1VH8A

Crystal structure of a 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vh8A00
1U43A 2UZHA 3RE3A 1KNKA 3Q8HA 3IEQA 4C82A 3ERNA 1IV4A 2GZLA 3P0ZA 3ESJA 4C8IA 1VHAA 3JVHA 3IKEA 1IV3A 3F0FA 3ELCA 3T80A 1GX1A 3F0DA 1IV2A 1U3PA 3QHDA 3K2XA 3P10A 3GHZA 1JN1A 1VH8A 3F0GA 1H47A 1YQNA 3FBAA 3FPIA 3K14A 1U3LA 1T0AA 3F6MA 4C8EA 2PMPA 3F0EA 2AMTA 1H48A 1JY8A 1KNJA 1W57A 1W55A 3IKFA 3MBMA 1IV1A 3IEWA 4C81A 4C8GA 1U40A 5B8FA 3KE1A 3EORA 3B6NA
chains in the Genus database with same CATH superfamily
3V7EA 4C82A 2KG4A 1QVFF 4C8IA 2UYKA 2OZBA 2RB9A 5LA6A 3VO8A 3M4SA 3CCMF 3LWQC 1K9MH 4EI7A 5FNVB 1GO1A 3JATA 3GYQA 3VOAA 4I4TB 3S02A 3CMAF 5FJ4C 2F9ZC 5EO3A 1W5BA 3JAWB 4ZHQA 3CCJF 5JCOC 3UT5A 5HP7A 1W41A 3JAMM 3WJPA 4NUTA 4BVQA 3LYBA 4X1IB 1U43A 1VQ7F 1KNKA 3IEQA 3ZO8A 3L7QA 2OTLF 3VYTC 3ESJA 3JVHA 1OAPA 5GIOC 1UFYA 2HS4A 4G4YA 3CYQA 1RQ7A 1QAHA 2V9YA 3NVKE 2DT4A 3JALB 2I6DA 4O2AB 4HNAB 3K14A 3TD3A 2EWCA 5KX5B 5GIPC 4IHJB 5EZYA 3HKDB 2CVLA 4R40B 5CA1B 1VQOF 4O4IA 3VYSC 4U3JA 2AIZP 2QI2A 1Q86H 2RHLA 3HTNA 3QUWA 5GAPK 5IYZA 1JFFA 1X7PA 2W8BC 1R1MA 2N48A 3T80A 1M1KH 3NK6A 5JVDB 1FNJA 3VTIC 3N4ZA 4ERHA 1NQ3A 5LYJA 1CN7A 4O2BA 1X52A 4F6RA 1X7OA 1K8AH 3F0EA 5HY1A 3KHNA 2HS3A 1W55A 4FFBA 3C9TA 3SIVA 3J81M 1T0KB 1YHQF 1IV4A 4X20A 3CC7F 2UYJA 4TV9B 4I55A 4I4TA 5GONA 4HNAA 4BT3A 5JH7A 3F0FA 4BVTA 3SIUA 3JATB 4ZOLA 1YIJF 3PAFA 2VXYA 1W5AA 5HP8A 2QA4F 4TUYA 4NWOB 5LA6B 3RYCA 3FBAA 2HP3A 1W40A 5KMGA 5CA0B 4EI9A 2PMPA 1YI2F 2AMTA 4LCKA 3IKFA 2H8EA 2R751 1PXWA 3PLAC 2OTJF 5CA0A 4TV8A 5LXTB 1VHAA 3RYCB 3I7TA 5J2UB 3F0DA 3C9RA 3LWOC 1U3PA 1TUBB 2BO1A 4ZOLB 2IQQA 5J2TA 1TVKA 1NMUB 3ZP7A 5JH7B 5GONB 2PHNA 1QU9A 3E20B 3D00A 3WGKA 3TD5A 5MN5A 1VQ9F 4BT4A 2HP0A 3JARA 3O85A 1YJWF 3JCMM 4B62A 1ONIA 3G71F 3P0ZA 2HP0B 3P4EA 3KJKA 2P6YA 3RYIA 5IJ0A 1GO0A 3V7QA 3LMEA 4BVRA 4ZI7A 4ZK7A 3DC2A 5JQGB 4X1KB 4O4IB 3LWRC 1Q81H 3CG6A 1W2BF 2Z01A 3KIZA 3OONA 4LNUA 4YJ2B 2Q1YA 3HKDA 3K12A 5EZYB 3LWVC 5HY4A 3ON1A 4ZHYB 4G4WA 2H6LA 4TV8B 5LXTA 5HXUA 3M84A 4BT7A 3C9UA 4C8GA 3CPWF 1KC8H 3N2KA 1GZ0A 2UYPA 4DRXB 4O4LA 3Q8HA 2OHWA 4IHJA 3E22A 2Z1FA 2KTVA 3VCZA 3NMUC 4EB6B 3RYIB 1NJIH 1YITF 2BTOA 1W3EX 1W5FA 5JCOA 5GINC 4TUYB 3HAXD 1DBFA 2B33A 3MCQA 2HVYD 2Z1UA 2QTPA 3CPQA 3M1XA 1ODEA 1H47A 1YQNA 2I6RA 1RLUA 4ZHWA 1RQ2A 3HJWC 3JAWA 1KNJA 3HWUA 3RYHB 4C81A 3B6NA 5J2TB 4X3LA 3WGJA 2KGWA 5LP6C 2KTUA 3CB2A 3ERNA 2VAPA 1X25A 2VGNA 3HKEA 1PF5A 1SZQA 4FFBB 3ZOPA 5ITZB 3CCEF 3G6EF 5IJ9A 2YYEA 4C4WC 1FSZA 2CW4A 4EB6A 2LBXA 5DCVA 4WBNA 4B5CA 1JN1A 3CCUF 3CD6F 5G4VC 1H7MA 1Q82H 2HRYA 3FPIA 1QVGF 3J7AR 5KMGB 3HKCB 5IYZB 4X1YA 3IEWA 1CLIA 1QD9A 2HX0A 4DRXA 3JASA 4E6EA 3BYQA 4XCQA 3CC2F 3CC4F 2GLZA 3LFOA 5CA1A 3S0HA 1VQ5F 5HY2A 5BMVA 3ELCA 4O4JA 3WJQA 1XRGA 5IJ0B 3QTYA 4ZHVA 3F0GA 3LDTA 1ZWZA 2HRUA 5JQGA 1JJ2F 3N2GA 1E7KA 2YXZA 5LP6B 2Z1TA 3FFMA 3RYFB 1S72F 5LYJB 4BT5A 5EWRA 4BT2A 3CCSF 1VQVA 4B46A 1RLGA 3D54A 4O4HA 5CB4B 1TVKB 2CSLA 2IAFA 1TUBA 2RHOA 3OW2F 5J2UA 2L26A 1IV3A 4O4JB 1YJNF 4RHAA 3NVIB 2Q1XA 1RA4A 4ZHQB 5BMVB 5FLXM 1Z5WA 3JASB 3DDNA 2ZODA 3LWPC 1OFUA 5KX5A 1H48A 1W57A 4O2AA 5C8YA 3ZP4A 2LBWA 1U40A 5B8FA 1Q8RA 3EORA 3I3FA 3V4DA 5EAZA 4B45A 3J80M 2NMUA 3TD4A 4EI8A 2MQEA 2CWJA 2WALA 3V3TA 2R6R1 1KQSF 3K2XA 5EYPA 2HS0A 1VQ8F 5GANK 3CCLF 4X20B 1YGYA 1VK3A 1W59A 3MDOA 5EB1B 3FD5A 1VQNF 3JAKA 4I55B 3MBMA 5MN4A 4I50B 4F6RB 3MQWA 1XV2A 3CCQF 4RQOA 3U0OA 3VIUA 5LOVA 4NQ3A 5FNVA 3VOBA 5LP6A 5JVDA 2CZWA 2OTMA 4BY9D 4O2BB 2ZAUA 2K1SA 3WGLA 1JFFB 3CMEF 2DYYA 3WGMA 3E22B 3I55F 1VH8A 3VYUC 4O4LB 4YJ3A 5MN6A 3I56F 1SDSA 3HKBA 2CHSA 4YJ3B 1VQ6F 4BW0B 3AGKA 2Z1EA 4X1YB 2VGMA 4U3JB 3RA5A 3CCVF 3HKCA 1K73H 1VQLF 4X1KA 1J7HA 5G4UC 1VQMF 3MCAB 1COMA 1IPAA 5IT9M 4WBNB 3CCRF 5LOVB 3JALA 5HY0A 1SA0A 4I50A 5IJ9B 5ITZA 4X1IA 3JAKB 3HKEB 2ZVYA 1W5EA 2VAWA 3E1YA 3F6MA 3JARB 4C8EA 1JY8A 3CXCF 3FD6A 3G4SF 3C9SA 2GVIA 4TZZA 3RYHA 2UZHA 3WXMB 4M8IA 2G9IA 3UT5B 3R0PA 3S0YA 3IR9A 1CK2A 2BTQB 1VQ4F 4G4ZA 5A2QM 5EIBC 5HWEA 1W581 2IG8A 1Z5VA 2FGYA 3C8LA 1YJ9F 3K0TA 3N2KB 1IV1A 4G4XA 2LBTA 2AIFA 5C8YB 2HQSC 1VQPF 2VAMA 5AVMA 5EB0A 3N4YA 3WPXA 2GZLA 2UYNA 4DXDA 4LNUB 4YJ2A 2CHTA 1XBIA 2ZVZA 1KD1H 3HKBB 2RHJA 3GTZA 1GX1A 1W42A 1IV2A 4TV9A 3WGNA 5HXZA 1FFXB 3P10A 4ZI7B 3GHZA 4X3MA 4G4VA 3D01A 3RA6A 3S06A 4BT6A 3RYFA 3S0WA 3VMFB 4O4HB 2ALEA 5CB4A 1U3LA 1T0AA 2LCAA 1JD1A 3N2GB 4U39A 4IIJA 1SA0B 2ZOVA 1M90H 2H8CA 3KE1A 4G88A 3RE3A 2QEXF 3S03A 1VQKF 1FFXA 5EIBD 4IIJB 4KWEA 3IKEA 2RHHA 4PWTA 1FNKA 3WPWA 3KJJA 1UI9A 3QHDA 3OBWA 3VI6A 5EYPB 1XHOA 3WJRA 1DT9A 3CYPB 2ZF8A 4BVSA 3NK7A 2FC3A 2JNBA 2UYNB 3IMPA 1Q7YH 3OBYA 1N8RH 2BTUA
chains in the Genus database with same CATH topology
1U43A 2UZHA 3RE3A 1KNKA 3Q8HA 3IEQA 4C82A 3ERNA 1IV4A 2GZLA 3P0ZA 3ESJA 4C8IA 1VHAA 3JVHA 3IKEA 1IV3A 3F0FA 3ELCA 3T80A 1GX1A 3F0DA 1IV2A 1U3PA 3QHDA 3K2XA 3P10A 3GHZA 1JN1A 1VH8A 3F0GA 1H47A 1YQNA 3FBAA 3FPIA 3K14A 1U3LA 1T0AA 3F6MA 4C8EA 2PMPA 3F0EA 2AMTA 1H48A 1JY8A 1KNJA 1W57A 1W55A 3IKFA 3MBMA 1IV1A 3IEWA 4C81A 4C8GA 1U40A 5B8FA 3KE1A 3EORA 3B6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U43 A;  2UZH A;  3RE3 A;  1KNK A;  3Q8H A;  3IEQ A;  4C82 A;  3ERN A;  1IV4 A;  2GZL A;  3P0Z A;  3ESJ A;  4C8I A;  1VHA A;  3JVH A;  3IKE A;  1IV3 A;  3F0F A;  3ELC A;  3T80 A;  1GX1 A;  3F0D A;  1IV2 A;  1U3P A;  3QHD A;  3K2X A;  3P10 A;  3GHZ A;  1JN1 A;  1VH8 A;  3F0G A;  1H47 A;  1YQN A;  3FBA A;  3FPI A;  3K14 A;  1U3L A;  1T0A A;  3F6M A;  4C8E A;  2PMP A;  3F0E A;  2AMT A;  1H48 A;  1JY8 A;  1KNJ A;  1W57 A;  1W55 A;  3IKF A;  3MBM A;  1IV1 A;  3IEW A;  4C81 A;  4C8G A;  1U40 A;  5B8F A;  3KE1 A;  3EOR A;  3B6N A; 
#chains in the Genus database with same CATH topology
 3V7E A;  4C82 A;  2KG4 A;  1QVF F;  4C8I A;  2UYK A;  2OZB A;  2RB9 A;  5LA6 A;  3VO8 A;  3M4S A;  3CCM F;  3LWQ C;  1K9M H;  4EI7 A;  5FNV B;  1GO1 A;  3JAT A;  3GYQ A;  3VOA A;  4I4T B;  3S02 A;  3CMA F;  5FJ4 C;  2F9Z C;  5EO3 A;  1W5B A;  3JAW B;  4ZHQ A;  3CCJ F;  5JCO C;  3UT5 A;  5HP7 A;  1W41 A;  3JAM M;  3WJP A;  4NUT A;  4BVQ A;  3LYB A;  4X1I B;  1U43 A;  1VQ7 F;  1KNK A;  3IEQ A;  3ZO8 A;  3L7Q A;  2OTL F;  3VYT C;  3ESJ A;  3JVH A;  1OAP A;  5GIO C;  1UFY A;  2HS4 A;  4G4Y A;  3CYQ A;  1RQ7 A;  1QAH A;  2V9Y A;  3NVK E;  2DT4 A;  3JAL B;  2I6D A;  4O2A B;  4HNA B;  3K14 A;  3TD3 A;  2EWC A;  5KX5 B;  5GIP C;  4IHJ B;  5EZY A;  3HKD B;  2CVL A;  4R40 B;  5CA1 B;  1VQO F;  4O4I A;  3VYS C;  4U3J A;  2AIZ P;  2QI2 A;  1Q86 H;  2RHL A;  3HTN A;  3QUW A;  5GAP K;  5IYZ A;  1JFF A;  1X7P A;  2W8B C;  1R1M A;  2N48 A;  3T80 A;  1M1K H;  3NK6 A;  5JVD B;  1FNJ A;  3VTI C;  3N4Z A;  4ERH A;  1NQ3 A;  5LYJ A;  1CN7 A;  4O2B A;  1X52 A;  4F6R A;  1X7O A;  1K8A H;  3F0E A;  5HY1 A;  3KHN A;  2HS3 A;  1W55 A;  4FFB A;  3C9T A;  3SIV A;  3J81 M;  1T0K B;  1YHQ F;  1IV4 A;  4X20 A;  3CC7 F;  2UYJ A;  4TV9 B;  4I55 A;  4I4T A;  5GON A;  4HNA A;  4BT3 A;  5JH7 A;  3F0F A;  4BVT A;  3SIU A;  3JAT B;  4ZOL A;  1YIJ F;  3PAF A;  2VXY A;  1W5A A;  5HP8 A;  2QA4 F;  4TUY A;  4NWO B;  5LA6 B;  3RYC A;  3FBA A;  2HP3 A;  1W40 A;  5KMG A;  5CA0 B;  4EI9 A;  2PMP A;  1YI2 F;  2AMT A;  4LCK A;  3IKF A;  2H8E A;  2R75 1;  1PXW A;  3PLA C;  2OTJ F;  5CA0 A;  4TV8 A;  5LXT B;  1VHA A;  3RYC B;  3I7T A;  5J2U B;  3F0D A;  3C9R A;  3LWO C;  1U3P A;  1TUB B;  2BO1 A;  4ZOL B;  2IQQ A;  5J2T A;  1TVK A;  1NMU B;  3ZP7 A;  5JH7 B;  5GON B;  2PHN A;  1QU9 A;  3E20 B;  3D00 A;  3WGK A;  3TD5 A;  5MN5 A;  1VQ9 F;  4BT4 A;  2HP0 A;  3JAR A;  3O85 A;  1YJW F;  3JCM M;  4B62 A;  1ONI A;  3G71 F;  3P0Z A;  2HP0 B;  3P4E A;  3KJK A;  2P6Y A;  3RYI A;  5IJ0 A;  1GO0 A;  3V7Q A;  3LME A;  4BVR A;  4ZI7 A;  4ZK7 A;  3DC2 A;  5JQG B;  4X1K B;  4O4I B;  3LWR C;  1Q81 H;  3CG6 A;  1W2B F;  2Z01 A;  3KIZ A;  3OON A;  4LNU A;  4YJ2 B;  2Q1Y A;  3HKD A;  3K12 A;  5EZY B;  3LWV C;  5HY4 A;  3ON1 A;  4ZHY B;  4G4W A;  2H6L A;  4TV8 B;  5LXT A;  5HXU A;  3M84 A;  4BT7 A;  3C9U A;  4C8G A;  3CPW F;  1KC8 H;  3N2K A;  1GZ0 A;  2UYP A;  4DRX B;  4O4L A;  3Q8H A;  2OHW A;  4IHJ A;  3E22 A;  2Z1F A;  2KTV A;  3VCZ A;  3NMU C;  4EB6 B;  3RYI B;  1NJI H;  1YIT F;  2BTO A;  1W3E X;  1W5F A;  5JCO A;  5GIN C;  4TUY B;  3HAX D;  1DBF A;  2B33 A;  3MCQ A;  2HVY D;  2Z1U A;  2QTP A;  3CPQ A;  3M1X A;  1ODE A;  1H47 A;  1YQN A;  2I6R A;  1RLU A;  4ZHW A;  1RQ2 A;  3HJW C;  3JAW A;  1KNJ A;  3HWU A;  3RYH B;  4C81 A;  3B6N A;  5J2T B;  4X3L A;  3WGJ A;  2KGW A;  5LP6 C;  2KTU A;  3CB2 A;  3ERN A;  2VAP A;  1X25 A;  2VGN A;  3HKE A;  1PF5 A;  1SZQ A;  4FFB B;  3ZOP A;  5ITZ B;  3CCE F;  3G6E F;  5IJ9 A;  2YYE A;  4C4W C;  1FSZ A;  2CW4 A;  4EB6 A;  2LBX A;  5DCV A;  4WBN A;  4B5C A;  1JN1 A;  3CCU F;  3CD6 F;  5G4V C;  1H7M A;  1Q82 H;  2HRY A;  3FPI A;  1QVG F;  3J7A R;  5KMG B;  3HKC B;  5IYZ B;  4X1Y A;  3IEW A;  1CLI A;  1QD9 A;  2HX0 A;  4DRX A;  3JAS A;  4E6E A;  3BYQ A;  4XCQ A;  3CC2 F;  3CC4 F;  2GLZ A;  3LFO A;  5CA1 A;  3S0H A;  1VQ5 F;  5HY2 A;  5BMV A;  3ELC A;  4O4J A;  3WJQ A;  1XRG A;  5IJ0 B;  3QTY A;  4ZHV A;  3F0G A;  3LDT A;  1ZWZ A;  2HRU A;  5JQG A;  1JJ2 F;  3N2G A;  1E7K A;  2YXZ A;  5LP6 B;  2Z1T A;  3FFM A;  3RYF B;  1S72 F;  5LYJ B;  4BT5 A;  5EWR A;  4BT2 A;  3CCS F;  1VQV A;  4B46 A;  1RLG A;  3D54 A;  4O4H A;  5CB4 B;  1TVK B;  2CSL A;  2IAF A;  1TUB A;  2RHO A;  3OW2 F;  5J2U A;  2L26 A;  1IV3 A;  4O4J B;  1YJN F;  4RHA A;  3NVI B;  2Q1X A;  1RA4 A;  4ZHQ B;  5BMV B;  5FLX M;  1Z5W A;  3JAS B;  3DDN A;  2ZOD A;  3LWP C;  1OFU A;  5KX5 A;  1H48 A;  1W57 A;  4O2A A;  5C8Y A;  3ZP4 A;  2LBW A;  1U40 A;  5B8F A;  1Q8R A;  3EOR A;  3I3F A;  3V4D A;  5EAZ A;  4B45 A;  3J80 M;  2NMU A;  3TD4 A;  4EI8 A;  2MQE A;  2CWJ A;  2WAL A;  3V3T A;  2R6R 1;  1KQS F;  3K2X A;  5EYP A;  2HS0 A;  1VQ8 F;  5GAN K;  3CCL F;  4X20 B;  1YGY A;  1VK3 A;  1W59 A;  3MDO A;  5EB1 B;  3FD5 A;  1VQN F;  3JAK A;  4I55 B;  3MBM A;  5MN4 A;  4I50 B;  4F6R B;  3MQW A;  1XV2 A;  3CCQ F;  4RQO A;  3U0O A;  3VIU A;  5LOV A;  4NQ3 A;  5FNV A;  3VOB A;  5LP6 A;  5JVD A;  2CZW A;  2OTM A;  4BY9 D;  4O2B B;  2ZAU A;  2K1S A;  3WGL A;  1JFF B;  3CME F;  2DYY A;  3WGM A;  3E22 B;  3I55 F;  1VH8 A;  3VYU C;  4O4L B;  4YJ3 A;  5MN6 A;  3I56 F;  1SDS A;  3HKB A;  2CHS A;  4YJ3 B;  1VQ6 F;  4BW0 B;  3AGK A;  2Z1E A;  4X1Y B;  2VGM A;  4U3J B;  3RA5 A;  3CCV F;  3HKC A;  1K73 H;  1VQL F;  4X1K A;  1J7H A;  5G4U C;  1VQM F;  3MCA B;  1COM A;  1IPA A;  5IT9 M;  4WBN B;  3CCR F;  5LOV B;  3JAL A;  5HY0 A;  1SA0 A;  4I50 A;  5IJ9 B;  5ITZ A;  4X1I A;  3JAK B;  3HKE B;  2ZVY A;  1W5E A;  2VAW A;  3E1Y A;  3F6M A;  3JAR B;  4C8E A;  1JY8 A;  3CXC F;  3FD6 A;  3G4S F;  3C9S A;  2GVI A;  4TZZ A;  3RYH A;  2UZH A;  3WXM B;  4M8I A;  2G9I A;  3UT5 B;  3R0P A;  3S0Y A;  3IR9 A;  1CK2 A;  2BTQ B;  1VQ4 F;  4G4Z A;  5A2Q M;  5EIB C;  5HWE A;  1W58 1;  2IG8 A;  1Z5V A;  2FGY A;  3C8L A;  1YJ9 F;  3K0T A;  3N2K B;  1IV1 A;  4G4X A;  2LBT A;  2AIF A;  5C8Y B;  2HQS C;  1VQP F;  2VAM A;  5AVM A;  5EB0 A;  3N4Y A;  3WPX A;  2GZL A;  2UYN A;  4DXD A;  4LNU B;  4YJ2 A;  2CHT A;  1XBI A;  2ZVZ A;  1KD1 H;  3HKB B;  2RHJ A;  3GTZ A;  1GX1 A;  1W42 A;  1IV2 A;  4TV9 A;  3WGN A;  5HXZ A;  1FFX B;  3P10 A;  4ZI7 B;  3GHZ A;  4X3M A;  4G4V A;  3D01 A;  3RA6 A;  3S06 A;  4BT6 A;  3RYF A;  3S0W A;  3VMF B;  4O4H B;  2ALE A;  5CB4 A;  1U3L A;  1T0A A;  2LCA A;  1JD1 A;  3N2G B;  4U39 A;  4IIJ A;  1SA0 B;  2ZOV A;  1M90 H;  2H8C A;  3KE1 A;  4G88 A;  3RE3 A;  2QEX F;  3S03 A;  1VQK F;  1FFX A;  5EIB D;  4IIJ B;  4KWE A;  3IKE A;  2RHH A;  4PWT A;  1FNK A;  3WPW A;  3KJJ A;  1UI9 A;  3QHD A;  3OBW A;  3VI6 A;  5EYP B;  1XHO A;  3WJR A;  1DT9 A;  3CYP B;  2ZF8 A;  4BVS A;  3NK7 A;  2FC3 A;  2JNB A;  2UYN B;  3IMP A;  1Q7Y H;  3OBY A;  1N8R H;  2BTU A; 
#chains in the Genus database with same CATH homology
 1U43 A;  2UZH A;  3RE3 A;  1KNK A;  3Q8H A;  3IEQ A;  4C82 A;  3ERN A;  1IV4 A;  2GZL A;  3P0Z A;  3ESJ A;  4C8I A;  1VHA A;  3JVH A;  3IKE A;  1IV3 A;  3F0F A;  3ELC A;  3T80 A;  1GX1 A;  3F0D A;  1IV2 A;  1U3P A;  3QHD A;  3K2X A;  3P10 A;  3GHZ A;  1JN1 A;  1VH8 A;  3F0G A;  1H47 A;  1YQN A;  3FBA A;  3FPI A;  3K14 A;  1U3L A;  1T0A A;  3F6M A;  4C8E A;  2PMP A;  3F0E A;  2AMT A;  1H48 A;  1JY8 A;  1KNJ A;  1W57 A;  1W55 A;  3IKF A;  3MBM A;  1IV1 A;  3IEW A;  4C81 A;  4C8G A;  1U40 A;  5B8F A;  3KE1 A;  3EOR A;  3B6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...