2JGEA 4DV2B 2HRCA 5B1DA 3RRBA 3RIEA 4WEOA 4RHXA 4B3MB 4Y2JA 3UWSA 1L9XA 3LUJA 121PA 2HLDA 3DV0A 4XYLA 1KRXA 1DRJA 2XA2A 3MLAA 4LBWA 5EE3A 4C4AA 4S05A 1ABEA 2R2GA 3KC2A 3QMMA 2IODA 3HZZA 3EN0A 3JR3A 2XWJI 4RIEA 5FUXA 5LQSA 4NAVA 4F72A 1ZEMA 2V7EA 1U0SY 1QV9A 4WL0A 2H0QA 3L8CA 2PXCA 5CU7A 1YS2X 4IQ8A 2NLOA 3IODA 2BKLA 4WI1A 5ISMA 2DH5A 2RMKA 3GQBB 1O9GA 1FMJA 3UJHA 4ZVLA 3VFDA 5K09A 2I6XA 4GGOA 2OY0A 1H4VB 2Z5LA 3LT5A 4US2R 3IJEB 3E82A 4XWOA 1X7XA 2WPDD 4W6QA 4YT8A 4E5NA 3WV4A 3NI2A 1THMA 3L0YA 5EWMB 4HQRA 5F1PA 3V8NA 1HUQA 3CWQA 5B55A 2DPMA 1HFKA 2VF2A 4JMPA 3TLMA 3A9TA 4PAQA 5TV2A 2I2DA 3DR5A 4OGGA 2ZUWA 1E0KA 3EQ7A 1FSPA 1CE8A 2F7SA 2A8YA 4Y2TA 1SHTX 3L1HA 4CLRA 4MQMA 1NTOA 1WPXA 3K9LA 3K0EA 5EPUA 1P61B 4R9RA 1FSGA 1NVWQ 3PNVA 2FW0A 1GKKA 3AZOA 2VJMA 1KRHA 3IILA 3MWKA 4NS1A 4OQPA 3EPHA 3I6IA 3COYA 2ZWAA 4FFRA 5E6UB 3HN6A 5L3SB 2C96A 1O5TA 2E7ZA 1D2GA 4CKEB 1SQSA 1B15A 5BR8B 3IE1A 1GAXA 2E6KA 4QOEA 3TKLA 1LKZA 3VR3A 3EBLA 3ZVMA 2PFKA 4I4CA 5FPKA 5IYZA 5CA0F 1CSEE 1JQBA 4LGVA 4MULA 1U4OA 1U98A 1FP2A 2CWWA 3I52A 4QU0A 4BV8A 5AW6A 4DUYB 2UDPA 4WFQA 3MS2A 1SHZA 3QBDA 1P0FA 3L7NA 1KIMA 1XTBA 1QC5A 5GADl 1XPJA 1EZZA 2QRQA 3DPSA 3FCCA 4B47A 3KQUA 1EX6A 2EC5A 3KM0A 2GYYA 3OFND 4Q16A 3WLJA 4F8EA 3IQFA 3WIDA 5JWOA 3ITDA 1IU9A 2GM5A 2QDXA 3GC6A 3PUJA 2YX1A 1SXGA 1VLLA 2YWRA 3ENQA 3AU8A 1BG6A 3I04A 2CXSA 1ZBDA 2C7GA 1QF7A 4K46A 1BIFA 1EX1A 3RYFB 3JQ8A 1AM4D 1XTUA 2GNOA 2QRHA 1AA9A 1HZJA 1U1CA 3FSGA 1AO3A 2V6MA 1G5QA 3NDRA 1TM3E 2OG2A 1XJ5A 2RCYA 3OG9A 4GC5A 1VA5A 2AVNA 1Z3IX 2P78A 2SICE 3AGQA 4IDEA 4QDTA 1K9SA 1M5RA 1T3HA 1U3TA 2FPIB 4RXTA 4YYEA 2FZLA 2WTUA 1NGSA 4TV9F 2FPMA 3M6IA 4XM1A 2A0XA 3E1GA 4TWZA 4TLMB 2XUJA 4D99A 1V5WA 2I5PO 3HLTA 4FLMA 4MO2A 1Z5PA 1B1CA 1V45E 4X1OA 1K88A 1UJ5A 1XMJA 3BSSA 2YVLA 2XH8A 3RUPA 1JQLB 3GEDA 4BFZA 2KS6A 1ELOA 1EVLA 5EVCA 5CPFA 4ER5A 2CSUA 2O0LA 1SEVA 4MP8A 1JYEA 1T5TA 1ZM2A 1G41A 2H1CA 2HX1A 1M1YE 1QKKA 3H97A 1QHEA 1E60A 1PNQA 1SPXA 4XYGA 3GGSA 3MCWA 5FJIA 3SQNA 3QNUA 4KTTE 5CM2Z 5IG2A 4WJLA 4X1KA 3LE8A 1WUJS 2BR3A 3CRVA 3MJRA 2PQ6A 4L5YA 5LXTA 3UGTA 3N8GA 2OA0A 1WUTA 4OXKA 2VDWA 1N6RA 2FQXA 2HIMA 2BRUA 1RWPA 3RF7A 5DOVA 1CZLA 3G2HA 1KQNA 1FCJA 1EDBA 1Y82A 2REBA 3DWFA 5TPWB 3OOSA 2Q0XA 5AVQA 1KZHA 4AKTA 2VP2A 1E1QD 3D0QA 3D6UA 3H2ZA 3PXEA 2F3RA 4AZ0B 3S2SA 4ZI7B 1B4DA 5EZYF 2Z43A 1EGQA 1E2LA 1K27A 3GFBA 3FDZA 3MIIA 4ZV9A 2OGTA 1V6AA 3AV0B 3KKOA 1GCIA 3GLHA 3MXOA 5IT4A 5D8DA 4EA9A 3AR5A 4H7DA 1GG5A 1S8NA 2Y76A 1IHUA 1L5RA 1NU8A 2DPGA 1DO2A 2XV1A 3NXKA 4B7UA 3VVMA 4HDRB 2R84A 5FPSA 5I7HA 1XL0A 2IOQA 1XTKA 4Z9XA 1U2ZA 1Z0FA 1NVDA 3EOAI 3OF3A 2HPAA 1ZAKA 2Q2WA 2QN9A 1YS9A 5AVSA 5C46F 4LGYA 3KTAB 1QZXA 1SUPA 4Q7KA 4L0QA 4HYQA 1KAMA 1TM4E 2W2NA 1QLJA 5JZBA 2H2WA 1XZJA 1L6RA 3SWWA 3QVLA 2Z04A 2Q5OA 5ALWA 2PSEA 4UKDA 4Q7QA 4LFAB 1YQWA 3OOWA 3LVQE 1F1BA 3QFCA 2YICA 5F5LA 3REFA 4EYGA 2JGIA 4XGIA 1BXGB 4JBIA 3SM3A 2YC2C 2YXEA 1SU7A 4NVRA 4E33A 1ZFNA 4EIWA 2JCVA 2GN6A 1JRLA 8AT1A 2OFPA 4NCAA 3H5AA 2I91A 1M6NA 2A5FA 2QLLA 3GROA 3IEIA 4PZ9A 2C57A 5A5FA 4OF4A 3KJEA 4B2IA 2A94A 2EWVA 1OI3A 3IJRA 2WQZA 1L5WA 1T2FA 2FP4A 3FPFA 1X94A 1EHYA 1K63A 3UB2A 1WKVA 2NMVA 1JSLA 4RPKA 1KI7A 1UWLA 2N3ZA 1TAQA 4M9UA 1TM5E 4ZCTA 2BGNA 1H3EA 1M2OB