1VH8A

Crystal structure of a 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vh8A00
3P0ZA 3B6NA 3MBMA 3IKFA 1KNJA 1GX1A 1U3LA 2GZLA 4C81A 3QHDA 1U43A 2PMPA 3JVHA 4C8EA 1H48A 5B8FA 1H47A 3F0EA 3ESJA 1KNKA 3P10A 3KE1A 3F0DA 1VHAA 3FBAA 3IEQA 3RE3A 4C82A 4C8IA 1JN1A 3GHZA 3F6MA 1JY8A 1IV1A 1IV3A 1T0AA 1W55A 3Q8HA 1U40A 1VH8A 1YQNA 1W57A 1U3PA 3IEWA 3K2XA 3F0FA 4C8GA 2AMTA 1IV4A 3FPIA 1IV2A 3T80A 3K14A 2UZHA 3IKEA 3ERNA 3EORA 3F0GA 3ELCA
chains in the Genus database with same CATH superfamily
3CC7F 4IIJA 2RHHA 3RYCB 2HRUA 2R6R1 5IJ9A 1Q8RA 4R40B 5LXTA 2UYNB 4ZI7B 1U43A 3IMPA 4HNAB 5J2UB 5HXZA 3G71F 4F6RA 3AGKA 3IEQA 4YJ3A 3M84A 3CCJF 1RLGA 3CD6F 3OW2F 1VH8A 5G4UC 2V9YA 4YJ2B 3S0HA 3WGKA 4NWOB 1RLUA 2LBXA 5C8YA 5MN6A 5JQGB 1OAPA 3DDNA 5HXUA 1K73H 3NVKE 4KWEA 3PAFA 1SA0B 5JCOA 3HKCB 5LA6A 1X52A 4FFBB 3ZO8A 1NJIH 1W5EA 4C82A 1TVKB 4IIJB 1RQ2A 1IV3A 3VIUA 3WXMB 5FJ4C 3WJRA 3VOAA 3RYHB 2H8EA 1ODEA 2UYJA 1QD9A 2WALA 3T80A 1QVGF 5EO3A 1VQPF 4ZHYB 5G4VC 4YJ3B 2LCAA 1QVFF 1E7KA 5IJ0A 2W8BC 2Q1YA 4EB6B 4LCKA 4XCQA 1VQLF 4I50A 4B62A 1W5BA 2JNBA 3RYFA 2B33A 2KTVA 4G4XA 1W55A 3HTNA 2OTLF 5FNVA 2HX0A 2H8CA 3SIUA 3JAKA 1JD1A 4RQOA 3GYQA 2P6YA 3CPWF 3CCSF 1YJWF 3V7QA 5LYJA 5KMGA 3B6NA 4U3JA 2OHWA 3ZP7A 2QTPA 5EAZA 1GO1A 3WJPA 2HP0A 3LWOC 3BYQA 4BT2A 5MN4A 3JAWA 1COMA 3LDTA 2VAWA 4EI8A 4BVRA 3CCQF 1Z5WA 2RHOA 1YJNF 4C8IA 3GHZA 5IJ0B 3KIZA 1YQNA 3IEWA 2ZVZA 3VO8A 5GANK 4I50B 2HVYD 2HP3A 2UYNA 3CCLF 4C4WC 2R751 4HNAA 1PXWA 3ZOPA 2HS0A 3E22B 2HQSC 4O2BA 3LWVC 1K9MH 2PMPA 5EB0A 3JAKB 1W41A 3LYBA 1Q86H 1VQ6F 2CZWA 3LFOA 4YJ2A 3JAMM 5J2TB 2Z1TA 1JFFB 3FBAA 5KMGB 3RE3A 3QUWA 1YHQF 2VAPA 1JN1A 3MCQA 1N8RH 5JQGA 3Q8HA 1U40A 3WGLA 2HP0B 1VQ5F 3JAWB 1W3EX 4I55A 1KC8H 4X1YA 3CCUF 3HKEA 4WBNA 3ERNA 2F9ZC 1VQOF 2I6RA 3N2GA 3P0ZA 3JCMM 4O4LA 1TVKA 1KNJA 1GX1A 2ZF8A 1RQ7A 4EI7A 3RYHA 4TZZA 2UYKA 3V3TA 1M1KH 1GZ0A 3C9RA 4NQ3A 2OTJF 5ITZA 5EZYA 4O2BB 1FSZA 3WPXA 3S0WA 1JY8A 4B5CA 4ZK7A 2QEXF 5KX5A 4TUYB 4O2AA 3SIVA 1IV4A 3FPIA 2NMUA 4EB6A 3C8LA 5GONB 2UZHA 3ZP4A 2DT4A 3K0TA 2MQEA 3K12A 1XRGA 2IAFA 2Z1UA 5LP6C 4I55B 3J7AR 1QAHA 3WGNA 1OFUA 5HY4A 4X1YB 3VCZA 3JARB 3HKEB 5JVDB 4WBNB 2YXZA 3VOBA 3CYPB 3N2GB 3RA6A 4O4IB 3JASA 2ZVYA 4O4LB 3CPQA 1VQNF 3E1YA 2CW4A 3KJJA 3WGJA 1W581 1W2BF 4PWTA 3I7TA 3ELCA 3VYSC 5EZYB 5ITZB 3CC2F 3HAXD 2Z1FA 1IPAA 4DRXA 3CMAF 3MBMA 5KX5B 1Q82H 1Z5VA 2IG8A 3MQWA 2L26A 4O2AB 3QHDA 2OTMA 4BVQA 1X7PA 3O85A 1YITF 5HP8A 2KGWA 2I6DA 5EYPB 1W42A 4X3MA 5MN5A 3VMFB 3E22A 3NK7A 3KJKA 2BTQB 1XHOA 2GLZA 5CB4A 1H7MA 5IT9M 2HRYA 3K14A 3N2KA 3ON1A 3G4SF 1KQSF 2Q1XA 5J2TA 3JASB 1JFFA 5JH7B 2AIFA 1W40A 4ZHQB 1KD1H 2ZOVA 4O4HB 4DXDA 3OONA 3CCMF 2LBWA 2ZODA 3IR9A 1H47A 1R1MA 4ZHWA 1RA4A 3KE1A 3F0DA 4E6EA 2QA4F 4BT5A 4ZOLB 4IHJB 4DRXB 1T0AA 1Q7YH 3KHNA 5HY1A 1VQVA 1YJ9F 2AMTA 1T0KB 5GAPK 1W59A 3NMUC 1FFXB 2GVIA 4G4YA 1M90H 4X1KA 3FD5A 1VQMF 3OBYA 1CK2A 3JALB 3JATA 5CB4B 1YGYA 4TUYA 3PLAC 3ESJA 4BW0B 3N2KB 3S03A 1ONIA 5GONA 1NQ3A 1QU9A 5BMVA 3DC2A 3J81M 4BT3A 4G4WA 1IV1A 4X3LA 1SZQA 5LOVA 5GINC 3F0FA 3S0YA 2EWCA 1VQ7F 3N4YA 3I55F 3JARA 2VAMA 5JVDA 4X1IB 4G4VA 3S06A 3VYUC 3C9UA 4O4IA 5EIBC 3LWQC 2GZLA 3HKBA 3HJWC 1W5AA 3JVHA 2VGMA 5B8FA 2LBTA 1ZWZA 3P10A 4RHAA 5EB1B 4X1KB 1XBIA 2N48A 1VHAA 3MDOA 4M8IA 4O4JA 3S02A 4G4ZA 3RA5A 1VK3A 2CWJA 3OBWA 5FLXM 5IYZB 3K2XA 3JATB 4EI9A 1IV2A 1VQKF 1S72F 2K1SA 1X25A 3CG6A 5BMVB 3WPWA 3N4ZA 5EYPA 2HS4A 1CLIA 3TD5A 5LOVB 1U3LA 2UYPA 3F0EA 5CA1B 5LP6A 1TUBA 3RYIA 5HP7A 3CMEF 2VXYA 5JH7A 3HKBB 4ZHQA 2OZBA 1DBFA 1K8AH 3E20B 4O4HA 4C8GA 1VQ9F 4U39A 3R0PA 2HS3A 2QI2A 3C9SA 2KG4A 5A2QM 5GIPC 3V7EA 4O4JB 3U0OA 3M1XA 5HY2A 1NMUB 3MCAB 4NUTA 5JCOC 2RHLA 4ZOLA 4TV8A 4IHJA 4ERHA 4BVTA 2BTOA 5HWEA 1Q81H 3LMEA 3V4DA 2FGYA 3WJQA 3HKDB 3UT5B 3QTYA 1FFXA 1X7OA 2AIZP 3CYQA 2BO1A 3P4EA 4LNUA 5IJ9B 4G88A 5LXTB 3CXCF 4BY9D 1W57A 3C9TA 2YYEA 3JALA 5LP6B 4F6RB 1TUBB 3RYIB 4ZHVA 3EORA 1DT9A 2Z01A 1VQ8F 3IKFA 4B46A 2PHNA 3M4SA 5EIBD 1H48A 5C8YB 4B45A 3NVIB 3L7QA 3HWUA 3VYTC 1YI2F 4X1IA 4TV8B 4BT7A 2Z1EA 1U3PA 5LA6B 2DYYA 2FC3A 2G9IA 3CB2A 3GTZA 3IKEA 4BT6A 3LWRC 5GIOC 4LNUB 2RB9A 4BT4A 5DCVA 1FNJA 5CA0A 4C81A 4C8EA 5HY0A 3FD6A 5IYZA 1UI9A 2RHJA 3FFMA 3NK6A 4I4TA 3CCVF 1YIJF 1KNKA 3CC4F 2BTUA 4TV9A 2CVLA 4X20A 1PF5A 3CCRF 2H6LA 3TD4A 4BVSA 3RYCA 1XV2A 3CCEF 4ZI7A 5J2UA 3I3FA 1JJ2F 1GO0A 1UFYA 5EWRA 3RYFB 3WGMA 3D00A 5CA1A 3I56F 1VQ4F 3TD3A 5FNVB 3D01A 2CSLA 2CHSA 2VGNA 1W5FA 3VTIC 2CHTA 1SDSA 2ALEA 5LYJB 1FNKA 1J7HA 2KTUA 4U3JB 1CN7A 3F6MA 2IQQA 3G6EF 3LWPC 5CA0B 1SA0A 3D54A 3VI6A 5AVMA 3HKCA 4I4TB 3HKDA 3UT5A 3J80M 4X20B 4FFBA 4TV9B 3F0GA 2ZAUA
chains in the Genus database with same CATH topology
3P0ZA 3B6NA 3MBMA 3IKFA 1KNJA 1GX1A 1U3LA 2GZLA 4C81A 3QHDA 1U43A 2PMPA 3JVHA 4C8EA 1H48A 5B8FA 1H47A 3F0EA 3ESJA 1KNKA 3P10A 3KE1A 3F0DA 1VHAA 3FBAA 3IEQA 3RE3A 4C82A 4C8IA 1JN1A 3GHZA 3F6MA 1JY8A 1IV1A 1IV3A 1T0AA 1W55A 3Q8HA 1U40A 1VH8A 1YQNA 1W57A 1U3PA 3IEWA 3K2XA 3F0FA 4C8GA 2AMTA 1IV4A 3FPIA 1IV2A 3T80A 3K14A 2UZHA 3IKEA 3ERNA 3EORA 3F0GA 3ELCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P0Z A;  3B6N A;  3MBM A;  3IKF A;  1KNJ A;  1GX1 A;  1U3L A;  2GZL A;  4C81 A;  3QHD A;  1U43 A;  2PMP A;  3JVH A;  4C8E A;  1H48 A;  5B8F A;  1H47 A;  3F0E A;  3ESJ A;  1KNK A;  3P10 A;  3KE1 A;  3F0D A;  1VHA A;  3FBA A;  3IEQ A;  3RE3 A;  4C82 A;  4C8I A;  1JN1 A;  3GHZ A;  3F6M A;  1JY8 A;  1IV1 A;  1IV3 A;  1T0A A;  1W55 A;  3Q8H A;  1U40 A;  1VH8 A;  1YQN A;  1W57 A;  1U3P A;  3IEW A;  3K2X A;  3F0F A;  4C8G A;  2AMT A;  1IV4 A;  3FPI A;  1IV2 A;  3T80 A;  3K14 A;  2UZH A;  3IKE A;  3ERN A;  3EOR A;  3F0G A;  3ELC A; 
#chains in the Genus database with same CATH topology
 3CC7 F;  4IIJ A;  2RHH A;  3RYC B;  2HRU A;  2R6R 1;  5IJ9 A;  1Q8R A;  4R40 B;  5LXT A;  2UYN B;  4ZI7 B;  1U43 A;  3IMP A;  4HNA B;  5J2U B;  5HXZ A;  3G71 F;  4F6R A;  3AGK A;  3IEQ A;  4YJ3 A;  3M84 A;  3CCJ F;  1RLG A;  3CD6 F;  3OW2 F;  1VH8 A;  5G4U C;  2V9Y A;  4YJ2 B;  3S0H A;  3WGK A;  4NWO B;  1RLU A;  2LBX A;  5C8Y A;  5MN6 A;  5JQG B;  1OAP A;  3DDN A;  5HXU A;  1K73 H;  3NVK E;  4KWE A;  3PAF A;  1SA0 B;  5JCO A;  3HKC B;  5LA6 A;  1X52 A;  4FFB B;  3ZO8 A;  1NJI H;  1W5E A;  4C82 A;  1TVK B;  4IIJ B;  1RQ2 A;  1IV3 A;  3VIU A;  3WXM B;  5FJ4 C;  3WJR A;  3VOA A;  3RYH B;  2H8E A;  1ODE A;  2UYJ A;  1QD9 A;  2WAL A;  3T80 A;  1QVG F;  5EO3 A;  1VQP F;  4ZHY B;  5G4V C;  4YJ3 B;  2LCA A;  1QVF F;  1E7K A;  5IJ0 A;  2W8B C;  2Q1Y A;  4EB6 B;  4LCK A;  4XCQ A;  1VQL F;  4I50 A;  4B62 A;  1W5B A;  2JNB A;  3RYF A;  2B33 A;  2KTV A;  4G4X A;  1W55 A;  3HTN A;  2OTL F;  5FNV A;  2HX0 A;  2H8C A;  3SIU A;  3JAK A;  1JD1 A;  4RQO A;  3GYQ A;  2P6Y A;  3CPW F;  3CCS F;  1YJW F;  3V7Q A;  5LYJ A;  5KMG A;  3B6N A;  4U3J A;  2OHW A;  3ZP7 A;  2QTP A;  5EAZ A;  1GO1 A;  3WJP A;  2HP0 A;  3LWO C;  3BYQ A;  4BT2 A;  5MN4 A;  3JAW A;  1COM A;  3LDT A;  2VAW A;  4EI8 A;  4BVR A;  3CCQ F;  1Z5W A;  2RHO A;  1YJN F;  4C8I A;  3GHZ A;  5IJ0 B;  3KIZ A;  1YQN A;  3IEW A;  2ZVZ A;  3VO8 A;  5GAN K;  4I50 B;  2HVY D;  2HP3 A;  2UYN A;  3CCL F;  4C4W C;  2R75 1;  4HNA A;  1PXW A;  3ZOP A;  2HS0 A;  3E22 B;  2HQS C;  4O2B A;  3LWV C;  1K9M H;  2PMP A;  5EB0 A;  3JAK B;  1W41 A;  3LYB A;  1Q86 H;  1VQ6 F;  2CZW A;  3LFO A;  4YJ2 A;  3JAM M;  5J2T B;  2Z1T A;  1JFF B;  3FBA A;  5KMG B;  3RE3 A;  3QUW A;  1YHQ F;  2VAP A;  1JN1 A;  3MCQ A;  1N8R H;  5JQG A;  3Q8H A;  1U40 A;  3WGL A;  2HP0 B;  1VQ5 F;  3JAW B;  1W3E X;  4I55 A;  1KC8 H;  4X1Y A;  3CCU F;  3HKE A;  4WBN A;  3ERN A;  2F9Z C;  1VQO F;  2I6R A;  3N2G A;  3P0Z A;  3JCM M;  4O4L A;  1TVK A;  1KNJ A;  1GX1 A;  2ZF8 A;  1RQ7 A;  4EI7 A;  3RYH A;  4TZZ A;  2UYK A;  3V3T A;  1M1K H;  1GZ0 A;  3C9R A;  4NQ3 A;  2OTJ F;  5ITZ A;  5EZY A;  4O2B B;  1FSZ A;  3WPX A;  3S0W A;  1JY8 A;  4B5C A;  4ZK7 A;  2QEX F;  5KX5 A;  4TUY B;  4O2A A;  3SIV A;  1IV4 A;  3FPI A;  2NMU A;  4EB6 A;  3C8L A;  5GON B;  2UZH A;  3ZP4 A;  2DT4 A;  3K0T A;  2MQE A;  3K12 A;  1XRG A;  2IAF A;  2Z1U A;  5LP6 C;  4I55 B;  3J7A R;  1QAH A;  3WGN A;  1OFU A;  5HY4 A;  4X1Y B;  3VCZ A;  3JAR B;  3HKE B;  5JVD B;  4WBN B;  2YXZ A;  3VOB A;  3CYP B;  3N2G B;  3RA6 A;  4O4I B;  3JAS A;  2ZVY A;  4O4L B;  3CPQ A;  1VQN F;  3E1Y A;  2CW4 A;  3KJJ A;  3WGJ A;  1W58 1;  1W2B F;  4PWT A;  3I7T A;  3ELC A;  3VYS C;  5EZY B;  5ITZ B;  3CC2 F;  3HAX D;  2Z1F A;  1IPA A;  4DRX A;  3CMA F;  3MBM A;  5KX5 B;  1Q82 H;  1Z5V A;  2IG8 A;  3MQW A;  2L26 A;  4O2A B;  3QHD A;  2OTM A;  4BVQ A;  1X7P A;  3O85 A;  1YIT F;  5HP8 A;  2KGW A;  2I6D A;  5EYP B;  1W42 A;  4X3M A;  5MN5 A;  3VMF B;  3E22 A;  3NK7 A;  3KJK A;  2BTQ B;  1XHO A;  2GLZ A;  5CB4 A;  1H7M A;  5IT9 M;  2HRY A;  3K14 A;  3N2K A;  3ON1 A;  3G4S F;  1KQS F;  2Q1X A;  5J2T A;  3JAS B;  1JFF A;  5JH7 B;  2AIF A;  1W40 A;  4ZHQ B;  1KD1 H;  2ZOV A;  4O4H B;  4DXD A;  3OON A;  3CCM F;  2LBW A;  2ZOD A;  3IR9 A;  1H47 A;  1R1M A;  4ZHW A;  1RA4 A;  3KE1 A;  3F0D A;  4E6E A;  2QA4 F;  4BT5 A;  4ZOL B;  4IHJ B;  4DRX B;  1T0A A;  1Q7Y H;  3KHN A;  5HY1 A;  1VQV A;  1YJ9 F;  2AMT A;  1T0K B;  5GAP K;  1W59 A;  3NMU C;  1FFX B;  2GVI A;  4G4Y A;  1M90 H;  4X1K A;  3FD5 A;  1VQM F;  3OBY A;  1CK2 A;  3JAL B;  3JAT A;  5CB4 B;  1YGY A;  4TUY A;  3PLA C;  3ESJ A;  4BW0 B;  3N2K B;  3S03 A;  1ONI A;  5GON A;  1NQ3 A;  1QU9 A;  5BMV A;  3DC2 A;  3J81 M;  4BT3 A;  4G4W A;  1IV1 A;  4X3L A;  1SZQ A;  5LOV A;  5GIN C;  3F0F A;  3S0Y A;  2EWC A;  1VQ7 F;  3N4Y A;  3I55 F;  3JAR A;  2VAM A;  5JVD A;  4X1I B;  4G4V A;  3S06 A;  3VYU C;  3C9U A;  4O4I A;  5EIB C;  3LWQ C;  2GZL A;  3HKB A;  3HJW C;  1W5A A;  3JVH A;  2VGM A;  5B8F A;  2LBT A;  1ZWZ A;  3P10 A;  4RHA A;  5EB1 B;  4X1K B;  1XBI A;  2N48 A;  1VHA A;  3MDO A;  4M8I A;  4O4J A;  3S02 A;  4G4Z A;  3RA5 A;  1VK3 A;  2CWJ A;  3OBW A;  5FLX M;  5IYZ B;  3K2X A;  3JAT B;  4EI9 A;  1IV2 A;  1VQK F;  1S72 F;  2K1S A;  1X25 A;  3CG6 A;  5BMV B;  3WPW A;  3N4Z A;  5EYP A;  2HS4 A;  1CLI A;  3TD5 A;  5LOV B;  1U3L A;  2UYP A;  3F0E A;  5CA1 B;  5LP6 A;  1TUB A;  3RYI A;  5HP7 A;  3CME F;  2VXY A;  5JH7 A;  3HKB B;  4ZHQ A;  2OZB A;  1DBF A;  1K8A H;  3E20 B;  4O4H A;  4C8G A;  1VQ9 F;  4U39 A;  3R0P A;  2HS3 A;  2QI2 A;  3C9S A;  2KG4 A;  5A2Q M;  5GIP C;  3V7E A;  4O4J B;  3U0O A;  3M1X A;  5HY2 A;  1NMU B;  3MCA B;  4NUT A;  5JCO C;  2RHL A;  4ZOL A;  4TV8 A;  4IHJ A;  4ERH A;  4BVT A;  2BTO A;  5HWE A;  1Q81 H;  3LME A;  3V4D A;  2FGY A;  3WJQ A;  3HKD B;  3UT5 B;  3QTY A;  1FFX A;  1X7O A;  2AIZ P;  3CYQ A;  2BO1 A;  3P4E A;  4LNU A;  5IJ9 B;  4G88 A;  5LXT B;  3CXC F;  4BY9 D;  1W57 A;  3C9T A;  2YYE A;  3JAL A;  5LP6 B;  4F6R B;  1TUB B;  3RYI B;  4ZHV A;  3EOR A;  1DT9 A;  2Z01 A;  1VQ8 F;  3IKF A;  4B46 A;  2PHN A;  3M4S A;  5EIB D;  1H48 A;  5C8Y B;  4B45 A;  3NVI B;  3L7Q A;  3HWU A;  3VYT C;  1YI2 F;  4X1I A;  4TV8 B;  4BT7 A;  2Z1E A;  1U3P A;  5LA6 B;  2DYY A;  2FC3 A;  2G9I A;  3CB2 A;  3GTZ A;  3IKE A;  4BT6 A;  3LWR C;  5GIO C;  4LNU B;  2RB9 A;  4BT4 A;  5DCV A;  1FNJ A;  5CA0 A;  4C81 A;  4C8E A;  5HY0 A;  3FD6 A;  5IYZ A;  1UI9 A;  2RHJ A;  3FFM A;  3NK6 A;  4I4T A;  3CCV F;  1YIJ F;  1KNK A;  3CC4 F;  2BTU A;  4TV9 A;  2CVL A;  4X20 A;  1PF5 A;  3CCR F;  2H6L A;  3TD4 A;  4BVS A;  3RYC A;  1XV2 A;  3CCE F;  4ZI7 A;  5J2U A;  3I3F A;  1JJ2 F;  1GO0 A;  1UFY A;  5EWR A;  3RYF B;  3WGM A;  3D00 A;  5CA1 A;  3I56 F;  1VQ4 F;  3TD3 A;  5FNV B;  3D01 A;  2CSL A;  2CHS A;  2VGN A;  1W5F A;  3VTI C;  2CHT A;  1SDS A;  2ALE A;  5LYJ B;  1FNK A;  1J7H A;  2KTU A;  4U3J B;  1CN7 A;  3F6M A;  2IQQ A;  3G6E F;  3LWP C;  5CA0 B;  1SA0 A;  3D54 A;  3VI6 A;  5AVM A;  3HKC A;  4I4T B;  3HKD A;  3UT5 A;  3J80 M;  4X20 B;  4FFB A;  4TV9 B;  3F0G A;  2ZAU A; 
#chains in the Genus database with same CATH homology
 3P0Z A;  3B6N A;  3MBM A;  3IKF A;  1KNJ A;  1GX1 A;  1U3L A;  2GZL A;  4C81 A;  3QHD A;  1U43 A;  2PMP A;  3JVH A;  4C8E A;  1H48 A;  5B8F A;  1H47 A;  3F0E A;  3ESJ A;  1KNK A;  3P10 A;  3KE1 A;  3F0D A;  1VHA A;  3FBA A;  3IEQ A;  3RE3 A;  4C82 A;  4C8I A;  1JN1 A;  3GHZ A;  3F6M A;  1JY8 A;  1IV1 A;  1IV3 A;  1T0A A;  1W55 A;  3Q8H A;  1U40 A;  1VH8 A;  1YQN A;  1W57 A;  1U3P A;  3IEW A;  3K2X A;  3F0F A;  4C8G A;  2AMT A;  1IV4 A;  3FPI A;  1IV2 A;  3T80 A;  3K14 A;  2UZH A;  3IKE A;  3ERN A;  3EOR A;  3F0G A;  3ELC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...