1VGXA

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vgxA00
5E68A 2FQTA 1YCLA 1J98A 2FQOA 1JQWA 1JVIA 1INNA 1J6VA 4XCHA 1JOEA 1VGXA 1VH2A 1J6XA 1VJEA 1J6WA 1IE0A
chains in the Genus database with same CATH superfamily
1PJ6A 1VGXA 2E2IK 3GEEA 2VUMA 4Y7NC 2WAQL 3A8JA 3H0GK 3FKIK 2NVXA 2NVQK 1Y1WK 3RZDC 4A3DC 2V6UA 4AYBL 2PA8L 5D4DA 1YNJA 3MMLB 5C4XC 4BBRK 3HOXK 1G51A 3S14C 3PO3K 4Q4ZA 1TWHK 2VUMC 4A3CC 1IS1A 3AD9C 1DCHA 3A8KA 3HOYC 2YU9C 4PABA 4QJVA 3N3YA 1TWHA 4A3EC 1JOEA 3ERED 1UV7A 1XXBA 1XZPB 5IP9K 3RZOK 2R92C 3CQZK 3I4NK 2CFAB 4A3KC 4M1XA 4FZBA 5HL8A 2JA7A 3GEHA 4OINA 4A3GK 2XCRB 5M5XK 2EBBA 3GEIA 1WIHA 4PAAA 4BXXK 4OIQA 2JA8C 5IYBC 3AD7C 4X6AK 2E2JK 3FHZA 4BLAA 2RH6A 3M3YK 5TMCA 3AH5A 3HOZK 1O24A 4A3DK 1I3QC 3RZDK 4NOIA 1VRQC 3JSTA 2NVYC 5TJ3A 3GTQK 4O2DA 1F7UA 1VH2A 1WQHA 2JA8K 1EK8A 4OIRA 5L46A 2R92K 2PMZD 3GTGA 4JK1A 3HOVK 1IL2A 4BBSK 3S0XA 3H3VD 5C44K 2PPBA 5CJ9A 3S17K 2P8TA 2JA5C 4C45A 4ZH4A 4QIWD 1EFWA 3TTGA 3LPXA 3GTGC 3GTJA 4BY1K 1IE0A 4QIWL 4AH6A 2O5JA 3WODA 2RGRA 1TWHC 1Y1VK 4YG2A 4J3NA 4C3JC 3S14K 5IP7C 5C3EC 3GTOC 2A6EA 5C3EK 1K83K 4GTLA 1O27A 2PHCB 3M3YC 4A3FK 5JFEA 4KAWX 3S2DC 1WOSA 2D6FC 3HOUC 1RU0A 2PMZL 4GTEA 1BS2A 1L0WA 5IYDK 1HI9A 5IYBK 1Y1WC 1Y1VA 1YNNA 2R93K 2E2HC 3RZOC 3GTKK 1B4BA 2O5IA 3Q3QA 1SMYA 3HOWC 3S1MC 4MQ9A 4C3HK 4G0VA 3CQZC 3I4NC 2YU9A 3FKIA 2NVXK 1R9TA 4KATA 3M4OC 4KM9A 3GTPA 3V4GA 1EI6A 2R93A 1TWAK 3DXJA 3HXAA 2NVTC 3AQOA 4LQYA 1O2AA 3S15C 2GSOA 3LAJA 3BUEA 1WCMA 3S1RC 2A6HA 2GAHC 2JA6C 3GTMC 2YU9K 3T02A 5C4XK 1R9TK 1TWCA 2XCOA 4XSZA 2B63C 2ZUEA 2B63K 1I50K 4GFQA 1WCMK 4C3IK 2KWAA 4G7OA 4LOWA 1XZQA 1BGWA 5IOSA 2JA6K 1TWGA 4GTBA 1V5VA 4G0UA 4KMAA 5M3MK 2E2IA 2JH3A 4A3JC 1XZPA 1XXCA 5EGHA 3K7AC 4C2MC 3CAGA 4A3KK 3S2HK 1JQWA 4A3MC 3AQPA 1USMA 4MEXA 2PA8D 1EH1A 4KN4A 4KMDA 1DD5A 2A68A 3GTKA 4P5AA 1HQMA 3GTKC 4WJ4A 4BLBA 4KMUA 3OEPA 1WOOA 1VLOA 5EGEA 4WJ3M 3OPFA 1AB4A 1K83C 3GTLK 1I50C 4DDQA 1O29A 3GTQC 4Q5SA 1O2FB 3HOUK 2ZUFA 1VJEA 1TWAA 3T01A 2Y0SD 3LAPA 2VUMK 4A3CK 2E2JC 3ADAC 2R7ZC 3H3VL 1ZXOA 5E68A 4P5BA 3SZZA 3GTGK 5M5WK 5IOTA 2V6TA 2R92A 4LK1A 4A3LC 2P5MA 1I50A 2GSUA 4XCHA 1X31C 2CFAA 3GTLC 5IOQA 2JA5A 3HKZL 3I4MK 1TWFA 2WB1D 4LR2A 4KARA 5IP9C 3IPJA 3TFIA 1F93A 1TWGC 2JA6A 3OREA 1TWGK 1YCLA 4KASA 5TMFA 4LK0A 4BY7K 4YFKA 2ZFZA 3G4AA 4KN7A 1INNA 4MEYA 2NVYA 3GDZA 4XLNA 2CW0A 2WB1L 5FLMK 5C4JC 4BKWA 1XPPA 1TWFC 3I4MC 4A3FC 3FOFA 1O28A 1WCMC 1PJ7A 3GTMA 4WILA 4BBRC 3CQZA 5IP7K 3GTOK 3HOZC 4C3JK 5FJ8K 3S16C 2NVYK 3N0CA 1Y1WA 2R7ZK 1J6XA 1SFOC 4GT9A 1KQ4A 1ZBSA 3GSIA 1BDFA 1WQGA 2NVTK 5C4JK 3S1NK 5IYCC 1TWAC 3S1QK 1PJ5A 3TFHA 2BE5A 1DCPA 3FKIC 4YFXA 4G7ZA 4GTDA 2R7ZA 4KMHA 3N0BA 4A3BC 3S17C 3S2HC 3GTPK 3GTPC 2GAGC 3PO2K 2JA5K 1J6VA 4BBSC 3GTQA 4FM9A 4KM8A 4XLPA 3EQLA 1JVIA 1O2BA 1YX2A 1EQRA 4GTAA 4KB4A 4QJVB 3FOEA 4C3IC 1K83A 4P9SA 5CHPA 1I6HC 2V6SA 3GTJC 3L4JA 4A93K 1SFOA 1GE9A 2B63A 1I3QK 2JA7K 4KDDA 5IYCK 4RMFA 4Y52C 3S16K 1ZQ1C 1ZYRA 2Y3PA 1ZVUA 4X6AC 3GTMK 3HOXC 3S1RK 3GTJK 4A93C 2FQTA 3GTOA 1F9NA 1IW7A 3T00A 1ISEA 4A3GC 4Y7NK 4G0WA 2XCQA 5IORA 1BJTA 1O26A 3H0GC 4A3IK 1J98A 1WORA 2WAQD 2Y0SL 1WQFA 3HOWK 3S1MK 4A3EK 5JVOA 4KB2A 4A3JK 2E2HK 2NVXC 4G7HA 1IQ0A 3HOVC 4A3BK 4LJZA 3GIRA 4C3HC 1I6VA 2FQOA 1WSVA 3GTLA 5IYDC 4C2MK 1XXAA 3K7AK 1USOA 4YFNA 1J6WA 1TWCK 3HOYK 2R93C 4A3IC 4AYBD 3A8IA 2E2HA 1F7VA 3QX3A 3PO3C 1WOPA 1XZQB 3S1QC 3SZYA 4A3LK 4GZYA 3AD8C 2W7VA 3BP3A 3S1NC 3S2DK 3TFJA 3L4KA 4GTFA 1R9TC 2JA7C 3G4CA 4GTCA 1SFOK 1O25A 1I3QA 1Y1VC 4LLGA 2A69A 3BP8C 1TWFK 2GSNA 3S15K 4Y52K 3HKZD 4ILDA 3VA7A 5M3FK 1I6HK 2NVQC 1IBAA 4BY1C 4BXXC 4OIOA 5M5YK 1B4AA 1C0AA 5FLMC 4BY7C 4OIPA 3PO2C 4XSXA 1TWCC 4A3MK 2E2IC 3NUHA 5C44C 3H0GA 3M4OK 1DCOA 4KC6A 1WSRA
chains in the Genus database with same CATH topology
5E68A 2FQTA 1YCLA 1J98A 2FQOA 1JQWA 1JVIA 1INNA 1J6VA 4XCHA 1JOEA 1VGXA 1VH2A 1J6XA 1VJEA 1J6WA 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E68 A;  2FQT A;  1YCL A;  1J98 A;  2FQO A;  1JQW A;  1JVI A;  1INN A;  1J6V A;  4XCH A;  1JOE A;  1VGX A;  1VH2 A;  1J6X A;  1VJE A;  1J6W A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 1PJ6 A;  1VGX A;  2E2I K;  3GEE A;  2VUM A;  4Y7N C;  2WAQ L;  3A8J A;  3H0G K;  3FKI K;  2NVX A;  2NVQ K;  1Y1W K;  3RZD C;  4A3D C;  2V6U A;  4AYB L;  2PA8 L;  5D4D A;  1YNJ A;  3MML B;  5C4X C;  4BBR K;  3HOX K;  1G51 A;  3S14 C;  3PO3 K;  4Q4Z A;  1TWH K;  2VUM C;  4A3C C;  1IS1 A;  3AD9 C;  1DCH A;  3A8K A;  3HOY C;  2YU9 C;  4PAB A;  4QJV A;  3N3Y A;  1TWH A;  4A3E C;  1JOE A;  3ERE D;  1UV7 A;  1XXB A;  1XZP B;  5IP9 K;  3RZO K;  2R92 C;  3CQZ K;  3I4N K;  2CFA B;  4A3K C;  4M1X A;  4FZB A;  5HL8 A;  2JA7 A;  3GEH A;  4OIN A;  4A3G K;  2XCR B;  5M5X K;  2EBB A;  3GEI A;  1WIH A;  4PAA A;  4BXX K;  4OIQ A;  2JA8 C;  5IYB C;  3AD7 C;  4X6A K;  2E2J K;  3FHZ A;  4BLA A;  2RH6 A;  3M3Y K;  5TMC A;  3AH5 A;  3HOZ K;  1O24 A;  4A3D K;  1I3Q C;  3RZD K;  4NOI A;  1VRQ C;  3JST A;  2NVY C;  5TJ3 A;  3GTQ K;  4O2D A;  1F7U A;  1VH2 A;  1WQH A;  2JA8 K;  1EK8 A;  4OIR A;  5L46 A;  2R92 K;  2PMZ D;  3GTG A;  4JK1 A;  3HOV K;  1IL2 A;  4BBS K;  3S0X A;  3H3V D;  5C44 K;  2PPB A;  5CJ9 A;  3S17 K;  2P8T A;  2JA5 C;  4C45 A;  4ZH4 A;  4QIW D;  1EFW A;  3TTG A;  3LPX A;  3GTG C;  3GTJ A;  4BY1 K;  1IE0 A;  4QIW L;  4AH6 A;  2O5J A;  3WOD A;  2RGR A;  1TWH C;  1Y1V K;  4YG2 A;  4J3N A;  4C3J C;  3S14 K;  5IP7 C;  5C3E C;  3GTO C;  2A6E A;  5C3E K;  1K83 K;  4GTL A;  1O27 A;  2PHC B;  3M3Y C;  4A3F K;  5JFE A;  4KAW X;  3S2D C;  1WOS A;  2D6F C;  3HOU C;  1RU0 A;  2PMZ L;  4GTE A;  1BS2 A;  1L0W A;  5IYD K;  1HI9 A;  5IYB K;  1Y1W C;  1Y1V A;  1YNN A;  2R93 K;  2E2H C;  3RZO C;  3GTK K;  1B4B A;  2O5I A;  3Q3Q A;  1SMY A;  3HOW C;  3S1M C;  4MQ9 A;  4C3H K;  4G0V A;  3CQZ C;  3I4N C;  2YU9 A;  3FKI A;  2NVX K;  1R9T A;  4KAT A;  3M4O C;  4KM9 A;  3GTP A;  3V4G A;  1EI6 A;  2R93 A;  1TWA K;  3DXJ A;  3HXA A;  2NVT C;  3AQO A;  4LQY A;  1O2A A;  3S15 C;  2GSO A;  3LAJ A;  3BUE A;  1WCM A;  3S1R C;  2A6H A;  2GAH C;  2JA6 C;  3GTM C;  2YU9 K;  3T02 A;  5C4X K;  1R9T K;  1TWC A;  2XCO A;  4XSZ A;  2B63 C;  2ZUE A;  2B63 K;  1I50 K;  4GFQ A;  1WCM K;  4C3I K;  2KWA A;  4G7O A;  4LOW A;  1XZQ A;  1BGW A;  5IOS A;  2JA6 K;  1TWG A;  4GTB A;  1V5V A;  4G0U A;  4KMA A;  5M3M K;  2E2I A;  2JH3 A;  4A3J C;  1XZP A;  1XXC A;  5EGH A;  3K7A C;  4C2M C;  3CAG A;  4A3K K;  3S2H K;  1JQW A;  4A3M C;  3AQP A;  1USM A;  4MEX A;  2PA8 D;  1EH1 A;  4KN4 A;  4KMD A;  1DD5 A;  2A68 A;  3GTK A;  4P5A A;  1HQM A;  3GTK C;  4WJ4 A;  4BLB A;  4KMU A;  3OEP A;  1WOO A;  1VLO A;  5EGE A;  4WJ3 M;  3OPF A;  1AB4 A;  1K83 C;  3GTL K;  1I50 C;  4DDQ A;  1O29 A;  3GTQ C;  4Q5S A;  1O2F B;  3HOU K;  2ZUF A;  1VJE A;  1TWA A;  3T01 A;  2Y0S D;  3LAP A;  2VUM K;  4A3C K;  2E2J C;  3ADA C;  2R7Z C;  3H3V L;  1ZXO A;  5E68 A;  4P5B A;  3SZZ A;  3GTG K;  5M5W K;  5IOT A;  2V6T A;  2R92 A;  4LK1 A;  4A3L C;  2P5M A;  1I50 A;  2GSU A;  4XCH A;  1X31 C;  2CFA A;  3GTL C;  5IOQ A;  2JA5 A;  3HKZ L;  3I4M K;  1TWF A;  2WB1 D;  4LR2 A;  4KAR A;  5IP9 C;  3IPJ A;  3TFI A;  1F93 A;  1TWG C;  2JA6 A;  3ORE A;  1TWG K;  1YCL A;  4KAS A;  5TMF A;  4LK0 A;  4BY7 K;  4YFK A;  2ZFZ A;  3G4A A;  4KN7 A;  1INN A;  4MEY A;  2NVY A;  3GDZ A;  4XLN A;  2CW0 A;  2WB1 L;  5FLM K;  5C4J C;  4BKW A;  1XPP A;  1TWF C;  3I4M C;  4A3F C;  3FOF A;  1O28 A;  1WCM C;  1PJ7 A;  3GTM A;  4WIL A;  4BBR C;  3CQZ A;  5IP7 K;  3GTO K;  3HOZ C;  4C3J K;  5FJ8 K;  3S16 C;  2NVY K;  3N0C A;  1Y1W A;  2R7Z K;  1J6X A;  1SFO C;  4GT9 A;  1KQ4 A;  1ZBS A;  3GSI A;  1BDF A;  1WQG A;  2NVT K;  5C4J K;  3S1N K;  5IYC C;  1TWA C;  3S1Q K;  1PJ5 A;  3TFH A;  2BE5 A;  1DCP A;  3FKI C;  4YFX A;  4G7Z A;  4GTD A;  2R7Z A;  4KMH A;  3N0B A;  4A3B C;  3S17 C;  3S2H C;  3GTP K;  3GTP C;  2GAG C;  3PO2 K;  2JA5 K;  1J6V A;  4BBS C;  3GTQ A;  4FM9 A;  4KM8 A;  4XLP A;  3EQL A;  1JVI A;  1O2B A;  1YX2 A;  1EQR A;  4GTA A;  4KB4 A;  4QJV B;  3FOE A;  4C3I C;  1K83 A;  4P9S A;  5CHP A;  1I6H C;  2V6S A;  3GTJ C;  3L4J A;  4A93 K;  1SFO A;  1GE9 A;  2B63 A;  1I3Q K;  2JA7 K;  4KDD A;  5IYC K;  4RMF A;  4Y52 C;  3S16 K;  1ZQ1 C;  1ZYR A;  2Y3P A;  1ZVU A;  4X6A C;  3GTM K;  3HOX C;  3S1R K;  3GTJ K;  4A93 C;  2FQT A;  3GTO A;  1F9N A;  1IW7 A;  3T00 A;  1ISE A;  4A3G C;  4Y7N K;  4G0W A;  2XCQ A;  5IOR A;  1BJT A;  1O26 A;  3H0G C;  4A3I K;  1J98 A;  1WOR A;  2WAQ D;  2Y0S L;  1WQF A;  3HOW K;  3S1M K;  4A3E K;  5JVO A;  4KB2 A;  4A3J K;  2E2H K;  2NVX C;  4G7H A;  1IQ0 A;  3HOV C;  4A3B K;  4LJZ A;  3GIR A;  4C3H C;  1I6V A;  2FQO A;  1WSV A;  3GTL A;  5IYD C;  4C2M K;  1XXA A;  3K7A K;  1USO A;  4YFN A;  1J6W A;  1TWC K;  3HOY K;  2R93 C;  4A3I C;  4AYB D;  3A8I A;  2E2H A;  1F7V A;  3QX3 A;  3PO3 C;  1WOP A;  1XZQ B;  3S1Q C;  3SZY A;  4A3L K;  4GZY A;  3AD8 C;  2W7V A;  3BP3 A;  3S1N C;  3S2D K;  3TFJ A;  3L4K A;  4GTF A;  1R9T C;  2JA7 C;  3G4C A;  4GTC A;  1SFO K;  1O25 A;  1I3Q A;  1Y1V C;  4LLG A;  2A69 A;  3BP8 C;  1TWF K;  2GSN A;  3S15 K;  4Y52 K;  3HKZ D;  4ILD A;  3VA7 A;  5M3F K;  1I6H K;  2NVQ C;  1IBA A;  4BY1 C;  4BXX C;  4OIO A;  5M5Y K;  1B4A A;  1C0A A;  5FLM C;  4BY7 C;  4OIP A;  3PO2 C;  4XSX A;  1TWC C;  4A3M K;  2E2I C;  3NUH A;  5C44 C;  3H0G A;  3M4O K;  1DCO A;  4KC6 A;  1WSR A; 
#chains in the Genus database with same CATH homology
 5E68 A;  2FQT A;  1YCL A;  1J98 A;  2FQO A;  1JQW A;  1JVI A;  1INN A;  1J6V A;  4XCH A;  1JOE A;  1VGX A;  1VH2 A;  1J6X A;  1VJE A;  1J6W A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...