1VGXA

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vgxA00
1JQWA 1J6WA 1JVIA 1VJEA 5E68A 1VH2A 2FQTA 4XCHA 2FQOA 1VGXA 1JOEA 1J98A 1IE0A 1J6VA 1YCLA 1INNA 1J6XA
chains in the Genus database with same CATH superfamily
4KARA 3HKZL 4GTDA 1I3QC 3I4NC 3ERED 4A3MK 2E2HK 3M4OK 4C3HK 2WB1D 3GTLC 3T02A 3BP8C 4YFKA 2EBBA 4GZYA 1K83C 3HOUK 4GTBA 4AYBD 4BKWA 2NVYK 4G0VA 3M3YC 1WQHA 1EFWA 3NUHA 4G7OA 1Y1WC 4X6AC 1F93A 2XCOA 5C4JC 4BY7K 1TWFA 3N3YA 3GTJK 4OIOA 3S1MK 3GSIA 1JOEA 1G51A 5IYBK 4QIWL 4C2MK 1JVIA 1TWCK 2R93C 2A69A 1WQFA 3GTOK 1WSVA 2JA5K 2JA6C 5IP7C 4GT9A 1UV7A 3FKIK 5JFEA 3HOVK 4G0WA 2GSNA 1TWHK 1XXAA 2GSUA 3GDZA 3TFHA 5EGHA 1BGWA 5IYDC 1WSRA 5IP9C 2B63A 3S16C 2V6UA 4OINA 4RMFA 4MEYA 4PABA 1F7VA 4KMDA 4A3LK 1VH2A 4FM9A 3CQZC 2V6SA 1TWAK 3GIRA 4KATA 2PA8L 2WB1L 1C0AA 4A3MC 1XPPA 3M4OC 1WIHA 1DCOA 4GTFA 1EQRA 1F9NA 4C3HC 2O5IA 4AYBL 3H3VL 2VUMK 4BY1K 3HOUC 1GE9A 1USOA 3AD8C 3OREA 2NVYC 1O28A 1XZQB 3GEHA 3S2DK 2O5JA 5CHPA 2ZFZA 1EK8A 5FLMK 1Y1VA 4BY7C 4KB4A 2NVQK 4P5BA 2GAHC 3GTJC 3GTPK 3S1MC 1J98A 4QIWD 2Y3PA 5IYBC 4A3EK 4C2MC 5M3MK 4KN4A 3GTGA 1KQ4A 4G7ZA 1TWCC 1O27A 2ZUEA 3V4GA 4C3IK 2XCRB 1I6VA 3GTOC 3K7AK 2JA5C 4NOIA 1VGXA 5M5YK 5IOSA 3GTMA 2WAQL 3FKIC 4KM8A 3HOVC 3S1NK 1O24A 1VLOA 3L4KA 5EGEA 1TWHC 1RU0A 4OIQA 1B4AA 2P8TA 4KM9A 4Q5SA 4XSZA 3GTKK 1IW7A 3GTLA 1K83A 5D4DA 1INNA 1ZQ1C 4A3LC 1ZYRA 4WJ3M 1DCPA 4JK1A 1TWAC 2PA8D 3A8JA 4BLBA 3RZDK 5IOTA 1USMA 2E2IK 5C3EK 1JQWA 2PHCB 2CFAB 4ILDA 1Y1WA 1PJ6A 4LR2A 3H3VD 3N0CA 4YG2A 5M5XK 2VUMC 3TTGA 4BY1C 2B63K 1SFOA 5JVOA 1O2BA 3S14K 5HL8A 3S2DC 4BBRK 1VJEA 1ISEA 2V6TA 4C3JK 1XZQA 1I50K 4A3FK 2YU9K 5FLMC 2R93A 2JA7A 3BUEA 4GFQA 1WOPA 2NVQC 2NVTK 3GTQK 3S2HC 1I6HK 3GTPC 4J3NA 1XZPA 5TJ3A 4A3EC 3PO2K 5IYCK 4A3JK 1PJ7A 1IQ0A 3FHZA 4C3IC 4WJ4A 3TFIA 3K7AC 4OIRA 3HOZK 3OPFA 2WAQD 2E2JK 4LQYA 3CQZA 3Q3QA 3S1NC 3I4MK 3S15K 3PO3K 4WILA 5CJ9A 5TMCA 4GTEA 2R92A 1ZVUA 3GTKC 4OIPA 4DDQA 3S1RK 3MMLB 1BS2A 4XLPA 2W7VA 2NVXK 2R7ZA 2E2HC 3LPXA 4P5AA 4BBSK 3RZDC 2E2IC 5TMFA 3ADAC 5C3EC 4PAAA 3G4AA 1O26A 4A3BK 1X31C 1VRQC 1ZBSA 4ZH4A 1R9TA 2CFAA 3LAJA 4GTAA 1V5VA 1YCLA 3IPJA 1J6XA 2B63C 3S14C 4BBRC 3DXJA 4C3JC 4KAWX 3HOYK 1BDFA 1I50C 2JH3A 1TWCA 2Y0SD 4A3FC 2FQOA 2YU9C 2A6EA 1TWGA 1B4BA 1XXCA 3GTOA 3HOXK 5C44K 2NVTC 4KB2A 3GTQC 4LOWA 1I6HC 4YFXA 4G0UA 3PO2C 5IYCC 4A3JC 1WCMA 1SFOK 1WOOA 5FJ8K 1TWHA 4BXXK 4A3CK 4G7HA 1TWFK 3H0GA 3N0BA 3HOWK 3HOZC 3WODA 5C4XK 2JA7K 1I3QA 2E2JC 4MEXA 4GTLA 3I4MC 5IOQA 4Y7NK 3S15C 4QJVB 2GSOA 3PO3C 4LK0A 1WQGA 1YNNA 3AD7C 3S1RC 4YFNA 2VUMA 2NVXC 4M1XA 1O2FB 2FQTA 4GTCA 4A3DK 4BBSC 3T01A 3A8IA 1IL2A 2A68A 2RH6A 1YNJA 4LLGA 4A3BC 3S17K 4Y52K 3G4CA 1EH1A 4A3KK 1BJTA 1O2AA 3SZZA 1EI6A 1IS1A 3GTPA 2R92K 2Y0SL 2R7ZK 4MQ9A 3RZOK 3HOYC 2JA6A 3GEEA 5E68A 2GAGC 4XLNA 3QX3A 1O29A 3HOXC 4AH6A 5C44C 4A3IK 4O2DA 1R9TK 4KC6A 2RGRA 3EQLA 1SFOC 4A3GK 1Y1VK 2PMZL 4BXXC 4A3CC 1HI9A 2BE5A 4Q4ZA 1WOSA 1TWFC 4BLAA 1PJ5A 3HOWC 3AQPA 3GTKA 5C4XC 3AD9C 1TWGK 2ZUFA 2JA7C 4KDDA 3AH5A 2E2HA 2JA8K 1SMYA 3FOEA 3GTGK 5L46A 4Y7NC 3S1QK 1WORA 2E2IA 2D6FC 4QJVA 1WCMK 2NVYA 1O25A 3GTMK 4A93K 2CW0A 1AB4A 3H0GK 2PPBA 4A3DC 4C45A 1I3QK 3I4NK 1IBAA 1I50A 2YU9A 3HKZD 4XCHA 3FOFA 3GTJA 3L4JA 1ZXOA 4Y52C 3S17C 4A3KC 3GTLK 5IORA 1J6WA 1K83K 3GTQA 1XXBA 4LJZA 1DCHA 2R92C 3M3YK 4KMHA 2R7ZC 3RZOC 2JA5A 2KWAA 1Y1WK 4X6AK 5C4JK 1L0WA 3FKIA 4KASA 4A3IC 1YX2A 4P9SA 1R9TC 5M3FK 3CAGA 1XZPB 3SZYA 2PMZD 3S2HK 4FZBA 2R93K 4A3GC 1Y1VC 1DD5A 3JSTA 2A6HA 3T00A 2JA6K 5IP7K 1TWAA 3TFJA 1HQMA 1TWGC 4KMAA 4KN7A 4XSXA 3OEPA 2NVXA 4KMUA 2JA8C 3BP3A 3GEIA 2P5MA 3GTGC 3VA7A 5M5WK 1J6VA 3S1QC 5IYDK 5IP9K 1F7UA 4LK1A 1WCMC 3S16K 1IE0A 3LAPA 3GTMC 4A93C 2XCQA 3HXAA 3S0XA 3A8KA 3AQOA 3H0GC 3CQZK
chains in the Genus database with same CATH topology
1JQWA 1J6WA 1JVIA 1VJEA 5E68A 1VH2A 2FQTA 4XCHA 2FQOA 1VGXA 1JOEA 1J98A 1IE0A 1J6VA 1YCLA 1INNA 1J6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1J6W A;  1JVI A;  1VJE A;  5E68 A;  1VH2 A;  2FQT A;  4XCH A;  2FQO A;  1VGX A;  1JOE A;  1J98 A;  1IE0 A;  1J6V A;  1YCL A;  1INN A;  1J6X A; 
#chains in the Genus database with same CATH topology
 4KAR A;  3HKZ L;  4GTD A;  1I3Q C;  3I4N C;  3ERE D;  4A3M K;  2E2H K;  3M4O K;  4C3H K;  2WB1 D;  3GTL C;  3T02 A;  3BP8 C;  4YFK A;  2EBB A;  4GZY A;  1K83 C;  3HOU K;  4GTB A;  4AYB D;  4BKW A;  2NVY K;  4G0V A;  3M3Y C;  1WQH A;  1EFW A;  3NUH A;  4G7O A;  1Y1W C;  4X6A C;  1F93 A;  2XCO A;  5C4J C;  4BY7 K;  1TWF A;  3N3Y A;  3GTJ K;  4OIO A;  3S1M K;  3GSI A;  1JOE A;  1G51 A;  5IYB K;  4QIW L;  4C2M K;  1JVI A;  1TWC K;  2R93 C;  2A69 A;  1WQF A;  3GTO K;  1WSV A;  2JA5 K;  2JA6 C;  5IP7 C;  4GT9 A;  1UV7 A;  3FKI K;  5JFE A;  3HOV K;  4G0W A;  2GSN A;  1TWH K;  1XXA A;  2GSU A;  3GDZ A;  3TFH A;  5EGH A;  1BGW A;  5IYD C;  1WSR A;  5IP9 C;  2B63 A;  3S16 C;  2V6U A;  4OIN A;  4RMF A;  4MEY A;  4PAB A;  1F7V A;  4KMD A;  4A3L K;  1VH2 A;  4FM9 A;  3CQZ C;  2V6S A;  1TWA K;  3GIR A;  4KAT A;  2PA8 L;  2WB1 L;  1C0A A;  4A3M C;  1XPP A;  3M4O C;  1WIH A;  1DCO A;  4GTF A;  1EQR A;  1F9N A;  4C3H C;  2O5I A;  4AYB L;  3H3V L;  2VUM K;  4BY1 K;  3HOU C;  1GE9 A;  1USO A;  3AD8 C;  3ORE A;  2NVY C;  1O28 A;  1XZQ B;  3GEH A;  3S2D K;  2O5J A;  5CHP A;  2ZFZ A;  1EK8 A;  5FLM K;  1Y1V A;  4BY7 C;  4KB4 A;  2NVQ K;  4P5B A;  2GAH C;  3GTJ C;  3GTP K;  3S1M C;  1J98 A;  4QIW D;  2Y3P A;  5IYB C;  4A3E K;  4C2M C;  5M3M K;  4KN4 A;  3GTG A;  1KQ4 A;  4G7Z A;  1TWC C;  1O27 A;  2ZUE A;  3V4G A;  4C3I K;  2XCR B;  1I6V A;  3GTO C;  3K7A K;  2JA5 C;  4NOI A;  1VGX A;  5M5Y K;  5IOS A;  3GTM A;  2WAQ L;  3FKI C;  4KM8 A;  3HOV C;  3S1N K;  1O24 A;  1VLO A;  3L4K A;  5EGE A;  1TWH C;  1RU0 A;  4OIQ A;  1B4A A;  2P8T A;  4KM9 A;  4Q5S A;  4XSZ A;  3GTK K;  1IW7 A;  3GTL A;  1K83 A;  5D4D A;  1INN A;  1ZQ1 C;  4A3L C;  1ZYR A;  4WJ3 M;  1DCP A;  4JK1 A;  1TWA C;  2PA8 D;  3A8J A;  4BLB A;  3RZD K;  5IOT A;  1USM A;  2E2I K;  5C3E K;  1JQW A;  2PHC B;  2CFA B;  4ILD A;  1Y1W A;  1PJ6 A;  4LR2 A;  3H3V D;  3N0C A;  4YG2 A;  5M5X K;  2VUM C;  3TTG A;  4BY1 C;  2B63 K;  1SFO A;  5JVO A;  1O2B A;  3S14 K;  5HL8 A;  3S2D C;  4BBR K;  1VJE A;  1ISE A;  2V6T A;  4C3J K;  1XZQ A;  1I50 K;  4A3F K;  2YU9 K;  5FLM C;  2R93 A;  2JA7 A;  3BUE A;  4GFQ A;  1WOP A;  2NVQ C;  2NVT K;  3GTQ K;  3S2H C;  1I6H K;  3GTP C;  4J3N A;  1XZP A;  5TJ3 A;  4A3E C;  3PO2 K;  5IYC K;  4A3J K;  1PJ7 A;  1IQ0 A;  3FHZ A;  4C3I C;  4WJ4 A;  3TFI A;  3K7A C;  4OIR A;  3HOZ K;  3OPF A;  2WAQ D;  2E2J K;  4LQY A;  3CQZ A;  3Q3Q A;  3S1N C;  3I4M K;  3S15 K;  3PO3 K;  4WIL A;  5CJ9 A;  5TMC A;  4GTE A;  2R92 A;  1ZVU A;  3GTK C;  4OIP A;  4DDQ A;  3S1R K;  3MML B;  1BS2 A;  4XLP A;  2W7V A;  2NVX K;  2R7Z A;  2E2H C;  3LPX A;  4P5A A;  4BBS K;  3RZD C;  2E2I C;  5TMF A;  3ADA C;  5C3E C;  4PAA A;  3G4A A;  1O26 A;  4A3B K;  1X31 C;  1VRQ C;  1ZBS A;  4ZH4 A;  1R9T A;  2CFA A;  3LAJ A;  4GTA A;  1V5V A;  1YCL A;  3IPJ A;  1J6X A;  2B63 C;  3S14 C;  4BBR C;  3DXJ A;  4C3J C;  4KAW X;  3HOY K;  1BDF A;  1I50 C;  2JH3 A;  1TWC A;  2Y0S D;  4A3F C;  2FQO A;  2YU9 C;  2A6E A;  1TWG A;  1B4B A;  1XXC A;  3GTO A;  3HOX K;  5C44 K;  2NVT C;  4KB2 A;  3GTQ C;  4LOW A;  1I6H C;  4YFX A;  4G0U A;  3PO2 C;  5IYC C;  4A3J C;  1WCM A;  1SFO K;  1WOO A;  5FJ8 K;  1TWH A;  4BXX K;  4A3C K;  4G7H A;  1TWF K;  3H0G A;  3N0B A;  3HOW K;  3HOZ C;  3WOD A;  5C4X K;  2JA7 K;  1I3Q A;  2E2J C;  4MEX A;  4GTL A;  3I4M C;  5IOQ A;  4Y7N K;  3S15 C;  4QJV B;  2GSO A;  3PO3 C;  4LK0 A;  1WQG A;  1YNN A;  3AD7 C;  3S1R C;  4YFN A;  2VUM A;  2NVX C;  4M1X A;  1O2F B;  2FQT A;  4GTC A;  4A3D K;  4BBS C;  3T01 A;  3A8I A;  1IL2 A;  2A68 A;  2RH6 A;  1YNJ A;  4LLG A;  4A3B C;  3S17 K;  4Y52 K;  3G4C A;  1EH1 A;  4A3K K;  1BJT A;  1O2A A;  3SZZ A;  1EI6 A;  1IS1 A;  3GTP A;  2R92 K;  2Y0S L;  2R7Z K;  4MQ9 A;  3RZO K;  3HOY C;  2JA6 A;  3GEE A;  5E68 A;  2GAG C;  4XLN A;  3QX3 A;  1O29 A;  3HOX C;  4AH6 A;  5C44 C;  4A3I K;  4O2D A;  1R9T K;  4KC6 A;  2RGR A;  3EQL A;  1SFO C;  4A3G K;  1Y1V K;  2PMZ L;  4BXX C;  4A3C C;  1HI9 A;  2BE5 A;  4Q4Z A;  1WOS A;  1TWF C;  4BLA A;  1PJ5 A;  3HOW C;  3AQP A;  3GTK A;  5C4X C;  3AD9 C;  1TWG K;  2ZUF A;  2JA7 C;  4KDD A;  3AH5 A;  2E2H A;  2JA8 K;  1SMY A;  3FOE A;  3GTG K;  5L46 A;  4Y7N C;  3S1Q K;  1WOR A;  2E2I A;  2D6F C;  4QJV A;  1WCM K;  2NVY A;  1O25 A;  3GTM K;  4A93 K;  2CW0 A;  1AB4 A;  3H0G K;  2PPB A;  4A3D C;  4C45 A;  1I3Q K;  3I4N K;  1IBA A;  1I50 A;  2YU9 A;  3HKZ D;  4XCH A;  3FOF A;  3GTJ A;  3L4J A;  1ZXO A;  4Y52 C;  3S17 C;  4A3K C;  3GTL K;  5IOR A;  1J6W A;  1K83 K;  3GTQ A;  1XXB A;  4LJZ A;  1DCH A;  2R92 C;  3M3Y K;  4KMH A;  2R7Z C;  3RZO C;  2JA5 A;  2KWA A;  1Y1W K;  4X6A K;  5C4J K;  1L0W A;  3FKI A;  4KAS A;  4A3I C;  1YX2 A;  4P9S A;  1R9T C;  5M3F K;  3CAG A;  1XZP B;  3SZY A;  2PMZ D;  3S2H K;  4FZB A;  2R93 K;  4A3G C;  1Y1V C;  1DD5 A;  3JST A;  2A6H A;  3T00 A;  2JA6 K;  5IP7 K;  1TWA A;  3TFJ A;  1HQM A;  1TWG C;  4KMA A;  4KN7 A;  4XSX A;  3OEP A;  2NVX A;  4KMU A;  2JA8 C;  3BP3 A;  3GEI A;  2P5M A;  3GTG C;  3VA7 A;  5M5W K;  1J6V A;  3S1Q C;  5IYD K;  5IP9 K;  1F7U A;  4LK1 A;  1WCM C;  3S16 K;  1IE0 A;  3LAP A;  3GTM C;  4A93 C;  2XCQ A;  3HXA A;  3S0X A;  3A8K A;  3AQO A;  3H0G C;  3CQZ K; 
#chains in the Genus database with same CATH homology
 1JQW A;  1J6W A;  1JVI A;  1VJE A;  5E68 A;  1VH2 A;  2FQT A;  4XCH A;  2FQO A;  1VGX A;  1JOE A;  1J98 A;  1IE0 A;  1J6V A;  1YCL A;  1INN A;  1J6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...