1VH8A

Crystal structure of a 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vh8A00
1U40A 1IV2A 1KNKA 3F6MA 3QHDA 1H47A 3B6NA 1IV4A 3IKEA 1IV1A 3IKFA 4C81A 3FPIA 3JVHA 3RE3A 3F0EA 3F0GA 3F0FA 3K14A 1W55A 3MBMA 1JY8A 1W57A 3KE1A 3P10A 2AMTA 1JN1A 1T0AA 1VH8A 1VHAA 3ELCA 3ERNA 3IEQA 1GX1A 3P0ZA 1KNJA 1IV3A 1U3LA 1U3PA 2PMPA 4C8EA 3F0DA 2GZLA 3IEWA 5B8FA 3T80A 4C8GA 3EORA 3K2XA 4C8IA 3GHZA 2UZHA 1YQNA 3ESJA 4C82A 3FBAA 3Q8HA 1U43A 1H48A
chains in the Genus database with same CATH superfamily
1Z5WA 5BMVB 5HP8A 2VAPA 2HRUA 4X1KA 2L26A 3DC2A 5KX5A 3PAFA 3V3TA 2OTLF 4X1IA 1IPAA 1QD9A 5EZYA 4I55A 3HKBB 1M1KH 4TV8B 3WJRA 4BVTA 2Q1YA 1RQ7A 2UYJA 3WGLA 5HWEA 3RYCA 5KX5B 3JARB 3FBAA 1RLGA 2FGYA 3LMEA 2VGNA 3VYUC 2MQEA 4C81A 5EIBC 3HKBA 3F0EA 3LWPC 3I55F 3J81M 1W55A 5EZYB 4EI9A 2QI2A 3HKCB 4I50B 3HAXD 1VQ4F 5EYPA 4KWEA 2VAWA 1NJIH 2BTOA 3WJQA 3S06A 3NVIB 2GZLA 1YJ9F 1R1MA 4O4HA 5LYJA 3E1YA 3G6EF 2BO1A 2B33A 3N4ZA 1YIJF 3C9SA 4C82A 3I56F 2GVIA 4B46A 4O2AA 3B6NA 5EB1B 3JALB 4TV9A 5LA6A 5A2QM 3RYHA 5HY2A 4EB6B 3TD5A 4DRXA 3KE1A 2W8BC 4BVRA 5EYPB 4BT7A 5EIBD 1JN1A 5CA1A 3ELCA 4O4JA 4FFBB 1GX1A 4C4WC 2UYPA 2I6RA 3WJPA 3F0DA 3IR9A 2Z1EA 2ZAUA 3CCUF 3QTYA 4EB6A 4ZHVA 5JVDA 3VTIC 2HS0A 3IKEA 3JVHA 3VYTC 3TD3A 2BTQB 1VQNF 3F0FA 2LBXA 1TVKB 5GONA 1W41A 1YGYA 3C9TA 2AIFA 2ZF8A 3HWUA 3ZO8A 3HJWC 4BVSA 5MN5A 3JAKB 1RLUA 4O2BA 2RHLA 2YXZA 1T0KB 1K8AH 2ZOVA 2ZVYA 3CCMF 1ODEA 4C8IA 3CCRF 1YITF 1VQKF 5JVDB 3K12A 1OAPA 1X7PA 3DDNA 4IIJA 5GONB 2I6DA 3FPIA 4ZK7A 4YJ3A 1GZ0A 3S0HA 3RYFA 3S0WA 1JY8A 1W57A 4BT2A 2CSLA 5HXUA 2LBWA 3VI6A 3ZP4A 5J2UB 1JFFA 3CCQF 3CCSF 3CC7F 3CG6A 1W5AA 3LWOC 1VQMF 1QVGF 3C9RA 3HKCA 1K9MH 3S03A 3FD6A 3CCEF 4IIJB 4NWOB 5C8YB 5HP7A 4F6RB 2G9IA 4ZI7A 4TUYB 5LYJB 4DRXB 4YJ2A 1JFFB 3VYSC 3CMEF 1SDSA 2KTVA 3CYPB 4NQ3A 3U0OA 4ERHA 2CWJA 2P6YA 3NK6A 3OBWA 4G4VA 3TD4A 5HXZA 5FNVA 2RHOA 3JALA 3CD6F 3D54A 4LCKA 3UT5B 1W5FA 4O4IB 4PWTA 4HNAB 1KNJA 2UYNB 4BT5A 3SIUA 3O85A 3D01A 3RA6A 5CA1B 1SA0B 1XV2A 3JAMM 3VOBA 3I3FA 3V7EA 3ESJA 1J7HA 3JAWB 3WGMA 3OW2F 1KC8H 4RHAA 1XBIA 3J80M 3CC2F 3RYCB 2WALA 3M84A 5LOVB 4BVQA 5KMGB 4HNAA 1VQOF 1QU9A 4XCQA 2Z01A 3M1XA 4O4LA 3ERNA 3JATA 1X25A 3N2KB 4G4XA 2OHWA 2KTUA 5GIOC 2LCAA 3MDOA 3JAWA 1TUBA 5FJ4C 1FNKA 1SA0A 4O2BB 1M90H 3LYBA 4U3JA 3IMPA 5JCOC 1VK3A 5CA0A 4I50A 3D00A 2HVYD 2OTMA 2UZHA 3WGKA 3E20B 4X1YB 5KMGA 5MN6A 4X1IB 1TUBB 2LBTA 3LWQC 5CB4A 2DYYA 5IJ0B 1Q81H 1VQ6F 5GINC 2IQQA 4TV9B 4BT4A 1W59A 4LNUB 2CHTA 3VOAA 3VIUA 4I4TB 5IT9M 1CLIA 3PLAC 4R40B 4U39A 2H6LA 4B5CA 1H7MA 2RB9A 4BW0B 3L7QA 4IHJB 3FFMA 3CXCF 1YJNF 1U40A 5CB4B 1IV4A 3MQWA 1JJ2F 3BYQA 5LXTB 1XRGA 3GTZA 3KIZA 3VO8A 2HRYA 4O4IA 2HP0A 1TVKA 1U3PA 4B45A 2IG8A 3T80A 1W5BA 3N2GB 1Q86H 2NMUA 3RA5A 5LA6B 2EWCA 2VAMA 2CW4A 3Q8HA 3WGNA 5GIPC 2Z1FA 4EI7A 1FSZA 3RYHB 1PF5A 2HX0A 3G4SF 3RE3A 4FFBA 3ON1A 5LOVA 1OFUA 3OBYA 3MBMA 5MN4A 2V9YA 4O4JB 5LP6A 4ZHQA 4G4ZA 4X1KB 3IEQA 2OZBA 5B8FA 4ZOLB 3KJJA 4O4LB 1VQLF 2QEXF 4G88A 4E6EA 2HP3A 3V4DA 1Q82H 5HY4A 3EORA 2HS3A 3QHDA 4U3JB 3V7QA 1H47A 2K1SA 2IAFA 3J7AR 1E7KA 3JARA 5IJ0A 1Z5VA 3HKEB 2Q1XA 1YI2F 4TUYA 5G4VC 5GAPK 5HY1A 1VHAA 1VH8A 1VQ7F 3CPWF 1VQ8F 3CCJF 5GANK 4B62A 1S72F 1W2BF 4TZZA 1COMA 2DT4A 3KHNA 2QTPA 1GO0A 1PXWA 4BT3A 4EI8A 3M4SA 2Z1TA 5FLXM 3I7TA 2F9ZC 3E22B 1KQSF 5J2TA 4O4HB 3VCZA 3MCQA 2BTUA 3RYFB 5DCVA 1DBFA 2R6R1 3K14A 5EO3A 1YHQF 2R751 5JCOA 3CPQA 3P4EA 5G4UC 3HTNA 4O2AB 3ZOPA 1VQ9F 3SIVA 2HP0B 4BY9D 1VQ5F 5EAZA 2HQSC 2JNBA 2VGMA 5LXTA 3N2GA 4C8EA 1YJWF 2VXYA 3JASA 2N48A 3RYIA 5JQGB 3NMUC 4F6RA 4ZI7B 5J2TB 1W40A 2Z1UA 3JATB 3N2KA 4G4YA 3LDTA 4YJ2B 1CN7A 5IJ9A 5C8YA 1YQNA 4X3MA 2QA4F 3WXMB 3C9UA 2OTJF 5FNVB 2RHJA 1IV1A 3WGJA 3QUWA 2ALEA 5EB0A 2KGWA 3CCVF 1RA4A 1CK2A 3CCLF 4X3LA 3S0YA 4NUTA 1SZQA 2AIZP 5LP6B 3RYIB 3CB2A 1U3LA 2RHHA 3IEWA 1DT9A 5ITZA 4ZHQB 1UFYA 1RQ2A 1XHOA 3GHZA 3WPXA 5IYZB 3JAKA 3OONA 2UYKA 1H48A 3F6MA 5HY0A 3NVKE 2HS4A 1W5EA 3IKFA 1VQPF 4RQOA 1VQVA 3HKDA 2YYEA 3HKEA 3K0TA 3VMFB 5BMVA 3CYQA 2PHNA 4ZHWA 1W3EX 4YJ3B 3NK7A 2KG4A 3ZP7A 3N4YA 2H8EA 4TV8A 1JD1A 1K73H 1UI9A 1X52A 3CC4F 5ITZB 1IV3A 4I55B 5CA0B 5IYZA 2ZVZA 4X1YA 5JH7B 5J2UA 4X20A 3CMAF 1Q7YH 3HKDB 4DXDA 3LWVC 3E22A 1W581 1N8RH 1IV2A 3LWRC 3AGKA 2CVLA 3F0GA 5EWRA 1W42A 3WPWA 4LNUA 3P10A 3GYQA 1FFXB 2AMTA 4I4TA 3FD5A 1KD1H 4M8IA 5JQGA 1QVFF 1ONIA 3P0ZA 5AVMA 5JH7A 2ZODA 4ZHYB 1X7OA 3R0PA 2GLZA 4X20B 4BT6A 2H8CA 3JASB 3UT5A 4IHJA 2CHSA 3LFOA 2UYNA 4WBNB 3S02A 1FFXA 1KNKA 3MCAB 4ZOLA 2FC3A 5IJ9B 3C8LA 1GO1A 1T0AA 1NQ3A 2PMPA 4G4WA 1QAHA 1NMUB 3KJKA 3JCMM 4C8GA 3K2XA 1ZWZA 1Q8RA 2CZWA 4WBNA 3G71F 5LP6C 1U43A 1FNJA
chains in the Genus database with same CATH topology
1U40A 1IV2A 1KNKA 3F6MA 3QHDA 1H47A 3B6NA 1IV4A 3IKEA 1IV1A 3IKFA 4C81A 3FPIA 3JVHA 3RE3A 3F0EA 3F0GA 3F0FA 3K14A 1W55A 3MBMA 1JY8A 1W57A 3KE1A 3P10A 2AMTA 1JN1A 1T0AA 1VH8A 1VHAA 3ELCA 3ERNA 3IEQA 1GX1A 3P0ZA 1KNJA 1IV3A 1U3LA 1U3PA 2PMPA 4C8EA 3F0DA 2GZLA 3IEWA 5B8FA 3T80A 4C8GA 3EORA 3K2XA 4C8IA 3GHZA 2UZHA 1YQNA 3ESJA 4C82A 3FBAA 3Q8HA 1U43A 1H48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U40 A;  1IV2 A;  1KNK A;  3F6M A;  3QHD A;  1H47 A;  3B6N A;  1IV4 A;  3IKE A;  1IV1 A;  3IKF A;  4C81 A;  3FPI A;  3JVH A;  3RE3 A;  3F0E A;  3F0G A;  3F0F A;  3K14 A;  1W55 A;  3MBM A;  1JY8 A;  1W57 A;  3KE1 A;  3P10 A;  2AMT A;  1JN1 A;  1T0A A;  1VH8 A;  1VHA A;  3ELC A;  3ERN A;  3IEQ A;  1GX1 A;  3P0Z A;  1KNJ A;  1IV3 A;  1U3L A;  1U3P A;  2PMP A;  4C8E A;  3F0D A;  2GZL A;  3IEW A;  5B8F A;  3T80 A;  4C8G A;  3EOR A;  3K2X A;  4C8I A;  3GHZ A;  2UZH A;  1YQN A;  3ESJ A;  4C82 A;  3FBA A;  3Q8H A;  1U43 A;  1H48 A; 
#chains in the Genus database with same CATH topology
 1Z5W A;  5BMV B;  5HP8 A;  2VAP A;  2HRU A;  4X1K A;  2L26 A;  3DC2 A;  5KX5 A;  3PAF A;  3V3T A;  2OTL F;  4X1I A;  1IPA A;  1QD9 A;  5EZY A;  4I55 A;  3HKB B;  1M1K H;  4TV8 B;  3WJR A;  4BVT A;  2Q1Y A;  1RQ7 A;  2UYJ A;  3WGL A;  5HWE A;  3RYC A;  5KX5 B;  3JAR B;  3FBA A;  1RLG A;  2FGY A;  3LME A;  2VGN A;  3VYU C;  2MQE A;  4C81 A;  5EIB C;  3HKB A;  3F0E A;  3LWP C;  3I55 F;  3J81 M;  1W55 A;  5EZY B;  4EI9 A;  2QI2 A;  3HKC B;  4I50 B;  3HAX D;  1VQ4 F;  5EYP A;  4KWE A;  2VAW A;  1NJI H;  2BTO A;  3WJQ A;  3S06 A;  3NVI B;  2GZL A;  1YJ9 F;  1R1M A;  4O4H A;  5LYJ A;  3E1Y A;  3G6E F;  2BO1 A;  2B33 A;  3N4Z A;  1YIJ F;  3C9S A;  4C82 A;  3I56 F;  2GVI A;  4B46 A;  4O2A A;  3B6N A;  5EB1 B;  3JAL B;  4TV9 A;  5LA6 A;  5A2Q M;  3RYH A;  5HY2 A;  4EB6 B;  3TD5 A;  4DRX A;  3KE1 A;  2W8B C;  4BVR A;  5EYP B;  4BT7 A;  5EIB D;  1JN1 A;  5CA1 A;  3ELC A;  4O4J A;  4FFB B;  1GX1 A;  4C4W C;  2UYP A;  2I6R A;  3WJP A;  3F0D A;  3IR9 A;  2Z1E A;  2ZAU A;  3CCU F;  3QTY A;  4EB6 A;  4ZHV A;  5JVD A;  3VTI C;  2HS0 A;  3IKE A;  3JVH A;  3VYT C;  3TD3 A;  2BTQ B;  1VQN F;  3F0F A;  2LBX A;  1TVK B;  5GON A;  1W41 A;  1YGY A;  3C9T A;  2AIF A;  2ZF8 A;  3HWU A;  3ZO8 A;  3HJW C;  4BVS A;  5MN5 A;  3JAK B;  1RLU A;  4O2B A;  2RHL A;  2YXZ A;  1T0K B;  1K8A H;  2ZOV A;  2ZVY A;  3CCM F;  1ODE A;  4C8I A;  3CCR F;  1YIT F;  1VQK F;  5JVD B;  3K12 A;  1OAP A;  1X7P A;  3DDN A;  4IIJ A;  5GON B;  2I6D A;  3FPI A;  4ZK7 A;  4YJ3 A;  1GZ0 A;  3S0H A;  3RYF A;  3S0W A;  1JY8 A;  1W57 A;  4BT2 A;  2CSL A;  5HXU A;  2LBW A;  3VI6 A;  3ZP4 A;  5J2U B;  1JFF A;  3CCQ F;  3CCS F;  3CC7 F;  3CG6 A;  1W5A A;  3LWO C;  1VQM F;  1QVG F;  3C9R A;  3HKC A;  1K9M H;  3S03 A;  3FD6 A;  3CCE F;  4IIJ B;  4NWO B;  5C8Y B;  5HP7 A;  4F6R B;  2G9I A;  4ZI7 A;  4TUY B;  5LYJ B;  4DRX B;  4YJ2 A;  1JFF B;  3VYS C;  3CME F;  1SDS A;  2KTV A;  3CYP B;  4NQ3 A;  3U0O A;  4ERH A;  2CWJ A;  2P6Y A;  3NK6 A;  3OBW A;  4G4V A;  3TD4 A;  5HXZ A;  5FNV A;  2RHO A;  3JAL A;  3CD6 F;  3D54 A;  4LCK A;  3UT5 B;  1W5F A;  4O4I B;  4PWT A;  4HNA B;  1KNJ A;  2UYN B;  4BT5 A;  3SIU A;  3O85 A;  3D01 A;  3RA6 A;  5CA1 B;  1SA0 B;  1XV2 A;  3JAM M;  3VOB A;  3I3F A;  3V7E A;  3ESJ A;  1J7H A;  3JAW B;  3WGM A;  3OW2 F;  1KC8 H;  4RHA A;  1XBI A;  3J80 M;  3CC2 F;  3RYC B;  2WAL A;  3M84 A;  5LOV B;  4BVQ A;  5KMG B;  4HNA A;  1VQO F;  1QU9 A;  4XCQ A;  2Z01 A;  3M1X A;  4O4L A;  3ERN A;  3JAT A;  1X25 A;  3N2K B;  4G4X A;  2OHW A;  2KTU A;  5GIO C;  2LCA A;  3MDO A;  3JAW A;  1TUB A;  5FJ4 C;  1FNK A;  1SA0 A;  4O2B B;  1M90 H;  3LYB A;  4U3J A;  3IMP A;  5JCO C;  1VK3 A;  5CA0 A;  4I50 A;  3D00 A;  2HVY D;  2OTM A;  2UZH A;  3WGK A;  3E20 B;  4X1Y B;  5KMG A;  5MN6 A;  4X1I B;  1TUB B;  2LBT A;  3LWQ C;  5CB4 A;  2DYY A;  5IJ0 B;  1Q81 H;  1VQ6 F;  5GIN C;  2IQQ A;  4TV9 B;  4BT4 A;  1W59 A;  4LNU B;  2CHT A;  3VOA A;  3VIU A;  4I4T B;  5IT9 M;  1CLI A;  3PLA C;  4R40 B;  4U39 A;  2H6L A;  4B5C A;  1H7M A;  2RB9 A;  4BW0 B;  3L7Q A;  4IHJ B;  3FFM A;  3CXC F;  1YJN F;  1U40 A;  5CB4 B;  1IV4 A;  3MQW A;  1JJ2 F;  3BYQ A;  5LXT B;  1XRG A;  3GTZ A;  3KIZ A;  3VO8 A;  2HRY A;  4O4I A;  2HP0 A;  1TVK A;  1U3P A;  4B45 A;  2IG8 A;  3T80 A;  1W5B A;  3N2G B;  1Q86 H;  2NMU A;  3RA5 A;  5LA6 B;  2EWC A;  2VAM A;  2CW4 A;  3Q8H A;  3WGN A;  5GIP C;  2Z1F A;  4EI7 A;  1FSZ A;  3RYH B;  1PF5 A;  2HX0 A;  3G4S F;  3RE3 A;  4FFB A;  3ON1 A;  5LOV A;  1OFU A;  3OBY A;  3MBM A;  5MN4 A;  2V9Y A;  4O4J B;  5LP6 A;  4ZHQ A;  4G4Z A;  4X1K B;  3IEQ A;  2OZB A;  5B8F A;  4ZOL B;  3KJJ A;  4O4L B;  1VQL F;  2QEX F;  4G88 A;  4E6E A;  2HP3 A;  3V4D A;  1Q82 H;  5HY4 A;  3EOR A;  2HS3 A;  3QHD A;  4U3J B;  3V7Q A;  1H47 A;  2K1S A;  2IAF A;  3J7A R;  1E7K A;  3JAR A;  5IJ0 A;  1Z5V A;  3HKE B;  2Q1X A;  1YI2 F;  4TUY A;  5G4V C;  5GAP K;  5HY1 A;  1VHA A;  1VH8 A;  1VQ7 F;  3CPW F;  1VQ8 F;  3CCJ F;  5GAN K;  4B62 A;  1S72 F;  1W2B F;  4TZZ A;  1COM A;  2DT4 A;  3KHN A;  2QTP A;  1GO0 A;  1PXW A;  4BT3 A;  4EI8 A;  3M4S A;  2Z1T A;  5FLX M;  3I7T A;  2F9Z C;  3E22 B;  1KQS F;  5J2T A;  4O4H B;  3VCZ A;  3MCQ A;  2BTU A;  3RYF B;  5DCV A;  1DBF A;  2R6R 1;  3K14 A;  5EO3 A;  1YHQ F;  2R75 1;  5JCO A;  3CPQ A;  3P4E A;  5G4U C;  3HTN A;  4O2A B;  3ZOP A;  1VQ9 F;  3SIV A;  2HP0 B;  4BY9 D;  1VQ5 F;  5EAZ A;  2HQS C;  2JNB A;  2VGM A;  5LXT A;  3N2G A;  4C8E A;  1YJW F;  2VXY A;  3JAS A;  2N48 A;  3RYI A;  5JQG B;  3NMU C;  4F6R A;  4ZI7 B;  5J2T B;  1W40 A;  2Z1U A;  3JAT B;  3N2K A;  4G4Y A;  3LDT A;  4YJ2 B;  1CN7 A;  5IJ9 A;  5C8Y A;  1YQN A;  4X3M A;  2QA4 F;  3WXM B;  3C9U A;  2OTJ F;  5FNV B;  2RHJ A;  1IV1 A;  3WGJ A;  3QUW A;  2ALE A;  5EB0 A;  2KGW A;  3CCV F;  1RA4 A;  1CK2 A;  3CCL F;  4X3L A;  3S0Y A;  4NUT A;  1SZQ A;  2AIZ P;  5LP6 B;  3RYI B;  3CB2 A;  1U3L A;  2RHH A;  3IEW A;  1DT9 A;  5ITZ A;  4ZHQ B;  1UFY A;  1RQ2 A;  1XHO A;  3GHZ A;  3WPX A;  5IYZ B;  3JAK A;  3OON A;  2UYK A;  1H48 A;  3F6M A;  5HY0 A;  3NVK E;  2HS4 A;  1W5E A;  3IKF A;  1VQP F;  4RQO A;  1VQV A;  3HKD A;  2YYE A;  3HKE A;  3K0T A;  3VMF B;  5BMV A;  3CYQ A;  2PHN A;  4ZHW A;  1W3E X;  4YJ3 B;  3NK7 A;  2KG4 A;  3ZP7 A;  3N4Y A;  2H8E A;  4TV8 A;  1JD1 A;  1K73 H;  1UI9 A;  1X52 A;  3CC4 F;  5ITZ B;  1IV3 A;  4I55 B;  5CA0 B;  5IYZ A;  2ZVZ A;  4X1Y A;  5JH7 B;  5J2U A;  4X20 A;  3CMA F;  1Q7Y H;  3HKD B;  4DXD A;  3LWV C;  3E22 A;  1W58 1;  1N8R H;  1IV2 A;  3LWR C;  3AGK A;  2CVL A;  3F0G A;  5EWR A;  1W42 A;  3WPW A;  4LNU A;  3P10 A;  3GYQ A;  1FFX B;  2AMT A;  4I4T A;  3FD5 A;  1KD1 H;  4M8I A;  5JQG A;  1QVF F;  1ONI A;  3P0Z A;  5AVM A;  5JH7 A;  2ZOD A;  4ZHY B;  1X7O A;  3R0P A;  2GLZ A;  4X20 B;  4BT6 A;  2H8C A;  3JAS B;  3UT5 A;  4IHJ A;  2CHS A;  3LFO A;  2UYN A;  4WBN B;  3S02 A;  1FFX A;  1KNK A;  3MCA B;  4ZOL A;  2FC3 A;  5IJ9 B;  3C8L A;  1GO1 A;  1T0A A;  1NQ3 A;  2PMP A;  4G4W A;  1QAH A;  1NMU B;  3KJK A;  3JCM M;  4C8G A;  3K2X A;  1ZWZ A;  1Q8R A;  2CZW A;  4WBN A;  3G71 F;  5LP6 C;  1U43 A;  1FNJ A; 
#chains in the Genus database with same CATH homology
 1U40 A;  1IV2 A;  1KNK A;  3F6M A;  3QHD A;  1H47 A;  3B6N A;  1IV4 A;  3IKE A;  1IV1 A;  3IKF A;  4C81 A;  3FPI A;  3JVH A;  3RE3 A;  3F0E A;  3F0G A;  3F0F A;  3K14 A;  1W55 A;  3MBM A;  1JY8 A;  1W57 A;  3KE1 A;  3P10 A;  2AMT A;  1JN1 A;  1T0A A;  1VH8 A;  1VHA A;  3ELC A;  3ERN A;  3IEQ A;  1GX1 A;  3P0Z A;  1KNJ A;  1IV3 A;  1U3L A;  1U3P A;  2PMP A;  4C8E A;  3F0D A;  2GZL A;  3IEW A;  5B8F A;  3T80 A;  4C8G A;  3EOR A;  3K2X A;  4C8I A;  3GHZ A;  2UZH A;  1YQN A;  3ESJ A;  4C82 A;  3FBA A;  3Q8H A;  1U43 A;  1H48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...