1VGXA

Crystal structure of a autoinducer-2 synthesis protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
b'ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteinase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vgxA00
1VJEA 1INNA 5E68A 2FQOA 1YCLA 1J6VA 1IE0A 1J6WA 1VH2A 1JOEA 4XCHA 1JQWA 1J98A 2FQTA 1JVIA 1VGXA 1J6XA
chains in the Genus database with same CATH superfamily
4KARA 2R92C 5C4JK 1ZXOA 4KMDA 3H0GC 1TWGA 3HOWC 2R7ZA 1SFOA 1INNA 4A3BC 2NVTC 3FOFA 2GSNA 4C3HK 4A3JC 1TWCK 1UV7A 2WAQD 3CAGA 2Y0SD 5C44C 2GAGC 4KDDA 1G51A 3PO3K 3N3YA 4GTEA 2CFAA 3PO2C 1USMA 1VH2A 1WCMC 4KMAA 3HOXK 1GE9A 4XLPA 5FLMC 2E2IC 2E2HK 4J3NA 2PMZL 2PA8D 4KN7A 2E2HA 3I4NK 3S1RK 3GTLA 1TWHC 2FQTA 3S1QC 1XXCA 5M3FK 4C3IC 5M5WK 2V6UA 2PMZD 3GTOC 5CHPA 4XSXA 3EQLA 4KM9A 1WSVA 4RMFA 2R93K 3A8KA 4FM9A 5C3EC 4AYBD 3RZOC 4FZBA 1ZQ1C 1BDFA 1VJEA 1B4AA 1USOA 1AB4A 1VLOA 2EBBA 3TFHA 3FKIA 4XLNA 1C0AA 1Y1WA 5IP9K 3HOVC 3V4GA 5C4JC 1V5VA 3S1MK 5IOTA 3DXJA 5IYDK 3SZZA 1I6VA 4C3HC 4XCHA 1TWCC 4KMHA 2PPBA 5IOSA 3PO3C 1WQFA 2B63K 4KB2A 3HOXC 4YG2A 3GTMK 2B63A 2A6EA 1EK8A 3I4NC 5CJ9A 3S1RC 2ZFZA 4KASA 4MQ9A 2BE5A 2CFAB 3S1NK 3M4OK 3LPXA 5IYCK 4O2DA 4C45A 2R93C 2NVXA 4A3LK 5IYBK 3H3VL 3BP3A 4MEXA 2VUMK 3MMLB 3GTGK 1DCOA 3H3VD 3GTGA 4P5AA 5IP9C 3OEPA 1TWAA 4G7HA 4A3DK 3OREA 5M5XK 3S1MC 3BUEA 5C4XC 4GZYA 3AH5A 4OIOA 4LOWA 5IYDC 2ZUEA 4C3JC 3VA7A 4QIWL 3CQZK 1YNJA 3GTKK 3G4CA 3HKZL 1ZBSA 3CQZA 1EQRA 2YU9K 4P9SA 1I50K 1TWGK 1WORA 2R7ZK 2YU9A 2W7VA 3AD7C 2WAQL 3AQOA 3GDZA 1I50A 5M5YK 2Y0SL 1SFOK 3GTMC 4QIWD 2JA7A 2E2JK 3HKZD 1XZQA 3TFIA 4M1XA 1I3QC 5EGEA 4Y52C 3S1NC 2PA8L 3S2DC 4KATA 4KB4A 4BLAA 4A3MK 5IYCC 4GTDA 4A3LC 5IYBC 3GTLK 1TWFA 2NVYA 2RGRA 4Q5SA 2JA8K 4G0UA 3N0BA 2VUMC 1BGWA 2GSUA 1O28A 4A3FK 4AYBL 2D6FC 1IL2A 1I6HC 4A3DC 2A69A 1XXAA 4GFQA 3TTGA 4BLBA 3GTQA 2JA6A 1K83K 3HOUK 3FKIK 1Y1WK 3GTKC 1R9TA 1K83A 1O2BA 4BBSK 1F93A 1TWGC 1O27A 3AD8C 2R7ZC 3HXAA 2P5MA 1SFOC 2NVQK 1F9NA 3I4MK 1O2AA 2JA5A 4C2MK 1YNNA 4OIPA 2E2JC 1EI6A 3ADAC 4BKWA 5IOQA 4KM8A 1BS2A 3G4AA 4A93K 4A3MC 3WODA 3JSTA 3RZDK 5E68A 1WOOA 3L4JA 3GTJA 4BBRK 1XZQB 2E2HC 3S14K 3TFJA 3GTLC 1Y1VK 4ZH4A 2ZUFA 2WB1L 2P8TA 4JK1A 2JA8C 4G7OA 1Y1VA 4LK1A 1J6XA 3HOZK 4A3FC 1F7VA 3GTPA 3S17K 1F7UA 1VGXA 2WB1D 2NVXK 3GEEA 5JVOA 2R92A 3K7AK 4X6AK 2XCRB 3H0GA 3GSIA 2NVTK 1PJ5A 1VRQC 3FKIC 4A3EK 4G7ZA 1Y1WC 4BBSC 1ISEA 3S2HK 4BY1K 1TWAK 2NVQC 4GTBA 3I4MC 4OIRA 4C2MC 1B4BA 2FQOA 3M3YK 2GAHC 1RU0A 4G0VA 1WCMA 4XSZA 1XZPB 2E2IA 2PHCB 3ERED 5D4DA 4A93C 3GEHA 1TWHA 1JQWA 4GTLA 3RZDC 1WOSA 4C3IK 2B63C 2JA7K 1IBAA 4BBRC 3GTOK 3S14C 4KC6A 1EFWA 3GTOA 3A8IA 3N0CA 5HL8A 1IQ0A 4LJZA 3HOZC 4DDQA 3FOEA 3S17C 4KAWX 3M4OC 1IW7A 2NVXC 4LQYA 1TWFK 2NVYK 3HOVK 3S15K 5TMFA 2A6HA 3K7AC 3FHZA 2XCOA 4X6AC 5IORA 4A3EC 3L4KA 3NUHA 3GTGC 3S2HC 1O29A 4BY1C 5TMCA 1TWCA 1TWAC 3GEIA 4Q4ZA 4WJ3M 3Q3QA 4Y7NK 3M3YC 5M3MK 4G0WA 3GTQK 1O2FB 4GTAA 1ZVUA 2JA6K 1IE0A 1WSRA 1J98A 4PABA 1R9TK 1WQHA 3S16K 4AH6A 3CQZC 3SZYA 1HQMA 4OIQA 2JH3A 1XZPA 4MEYA 2YU9C 2XCQA 1EH1A 2JA5K 1I50C 4YFNA 5L46A 1L0WA 1YX2A 1PJ6A 2O5JA 4BY7K 2A68A 2JA7C 1WQGA 3T02A 5TJ3A 3LAPA 2Y3PA 1DD5A 1HI9A 1KQ4A 1O25A 4A3CK 2RH6A 3T00A 2R93A 4BXXK 4WJ4A 5IP7K 3GTJK 4YFXA 1DCPA 1O24A 1TWFC 2NVYC 3S15C 2V6SA 5C4XK 1X31C 1XPPA 3BP8C 1PJ7A 5JFEA 4C3JK 4LLGA 1IS1A 3GTPK 4A3IK 4QJVB 4A3GK 3HOYK 4YFKA 1O26A 4A3KK 1J6WA 2R92K 4Y7NC 3GTQC 3H0GK 3GIRA 3QX3A 2JA6C 4WILA 3HOWK 1ZYRA 1R9TC 1K83C 4A3BK 3GTMA 4NOIA 1SMYA 3HOUC 3S16C 1BJTA 4KN4A 1I3QK 4LR2A 4A3JK 1YCLA 3AD9C 2CW0A 2JA5C 1I3QA 5C44K 4Y52K 4PAAA 3S2DK 4BY7C 1WOPA 5EGHA 4OINA 3PO2K 2GSOA 1WCMK 1DCHA 4ILDA 5FLMK 2E2IK 4GTFA 4A3CC 2O5IA 1JVIA 3T01A 1TWHK 4GT9A 4BXXC 3AQPA 1J6VA 4GTCA 3S1QK 1WIHA 5IP7C 3IPJA 3GTJC 4LK0A 2VUMA 1I6HK 1JOEA 1XXBA 1Y1VC 5FJ8K 5C3EK 2KWAA 2V6TA 3RZOK 3A8JA 3GTPC 4A3IC 4KMUA 4A3GC 3HOYC 3OPFA 3S0XA 4P5BA 3LAJA 4A3KC 4QJVA 3GTKA
chains in the Genus database with same CATH topology
1VJEA 1INNA 5E68A 2FQOA 1YCLA 1J6VA 1IE0A 1J6WA 1VH2A 1JOEA 4XCHA 1JQWA 1J98A 2FQTA 1JVIA 1VGXA 1J6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJE A;  1INN A;  5E68 A;  2FQO A;  1YCL A;  1J6V A;  1IE0 A;  1J6W A;  1VH2 A;  1JOE A;  4XCH A;  1JQW A;  1J98 A;  2FQT A;  1JVI A;  1VGX A;  1J6X A; 
#chains in the Genus database with same CATH topology
 4KAR A;  2R92 C;  5C4J K;  1ZXO A;  4KMD A;  3H0G C;  1TWG A;  3HOW C;  2R7Z A;  1SFO A;  1INN A;  4A3B C;  2NVT C;  3FOF A;  2GSN A;  4C3H K;  4A3J C;  1TWC K;  1UV7 A;  2WAQ D;  3CAG A;  2Y0S D;  5C44 C;  2GAG C;  4KDD A;  1G51 A;  3PO3 K;  3N3Y A;  4GTE A;  2CFA A;  3PO2 C;  1USM A;  1VH2 A;  1WCM C;  4KMA A;  3HOX K;  1GE9 A;  4XLP A;  5FLM C;  2E2I C;  2E2H K;  4J3N A;  2PMZ L;  2PA8 D;  4KN7 A;  2E2H A;  3I4N K;  3S1R K;  3GTL A;  1TWH C;  2FQT A;  3S1Q C;  1XXC A;  5M3F K;  4C3I C;  5M5W K;  2V6U A;  2PMZ D;  3GTO C;  5CHP A;  4XSX A;  3EQL A;  4KM9 A;  1WSV A;  4RMF A;  2R93 K;  3A8K A;  4FM9 A;  5C3E C;  4AYB D;  3RZO C;  4FZB A;  1ZQ1 C;  1BDF A;  1VJE A;  1B4A A;  1USO A;  1AB4 A;  1VLO A;  2EBB A;  3TFH A;  3FKI A;  4XLN A;  1C0A A;  1Y1W A;  5IP9 K;  3HOV C;  3V4G A;  5C4J C;  1V5V A;  3S1M K;  5IOT A;  3DXJ A;  5IYD K;  3SZZ A;  1I6V A;  4C3H C;  4XCH A;  1TWC C;  4KMH A;  2PPB A;  5IOS A;  3PO3 C;  1WQF A;  2B63 K;  4KB2 A;  3HOX C;  4YG2 A;  3GTM K;  2B63 A;  2A6E A;  1EK8 A;  3I4N C;  5CJ9 A;  3S1R C;  2ZFZ A;  4KAS A;  4MQ9 A;  2BE5 A;  2CFA B;  3S1N K;  3M4O K;  3LPX A;  5IYC K;  4O2D A;  4C45 A;  2R93 C;  2NVX A;  4A3L K;  5IYB K;  3H3V L;  3BP3 A;  4MEX A;  2VUM K;  3MML B;  3GTG K;  1DCO A;  3H3V D;  3GTG A;  4P5A A;  5IP9 C;  3OEP A;  1TWA A;  4G7H A;  4A3D K;  3ORE A;  5M5X K;  3S1M C;  3BUE A;  5C4X C;  4GZY A;  3AH5 A;  4OIO A;  4LOW A;  5IYD C;  2ZUE A;  4C3J C;  3VA7 A;  4QIW L;  3CQZ K;  1YNJ A;  3GTK K;  3G4C A;  3HKZ L;  1ZBS A;  3CQZ A;  1EQR A;  2YU9 K;  4P9S A;  1I50 K;  1TWG K;  1WOR A;  2R7Z K;  2YU9 A;  2W7V A;  3AD7 C;  2WAQ L;  3AQO A;  3GDZ A;  1I50 A;  5M5Y K;  2Y0S L;  1SFO K;  3GTM C;  4QIW D;  2JA7 A;  2E2J K;  3HKZ D;  1XZQ A;  3TFI A;  4M1X A;  1I3Q C;  5EGE A;  4Y52 C;  3S1N C;  2PA8 L;  3S2D C;  4KAT A;  4KB4 A;  4BLA A;  4A3M K;  5IYC C;  4GTD A;  4A3L C;  5IYB C;  3GTL K;  1TWF A;  2NVY A;  2RGR A;  4Q5S A;  2JA8 K;  4G0U A;  3N0B A;  2VUM C;  1BGW A;  2GSU A;  1O28 A;  4A3F K;  4AYB L;  2D6F C;  1IL2 A;  1I6H C;  4A3D C;  2A69 A;  1XXA A;  4GFQ A;  3TTG A;  4BLB A;  3GTQ A;  2JA6 A;  1K83 K;  3HOU K;  3FKI K;  1Y1W K;  3GTK C;  1R9T A;  1K83 A;  1O2B A;  4BBS K;  1F93 A;  1TWG C;  1O27 A;  3AD8 C;  2R7Z C;  3HXA A;  2P5M A;  1SFO C;  2NVQ K;  1F9N A;  3I4M K;  1O2A A;  2JA5 A;  4C2M K;  1YNN A;  4OIP A;  2E2J C;  1EI6 A;  3ADA C;  4BKW A;  5IOQ A;  4KM8 A;  1BS2 A;  3G4A A;  4A93 K;  4A3M C;  3WOD A;  3JST A;  3RZD K;  5E68 A;  1WOO A;  3L4J A;  3GTJ A;  4BBR K;  1XZQ B;  2E2H C;  3S14 K;  3TFJ A;  3GTL C;  1Y1V K;  4ZH4 A;  2ZUF A;  2WB1 L;  2P8T A;  4JK1 A;  2JA8 C;  4G7O A;  1Y1V A;  4LK1 A;  1J6X A;  3HOZ K;  4A3F C;  1F7V A;  3GTP A;  3S17 K;  1F7U A;  1VGX A;  2WB1 D;  2NVX K;  3GEE A;  5JVO A;  2R92 A;  3K7A K;  4X6A K;  2XCR B;  3H0G A;  3GSI A;  2NVT K;  1PJ5 A;  1VRQ C;  3FKI C;  4A3E K;  4G7Z A;  1Y1W C;  4BBS C;  1ISE A;  3S2H K;  4BY1 K;  1TWA K;  2NVQ C;  4GTB A;  3I4M C;  4OIR A;  4C2M C;  1B4B A;  2FQO A;  3M3Y K;  2GAH C;  1RU0 A;  4G0V A;  1WCM A;  4XSZ A;  1XZP B;  2E2I A;  2PHC B;  3ERE D;  5D4D A;  4A93 C;  3GEH A;  1TWH A;  1JQW A;  4GTL A;  3RZD C;  1WOS A;  4C3I K;  2B63 C;  2JA7 K;  1IBA A;  4BBR C;  3GTO K;  3S14 C;  4KC6 A;  1EFW A;  3GTO A;  3A8I A;  3N0C A;  5HL8 A;  1IQ0 A;  4LJZ A;  3HOZ C;  4DDQ A;  3FOE A;  3S17 C;  4KAW X;  3M4O C;  1IW7 A;  2NVX C;  4LQY A;  1TWF K;  2NVY K;  3HOV K;  3S15 K;  5TMF A;  2A6H A;  3K7A C;  3FHZ A;  2XCO A;  4X6A C;  5IOR A;  4A3E C;  3L4K A;  3NUH A;  3GTG C;  3S2H C;  1O29 A;  4BY1 C;  5TMC A;  1TWC A;  1TWA C;  3GEI A;  4Q4Z A;  4WJ3 M;  3Q3Q A;  4Y7N K;  3M3Y C;  5M3M K;  4G0W A;  3GTQ K;  1O2F B;  4GTA A;  1ZVU A;  2JA6 K;  1IE0 A;  1WSR A;  1J98 A;  4PAB A;  1R9T K;  1WQH A;  3S16 K;  4AH6 A;  3CQZ C;  3SZY A;  1HQM A;  4OIQ A;  2JH3 A;  1XZP A;  4MEY A;  2YU9 C;  2XCQ A;  1EH1 A;  2JA5 K;  1I50 C;  4YFN A;  5L46 A;  1L0W A;  1YX2 A;  1PJ6 A;  2O5J A;  4BY7 K;  2A68 A;  2JA7 C;  1WQG A;  3T02 A;  5TJ3 A;  3LAP A;  2Y3P A;  1DD5 A;  1HI9 A;  1KQ4 A;  1O25 A;  4A3C K;  2RH6 A;  3T00 A;  2R93 A;  4BXX K;  4WJ4 A;  5IP7 K;  3GTJ K;  4YFX A;  1DCP A;  1O24 A;  1TWF C;  2NVY C;  3S15 C;  2V6S A;  5C4X K;  1X31 C;  1XPP A;  3BP8 C;  1PJ7 A;  5JFE A;  4C3J K;  4LLG A;  1IS1 A;  3GTP K;  4A3I K;  4QJV B;  4A3G K;  3HOY K;  4YFK A;  1O26 A;  4A3K K;  1J6W A;  2R92 K;  4Y7N C;  3GTQ C;  3H0G K;  3GIR A;  3QX3 A;  2JA6 C;  4WIL A;  3HOW K;  1ZYR A;  1R9T C;  1K83 C;  4A3B K;  3GTM A;  4NOI A;  1SMY A;  3HOU C;  3S16 C;  1BJT A;  4KN4 A;  1I3Q K;  4LR2 A;  4A3J K;  1YCL A;  3AD9 C;  2CW0 A;  2JA5 C;  1I3Q A;  5C44 K;  4Y52 K;  4PAA A;  3S2D K;  4BY7 C;  1WOP A;  5EGH A;  4OIN A;  3PO2 K;  2GSO A;  1WCM K;  1DCH A;  4ILD A;  5FLM K;  2E2I K;  4GTF A;  4A3C C;  2O5I A;  1JVI A;  3T01 A;  1TWH K;  4GT9 A;  4BXX C;  3AQP A;  1J6V A;  4GTC A;  3S1Q K;  1WIH A;  5IP7 C;  3IPJ A;  3GTJ C;  4LK0 A;  2VUM A;  1I6H K;  1JOE A;  1XXB A;  1Y1V C;  5FJ8 K;  5C3E K;  2KWA A;  2V6T A;  3RZO K;  3A8J A;  3GTP C;  4A3I C;  4KMU A;  4A3G C;  3HOY C;  3OPF A;  3S0X A;  4P5B A;  3LAJ A;  4A3K C;  4QJV A;  3GTK A; 
#chains in the Genus database with same CATH homology
 1VJE A;  1INN A;  5E68 A;  2FQO A;  1YCL A;  1J6V A;  1IE0 A;  1J6W A;  1VH2 A;  1JOE A;  4XCH A;  1JQW A;  1J98 A;  2FQT A;  1JVI A;  1VGX A;  1J6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...