1VH8A

Crystal structure of a 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
b'SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vh8A00
1H47A 3JVHA 1JY8A 4C8GA 3ERNA 3IKFA 3QHDA 1IV2A 4C82A 2AMTA 3ESJA 3F0GA 4C81A 3MBMA 3RE3A 3FPIA 1U43A 1VH8A 3P10A 2UZHA 3GHZA 3F0FA 3K2XA 1W55A 3P0ZA 1U40A 3B6NA 1KNKA 1VHAA 1IV1A 3ELCA 3IKEA 3FBAA 1T0AA 1KNJA 4C8IA 3F6MA 1IV3A 5B8FA 1U3LA 1IV4A 2GZLA 3KE1A 3T80A 1H48A 1GX1A 1YQNA 3F0EA 1JN1A 3K14A 3IEQA 3EORA 4C8EA 2PMPA 3Q8HA 3F0DA 1W57A 3IEWA 1U3PA
chains in the Genus database with same CATH superfamily
3KHNA 1E7KA 3K0TA 1NJIH 3HKBA 1XV2A 3NK6A 4EI7A 5FNVB 5CA0A 3ZP4A 2ZVYA 3CCEF 3LWQC 3V4DA 2V9YA 4O2BA 1KQSF 3WGNA 4F6RA 2VGNA 2BTUA 5CA1B 1QVFF 2FGYA 3DDNA 5EO3A 2GLZA 3QTYA 2N48A 3HKEA 1OAPA 2BTOA 4X1YB 3WPWA 4WBNA 3CG6A 2UYKA 5JCOA 3CMAF 1K8AH 1SA0A 5DCVA 3I55F 3VI6A 4X1KB 5EIBD 3N2KB 3S0WA 3CCVF 1M90H 4R40B 1W5FA 2I6DA 1VQ8F 5C8YB 2Z1FA 1TVKA 3JARB 5JQGB 1U40A 5JH7A 3QUWA 5G4UC 2QTPA 4G4XA 4I4TA 1K9MH 3F6MA 5KMGA 1NQ3A 2RB9A 2HS4A 3F0EA 5LOVB 5HY4A 3NMUC 4C8EA 3LWPC 2ALEA 2H8EA 3CCUF 3JATB 1X7OA 1KD1H 4IIJA 1H7MA 3V3TA 3ERNA 5EYPA 3S02A 3N4ZA 4X20A 1Q7YH 3PAFA 3VTIC 2CZWA 3VO8A 5HY0A 4HNAB 3MCQA 3RYHB 5IT9M 3B6NA 4TV9A 1QAHA 4O4JA 3TD5A 3RYCA 5FLXM 1ONIA 1KNJA 5IJ0A 2ZVZA 1IPAA 1T0KB 1VQKF 3AGKA 1JN1A 5KX5A 1JJ2F 1W581 1U3PA 3CCSF 4F6RB 3GTZA 2BTQB 3VIUA 3VYTC 1SDSA 1YJ9F 1JY8A 2LBTA 1W41A 3UT5A 2QI2A 4C81A 4DXDA 3NVKE 3HKEB 3JALA 5HWEA 3IR9A 3CYPB 3F0FA 4YJ2A 2Z1EA 4I50B 1RQ7A 1Q8RA 4WBNB 5ITZA 1ODEA 5IYZA 4TUYA 3C9UA 3CPQA 1YJNF 5EWRA 5LP6B 1CK2A 1ZWZA 2GZLA 1GO1A 3D54A 1YJWF 5GIOC 3KIZA 2HX0A 2LCAA 4ZI7A 1W3EX 3JVHA 3TD4A 5JH7B 3CYQA 4DRXA 3CCRF 4BVRA 4I4TB 3OBYA 1W42A 2UZHA 5HXZA 5GAPK 1JFFA 4BVTA 3GYQA 3VCZA 4B46A 4X3MA 1RA4A 3IEQA 3MQWA 4BVSA 3JAWA 2GVIA 5HP7A 3HKCA 4G4ZA 4TV9B 1VQPF 3D01A 4EI8A 5IJ0B 3RYFA 1XRGA 1W59A 3WGMA 4O4HA 3S0YA 3V7QA 3CCLF 4ERHA 5CB4B 4BW0B 2KTVA 3JASB 3M4SA 3P4EA 3KE1A 3T80A 5GIPC 1H48A 4X3LA 3NVIB 2HQSC 3HAXD 3OONA 3JAKA 3JALB 4TV8A 3F0DA 5EIBC 1Q81H 2R6R1 4YJ2B 5EB0A 1S72F 1FFXB 5ITZB 3QHDA 2UYPA 1IV2A 4C82A 4TUYB 4O4LA 4B45A 4ZHVA 5IYZB 2HP0B 3FD5A 3LDTA 3O85A 3VOBA 3J7AR 1XBIA 3FD6A 2UYNA 3SIUA 4RQOA 3FFMA 2CW4A 1GX1A 1R1MA 4M8IA 4DRXB 4EB6B 2R751 4LNUA 4IHJB 4RHAA 3J80M 1TUBB 4O2AA 3LWRC 3N2GB 1XHOA 2Z1UA 2PHNA 4G4VA 5A2QM 2ZAUA 5GINC 1VQ9F 4U3JB 2VXYA 2YYEA 3K2XA 4BT4A 4ZHQA 3IMPA 5BMVA 3LFOA 3M1XA 5EZYA 1W2BF 5B8FA 2Z01A 1U3LA 2RHJA 4BY9D 4G88A 2RHHA 3HKCB 3OW2F 3HKBB 2ZF8A 2P6YA 3CXCF 5LYJA 5CA0B 3RYFB 1N8RH 3IEWA 2HRUA 4O2BB 2QEXF 1FSZA 3DC2A 5JCOC 1JD1A 1Q86H 2EWCA 5LXTA 1M1KH 3E20B 2FC3A 2G9IA 5LP6C 3GHZA 3MDOA 1YGYA 3S0HA 3WPXA 2OTMA 4ZK7A 2Z1TA 5FNVA 2LBWA 1PF5A 5HY1A 3L7QA 1K73H 1SA0B 2DYYA 4LCKA 1W40A 3LMEA 1X25A 2JNBA 1CN7A 2CWJA 4O4IA 4BT7A 4O4LB 3JAMM 3EORA 3ZOPA 1VQOF 1W57A 4FFBA 3G4SF 4X1YA 3JCMM 3LWOC 1TVKB 1RQ2A 3C9SA 2VGMA 2ZODA 3ESJA 1VQMF 2UYNB 2QA4F 3FPIA 5HY2A 1VQ6F 4BT6A 5KMGB 1FNJA 3PLAC 2IAFA 5HP8A 3WJPA 3I7TA 3D00A 2RHOA 1IV1A 4C4WC 1QVGF 5LA6A 4LNUB 4YJ3A 4BVQA 3S06A 4C8IA 1Z5VA 4X1IA 5C8YA 1QU9A 4IIJB 2W8BC 3HKDA 3JARA 5JQGA 5EYPB 2HP3A 4X20B 2CHTA 5JVDA 5J2UA 3RYIA 1OFUA 3I3FA 3IKFA 5BMVB 3F0GA 4O4JB 3RYCB 1W5BA 5EZYB 3M84A 3U0OA 1U43A 3JATA 3E22A 4BT2A 1W55A 2HS0A 2VAWA 3N4YA 2VAMA 5KX5B 5IJ9A 4G4WA 4G4YA 4HNAA 3CB2A 3I56F 2F9ZC 3K14A 5FJ4C 1VQNF 3G71F 5LXTB 3NK7A 3UT5B 2UYJA 2OHWA 3P10A 3VOAA 4BT3A 5AVMA 3R0PA 4C8GA 2B33A 4U39A 2AIFA 1PXWA 4O4IB 3WXMB 3S03A 1KNKA 2ZOVA 2HVYD 1T0AA 2IG8A 1UI9A 2KTUA 4NUTA 4FFBB 3CCMF 1YITF 3VYUC 3VYSC 4I50A 4ZI7B 3SIVA 1Q82H 3CC7F 1YQNA 3RA6A 2KGWA 5MN4A 2I6RA 1SZQA 5LP6A 5MN5A 3CC2F 2AIZP 3CCQF 5J2TA 3K12A 5LA6B 5GONA 4YJ3B 3WGJA 4EI9A 1W5EA 3RE3A 1JFFB 3CPWF 3V7EA 1UFYA 4X1IB 4ZOLA 1VH8A 1YHQF 2OZBA 3J81M 2YXZA 3HKDB 1COMA 4I55A 3FBAA 2KG4A 2DT4A 5JVDB 4TZZA 1RLGA 1VQVA 3BYQA 5J2UB 1IV4A 5G4VC 3CD6F 3RYIB 3JAWB 3LYBA 1VQ5F 2H6LA 4BT5A 2NMUA 3WJRA 2CHSA 3E22B 1H47A 3KJKA 1W5AA 5EAZA 1KC8H 2RHLA 4O4HB 2Q1YA 4KWEA 4B62A 5IJ9B 3OBWA 2K1SA 1QD9A 3CCJF 1VHAA 3IKEA 1VK3A 2IQQA 3JAKB 4TV8B 5GANK 1FNKA 4B5CA 4ZHYB 5CA1A 3C9TA 2CVLA 3RA5A 5CB4A 3WJQA 2L26A 1NMUB 3MCAB 2MQEA 1CLIA 1RLUA 3ON1A 3JASA 2HRYA 3VMFB 3WGLA 3WGKA 4PWTA 3MBMA 2CSLA 1X52A 1FFXA 4X1KA 2OTJF 2OTLF 2WALA 2H8CA 1DBFA 5EB1B 1DT9A 3N2KA 3HTNA 3CMEF 2HP0A 3KJJA 1YI2F 1IV3A 3TD3A 2BO1A 4E6EA 3HWUA 5J2TB 4ZHWA 3CC4F 1GO0A 4O2AB 5GONB 3G6EF 2PMPA 3LWVC 3ZO8A 4ZOLB 5HXUA 1X7PA 3Q8HA 1Z5WA 1VQ4F 3C9RA 3HJWC 4I55B 4ZHQB 1YIJF 4EB6A 5LOVA 3E1YA 2AMTA 2Q1XA 2VAPA 4IHJA 4NQ3A 1TUBA 3ZP7A 1GZ0A 3C8LA 3N2GA 3ELCA 1J7HA 2HS3A 1VQLF 5MN6A 4U3JA 5LYJB 2LBXA 1VQ7F 4NWOB 3RYHA 4XCQA 3P0ZA
chains in the Genus database with same CATH topology
1H47A 3JVHA 1JY8A 4C8GA 3ERNA 3IKFA 3QHDA 1IV2A 4C82A 2AMTA 3ESJA 3F0GA 4C81A 3MBMA 3RE3A 3FPIA 1U43A 1VH8A 3P10A 2UZHA 3GHZA 3F0FA 3K2XA 1W55A 3P0ZA 1U40A 3B6NA 1KNKA 1VHAA 1IV1A 3ELCA 3IKEA 3FBAA 1T0AA 1KNJA 4C8IA 3F6MA 1IV3A 5B8FA 1U3LA 1IV4A 2GZLA 3KE1A 3T80A 1H48A 1GX1A 1YQNA 3F0EA 1JN1A 3K14A 3IEQA 3EORA 4C8EA 2PMPA 3Q8HA 3F0DA 1W57A 3IEWA 1U3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H47 A;  3JVH A;  1JY8 A;  4C8G A;  3ERN A;  3IKF A;  3QHD A;  1IV2 A;  4C82 A;  2AMT A;  3ESJ A;  3F0G A;  4C81 A;  3MBM A;  3RE3 A;  3FPI A;  1U43 A;  1VH8 A;  3P10 A;  2UZH A;  3GHZ A;  3F0F A;  3K2X A;  1W55 A;  3P0Z A;  1U40 A;  3B6N A;  1KNK A;  1VHA A;  1IV1 A;  3ELC A;  3IKE A;  3FBA A;  1T0A A;  1KNJ A;  4C8I A;  3F6M A;  1IV3 A;  5B8F A;  1U3L A;  1IV4 A;  2GZL A;  3KE1 A;  3T80 A;  1H48 A;  1GX1 A;  1YQN A;  3F0E A;  1JN1 A;  3K14 A;  3IEQ A;  3EOR A;  4C8E A;  2PMP A;  3Q8H A;  3F0D A;  1W57 A;  3IEW A;  1U3P A; 
#chains in the Genus database with same CATH topology
 3KHN A;  1E7K A;  3K0T A;  1NJI H;  3HKB A;  1XV2 A;  3NK6 A;  4EI7 A;  5FNV B;  5CA0 A;  3ZP4 A;  2ZVY A;  3CCE F;  3LWQ C;  3V4D A;  2V9Y A;  4O2B A;  1KQS F;  3WGN A;  4F6R A;  2VGN A;  2BTU A;  5CA1 B;  1QVF F;  2FGY A;  3DDN A;  5EO3 A;  2GLZ A;  3QTY A;  2N48 A;  3HKE A;  1OAP A;  2BTO A;  4X1Y B;  3WPW A;  4WBN A;  3CG6 A;  2UYK A;  5JCO A;  3CMA F;  1K8A H;  1SA0 A;  5DCV A;  3I55 F;  3VI6 A;  4X1K B;  5EIB D;  3N2K B;  3S0W A;  3CCV F;  1M90 H;  4R40 B;  1W5F A;  2I6D A;  1VQ8 F;  5C8Y B;  2Z1F A;  1TVK A;  3JAR B;  5JQG B;  1U40 A;  5JH7 A;  3QUW A;  5G4U C;  2QTP A;  4G4X A;  4I4T A;  1K9M H;  3F6M A;  5KMG A;  1NQ3 A;  2RB9 A;  2HS4 A;  3F0E A;  5LOV B;  5HY4 A;  3NMU C;  4C8E A;  3LWP C;  2ALE A;  2H8E A;  3CCU F;  3JAT B;  1X7O A;  1KD1 H;  4IIJ A;  1H7M A;  3V3T A;  3ERN A;  5EYP A;  3S02 A;  3N4Z A;  4X20 A;  1Q7Y H;  3PAF A;  3VTI C;  2CZW A;  3VO8 A;  5HY0 A;  4HNA B;  3MCQ A;  3RYH B;  5IT9 M;  3B6N A;  4TV9 A;  1QAH A;  4O4J A;  3TD5 A;  3RYC A;  5FLX M;  1ONI A;  1KNJ A;  5IJ0 A;  2ZVZ A;  1IPA A;  1T0K B;  1VQK F;  3AGK A;  1JN1 A;  5KX5 A;  1JJ2 F;  1W58 1;  1U3P A;  3CCS F;  4F6R B;  3GTZ A;  2BTQ B;  3VIU A;  3VYT C;  1SDS A;  1YJ9 F;  1JY8 A;  2LBT A;  1W41 A;  3UT5 A;  2QI2 A;  4C81 A;  4DXD A;  3NVK E;  3HKE B;  3JAL A;  5HWE A;  3IR9 A;  3CYP B;  3F0F A;  4YJ2 A;  2Z1E A;  4I50 B;  1RQ7 A;  1Q8R A;  4WBN B;  5ITZ A;  1ODE A;  5IYZ A;  4TUY A;  3C9U A;  3CPQ A;  1YJN F;  5EWR A;  5LP6 B;  1CK2 A;  1ZWZ A;  2GZL A;  1GO1 A;  3D54 A;  1YJW F;  5GIO C;  3KIZ A;  2HX0 A;  2LCA A;  4ZI7 A;  1W3E X;  3JVH A;  3TD4 A;  5JH7 B;  3CYQ A;  4DRX A;  3CCR F;  4BVR A;  4I4T B;  3OBY A;  1W42 A;  2UZH A;  5HXZ A;  5GAP K;  1JFF A;  4BVT A;  3GYQ A;  3VCZ A;  4B46 A;  4X3M A;  1RA4 A;  3IEQ A;  3MQW A;  4BVS A;  3JAW A;  2GVI A;  5HP7 A;  3HKC A;  4G4Z A;  4TV9 B;  1VQP F;  3D01 A;  4EI8 A;  5IJ0 B;  3RYF A;  1XRG A;  1W59 A;  3WGM A;  4O4H A;  3S0Y A;  3V7Q A;  3CCL F;  4ERH A;  5CB4 B;  4BW0 B;  2KTV A;  3JAS B;  3M4S A;  3P4E A;  3KE1 A;  3T80 A;  5GIP C;  1H48 A;  4X3L A;  3NVI B;  2HQS C;  3HAX D;  3OON A;  3JAK A;  3JAL B;  4TV8 A;  3F0D A;  5EIB C;  1Q81 H;  2R6R 1;  4YJ2 B;  5EB0 A;  1S72 F;  1FFX B;  5ITZ B;  3QHD A;  2UYP A;  1IV2 A;  4C82 A;  4TUY B;  4O4L A;  4B45 A;  4ZHV A;  5IYZ B;  2HP0 B;  3FD5 A;  3LDT A;  3O85 A;  3VOB A;  3J7A R;  1XBI A;  3FD6 A;  2UYN A;  3SIU A;  4RQO A;  3FFM A;  2CW4 A;  1GX1 A;  1R1M A;  4M8I A;  4DRX B;  4EB6 B;  2R75 1;  4LNU A;  4IHJ B;  4RHA A;  3J80 M;  1TUB B;  4O2A A;  3LWR C;  3N2G B;  1XHO A;  2Z1U A;  2PHN A;  4G4V A;  5A2Q M;  2ZAU A;  5GIN C;  1VQ9 F;  4U3J B;  2VXY A;  2YYE A;  3K2X A;  4BT4 A;  4ZHQ A;  3IMP A;  5BMV A;  3LFO A;  3M1X A;  5EZY A;  1W2B F;  5B8F A;  2Z01 A;  1U3L A;  2RHJ A;  4BY9 D;  4G88 A;  2RHH A;  3HKC B;  3OW2 F;  3HKB B;  2ZF8 A;  2P6Y A;  3CXC F;  5LYJ A;  5CA0 B;  3RYF B;  1N8R H;  3IEW A;  2HRU A;  4O2B B;  2QEX F;  1FSZ A;  3DC2 A;  5JCO C;  1JD1 A;  1Q86 H;  2EWC A;  5LXT A;  1M1K H;  3E20 B;  2FC3 A;  2G9I A;  5LP6 C;  3GHZ A;  3MDO A;  1YGY A;  3S0H A;  3WPX A;  2OTM A;  4ZK7 A;  2Z1T A;  5FNV A;  2LBW A;  1PF5 A;  5HY1 A;  3L7Q A;  1K73 H;  1SA0 B;  2DYY A;  4LCK A;  1W40 A;  3LME A;  1X25 A;  2JNB A;  1CN7 A;  2CWJ A;  4O4I A;  4BT7 A;  4O4L B;  3JAM M;  3EOR A;  3ZOP A;  1VQO F;  1W57 A;  4FFB A;  3G4S F;  4X1Y A;  3JCM M;  3LWO C;  1TVK B;  1RQ2 A;  3C9S A;  2VGM A;  2ZOD A;  3ESJ A;  1VQM F;  2UYN B;  2QA4 F;  3FPI A;  5HY2 A;  1VQ6 F;  4BT6 A;  5KMG B;  1FNJ A;  3PLA C;  2IAF A;  5HP8 A;  3WJP A;  3I7T A;  3D00 A;  2RHO A;  1IV1 A;  4C4W C;  1QVG F;  5LA6 A;  4LNU B;  4YJ3 A;  4BVQ A;  3S06 A;  4C8I A;  1Z5V A;  4X1I A;  5C8Y A;  1QU9 A;  4IIJ B;  2W8B C;  3HKD A;  3JAR A;  5JQG A;  5EYP B;  2HP3 A;  4X20 B;  2CHT A;  5JVD A;  5J2U A;  3RYI A;  1OFU A;  3I3F A;  3IKF A;  5BMV B;  3F0G A;  4O4J B;  3RYC B;  1W5B A;  5EZY B;  3M84 A;  3U0O A;  1U43 A;  3JAT A;  3E22 A;  4BT2 A;  1W55 A;  2HS0 A;  2VAW A;  3N4Y A;  2VAM A;  5KX5 B;  5IJ9 A;  4G4W A;  4G4Y A;  4HNA A;  3CB2 A;  3I56 F;  2F9Z C;  3K14 A;  5FJ4 C;  1VQN F;  3G71 F;  5LXT B;  3NK7 A;  3UT5 B;  2UYJ A;  2OHW A;  3P10 A;  3VOA A;  4BT3 A;  5AVM A;  3R0P A;  4C8G A;  2B33 A;  4U39 A;  2AIF A;  1PXW A;  4O4I B;  3WXM B;  3S03 A;  1KNK A;  2ZOV A;  2HVY D;  1T0A A;  2IG8 A;  1UI9 A;  2KTU A;  4NUT A;  4FFB B;  3CCM F;  1YIT F;  3VYU C;  3VYS C;  4I50 A;  4ZI7 B;  3SIV A;  1Q82 H;  3CC7 F;  1YQN A;  3RA6 A;  2KGW A;  5MN4 A;  2I6R A;  1SZQ A;  5LP6 A;  5MN5 A;  3CC2 F;  2AIZ P;  3CCQ F;  5J2T A;  3K12 A;  5LA6 B;  5GON A;  4YJ3 B;  3WGJ A;  4EI9 A;  1W5E A;  3RE3 A;  1JFF B;  3CPW F;  3V7E A;  1UFY A;  4X1I B;  4ZOL A;  1VH8 A;  1YHQ F;  2OZB A;  3J81 M;  2YXZ A;  3HKD B;  1COM A;  4I55 A;  3FBA A;  2KG4 A;  2DT4 A;  5JVD B;  4TZZ A;  1RLG A;  1VQV A;  3BYQ A;  5J2U B;  1IV4 A;  5G4V C;  3CD6 F;  3RYI B;  3JAW B;  3LYB A;  1VQ5 F;  2H6L A;  4BT5 A;  2NMU A;  3WJR A;  2CHS A;  3E22 B;  1H47 A;  3KJK A;  1W5A A;  5EAZ A;  1KC8 H;  2RHL A;  4O4H B;  2Q1Y A;  4KWE A;  4B62 A;  5IJ9 B;  3OBW A;  2K1S A;  1QD9 A;  3CCJ F;  1VHA A;  3IKE A;  1VK3 A;  2IQQ A;  3JAK B;  4TV8 B;  5GAN K;  1FNK A;  4B5C A;  4ZHY B;  5CA1 A;  3C9T A;  2CVL A;  3RA5 A;  5CB4 A;  3WJQ A;  2L26 A;  1NMU B;  3MCA B;  2MQE A;  1CLI A;  1RLU A;  3ON1 A;  3JAS A;  2HRY A;  3VMF B;  3WGL A;  3WGK A;  4PWT A;  3MBM A;  2CSL A;  1X52 A;  1FFX A;  4X1K A;  2OTJ F;  2OTL F;  2WAL A;  2H8C A;  1DBF A;  5EB1 B;  1DT9 A;  3N2K A;  3HTN A;  3CME F;  2HP0 A;  3KJJ A;  1YI2 F;  1IV3 A;  3TD3 A;  2BO1 A;  4E6E A;  3HWU A;  5J2T B;  4ZHW A;  3CC4 F;  1GO0 A;  4O2A B;  5GON B;  3G6E F;  2PMP A;  3LWV C;  3ZO8 A;  4ZOL B;  5HXU A;  1X7P A;  3Q8H A;  1Z5W A;  1VQ4 F;  3C9R A;  3HJW C;  4I55 B;  4ZHQ B;  1YIJ F;  4EB6 A;  5LOV A;  3E1Y A;  2AMT A;  2Q1X A;  2VAP A;  4IHJ A;  4NQ3 A;  1TUB A;  3ZP7 A;  1GZ0 A;  3C8L A;  3N2G A;  3ELC A;  1J7H A;  2HS3 A;  1VQL F;  5MN6 A;  4U3J A;  5LYJ B;  2LBX A;  1VQ7 F;  4NWO B;  3RYH A;  4XCQ A;  3P0Z A; 
#chains in the Genus database with same CATH homology
 1H47 A;  3JVH A;  1JY8 A;  4C8G A;  3ERN A;  3IKF A;  3QHD A;  1IV2 A;  4C82 A;  2AMT A;  3ESJ A;  3F0G A;  4C81 A;  3MBM A;  3RE3 A;  3FPI A;  1U43 A;  1VH8 A;  3P10 A;  2UZH A;  3GHZ A;  3F0F A;  3K2X A;  1W55 A;  3P0Z A;  1U40 A;  3B6N A;  1KNK A;  1VHA A;  1IV1 A;  3ELC A;  3IKE A;  3FBA A;  1T0A A;  1KNJ A;  4C8I A;  3F6M A;  1IV3 A;  5B8F A;  1U3L A;  1IV4 A;  2GZL A;  3KE1 A;  3T80 A;  1H48 A;  1GX1 A;  1YQN A;  3F0E A;  1JN1 A;  3K14 A;  3IEQ A;  3EOR A;  4C8E A;  2PMP A;  3Q8H A;  3F0D A;  1W57 A;  3IEW A;  1U3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...