1VH8A

Crystal structure of a 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
153
Chain Sequence
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFPKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 44
structure length 153
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 1vh8A00
3IKEA 3Q8HA 3GHZA 1JY8A 1U3PA 4C8GA 4C8IA 1U43A 3K2XA 2UZHA 5B8FA 3P10A 1IV2A 1U40A 3ELCA 3T80A 3F0FA 1GX1A 4C82A 3QHDA 3B6NA 3F6MA 1H47A 3RE3A 1VHAA 3F0EA 1H48A 3K14A 1T0AA 2PMPA 3EORA 1JN1A 3ERNA 3ESJA 3FBAA 1YQNA 1IV3A 1VH8A 1KNKA 3IKFA 1W57A 3KE1A 4C8EA 2GZLA 1U3LA 3MBMA 4C81A 1IV1A 3IEWA 3JVHA 1IV4A 1W55A 3F0DA 3FPIA 2AMTA 3IEQA 3P0ZA 3F0GA 1KNJA
chains in the Genus database with same CATH superfamily
2KGWA 4X1KA 3KHNA 1W59A 3DDNA 2V9YA 4DRXA 2OTMA 2ZF8A 4X20B 3K2XA 2KTUA 3C9RA 4KWEA 1Z5WA 3T80A 4C82A 2ZODA 5KMGB 3S03A 2HQSC 2CSLA 3I3FA 4M8IA 4O4JA 1IV3A 4E6EA 1RQ2A 2FC3A 2CHTA 5JQGA 2VAMA 4X1YA 1IV1A 5LP6B 1RLUA 5CA0B 5LA6A 5EAZA 3KJJA 1YITF 2KTVA 1YJWF 1W2BF 3JASB 1QVFF 3J7AR 2VXYA 3VI6A 2UYNA 1VQLF 2KG4A 3HTNA 1FFXA 1W5BA 3TD5A 2Q1XA 4BT5A 4BT6A 1VH8A 2HP3A 2VGMA 3WJRA 3P4EA 1RLGA 4O2BB 1VQ6F 5JH7B 3HWUA 3S0YA 4TV8A 1X25A 2BTQB 4YJ3A 1ONIA 3CYQA 4FFBB 3ZP7A 3WGNA 3IEQA 5HWEA 3P0ZA 3S0WA 2HP0A 2ZVYA 3Q8HA 1JY8A 4C8GA 2OTJF 3JAMM 4WBNB 2OZBA 2N48A 3CMAF 3VYSC 1J7HA 3N2KB 2PMPA 5EIBD 5EZYA 5FJ4C 4PWTA 3N2GA 3LWVC 2ALEA 3LDTA 3RYHA 2FGYA 1DT9A 4TUYA 1XBIA 1JD1A 1S72F 1KQSF 4LCKA 5MN4A 1YIJF 3S02A 5HP7A 2BO1A 5ITZA 3VOAA 3JAKA 3FD5A 3P10A 5HY0A 1E7KA 3JARA 5JVDA 3CCVF 3HKBA 3OW2F 1SA0B 3FFMA 3JAWA 2W8BC 2ZAUA 2IG8A 4G4WA 5AVMA 3EORA 1SDSA 3V3TA 1JN1A 5BMVB 3N4ZA 5G4UC 1XRGA 3MQWA 4X20A 1KNKA 4EB6B 3SIUA 3RYIA 1X7PA 3LWOC 1RA4A 1W40A 5KMGA 2I6RA 3V7QA 3PLAC 2MQEA 3GYQA 1FNJA 3V4DA 2AIFA 3WGMA 3O85A 2ZVZA 1M90H 1CN7A 1SZQA 4F6RB 2BTOA 5LP6A 3E22B 1X52A 4NUTA 3LWQC 3D01A 2R751 5CA0A 2IAFA 2H8EA 5FNVB 1QD9A 4BY9D 1GO0A 3CCUF 2RHLA 3GTZA 3JALB 4BT3A 3JASA 3I7TA 5HY4A 4I4TB 5HY2A 2CZWA 2QTPA 4O2AB 2LBXA 3JVHA 5EWRA 1KNJA 3E1YA 2QEXF 4TZZA 1U3PA 1VQ4F 4O2BA 5JH7A 3QTYA 5IJ0B 2R6R1 1W41A 3ZO8A 4FFBA 3VYTC 3C9UA 3WPWA 3IMPA 3UT5B 1FNKA 4ZHQB 3TD3A 3QUWA 1YQNA 4WBNA 3DC2A 3CPWF 4NWOB 2CW4A 4IIJB 3LWRC 1VQKF 5J2UB 3ON1A 3N2KA 4ZK7A 1UI9A 4LNUB 3FPIA 4BVSA 2LBTA 3BYQA 4BT2A 4ZI7B 2H6LA 1K73H 1U43A 2UZHA 1JFFB 3G6EF 3CCRF 5IJ9B 2OHWA 3M4SA 3CCQF 2Q1YA 2HS3A 3KJKA 4ZHWA 4TV9B 3HKCB 1SA0A 4G4XA 4C81A 3IEWA 3CC7F 5BMVA 3WJPA 2G9IA 2AMTA 3RA5A 1Z5VA 4EI7A 5EB1B 5GAPK 1KD1H 3VO8A 4C8IA 1TVKB 3CC2F 2LBWA 5CA1B 1XHOA 3K14A 1VQNF 3S06A 3VIUA 2Z1FA 3ERNA 3CCEF 4F6RA 4BT7A 1Q86H 1T0KB 4U3JB 4YJ2B 4C8EA 3ZOPA 4B45A 1VQ7F 4XCQA 2IQQA 2RHHA 3IR9A 1K8AH 4O4LB 3CD6F 5KX5B 1W5FA 4BVQA 1YGYA 5FNVA 1VQMF 1JJ2F 3JALA 2GVIA 1X7OA 5GINC 3CMEF 5JQGB 5FLXM 4G4ZA 4X1YB 4I55B 3CXCF 3OONA 1H48A 3HKDB 1YI2F 3C8LA 2H8CA 3CPQA 5IJ0A 5LA6B 5MN5A 3SIVA 4ZHVA 1W57A 4R40B 2UYKA 3OBWA 1KC8H 2K1SA 5CB4B 1ODEA 2HRYA 3UT5A 2JNBA 3N4YA 3LWPC 3CB2A 3NVIB 4G4YA 1FFXB 4IIJA 2DYYA 5J2UA 5A2QM 3G71F 4BVTA 4LNUA 1NQ3A 5C8YB 3RE3A 5IT9M 2CHSA 4YJ3B 4ZI7A 1QAHA 3U0OA 5HXUA 1FSZA 3LYBA 3RA6A 1JFFA 2RHJA 4DXDA 4I50B 1W5EA 1VQVA 4ZOLB 5IJ9A 5GIPC 1XV2A 1IV4A 3RYCB 2YYEA 2P6YA 3L7QA 1VQ5F 4TV9A 3HKCA 5EZYB 5MN6A 1TUBB 4X3LA 2OTLF 3F6MA 1VHAA 2WALA 4U39A 5HY1A 2CVLA 2QA4F 4BVRA 2B33A 4O4IB 4X1IB 3KIZA 3MDOA 3J80M 3CCMF 3IKFA 3CC4F 1TVKA 3M84A 3HKEB 3WGKA 3NMUC 5CA1A 1DBFA 2ZOVA 2VGNA 2HS0A 2RB9A 3WGLA 4U3JA 5LOVB 3GHZA 4YJ2A 5DCVA 3AGKA 5HXZA 1QVGF 1VQ9F 3JCMM 3WJQA 1YJ9F 4O4LA 3RYIB 3WPXA 1VK3A 5KX5A 4RQOA 3NK7A 5J2TB 1RQ7A 2PHNA 3K12A 2Z1EA 5IYZB 4IHJB 3I55F 5LXTB 4C4WC 1M1KH 4I55A 4G88A 5LYJB 3HKDA 4HNAB 3FD6A 2BTUA 3F0DA 5GONB 5JCOA 5EB0A 5EYPB 2HS4A 2EWCA 2VAWA 3V7EA 4B5CA 5CB4A 4EB6A 1COMA 5B8FA 3RYFB 1IV2A 3OBYA 2UYJA 3E20B 5EIBC 4B46A 1Q81H 4O4HB 2Z01A 5G4VC 1Q7YH 1R1MA 3JATB 1CLIA 2VAPA 1W42A 3CG6A 2HVYD 5LP6C 4X3MA 1VQ8F 4B62A 4X1KB 1PF5A 3E22A 2CWJA 1U3LA 5C8YA 4DRXB 2DT4A 3D00A 1K9MH 1PXWA 3K0TA 3MCAB 1W55A 2NMUA 3C9SA 3C9TA 1VQPF 1Q82H 3NVKE 3F0GA 1VQOF 2Z1UA 3CCLF 1YHQF 4I50A 4ZOLA 4O4JB 5HP8A 3G4SF 4I4TA 3VOBA 4O2AA 1U40A 3RYCA 3HJWC 3B6NA 1H47A 2AIZP 3F0EA 2LCAA 3VCZA 3HAXD 3ESJA 1TUBA 4ZHYB 1GO1A 4EI9A 1W3EX 2GZLA 4BT4A 3I56F 4O4IA 1NMUB 4ZHQA 2QI2A 4X1IA 3VYUC 2UYNB 1W581 3MCQA 3HKEA 3S0HA 5GIOC 3NK6A 1GX1A 1OAPA 2HX0A 4TV8B 5LOVA 1ZWZA 2YXZA 3M1XA 1GZ0A 4G4VA 2HP0B 4BW0B 5J2TA 4NQ3A 4RHAA 4ERHA 3WXMB 3LMEA 3CCSF 1UFYA 3ZP4A 3KE1A 3QHDA 4IHJA 5IYZA 1NJIH 1YJNF 3IKEA 3CCJF 5LXTA 5EO3A 3CYPB 3J81M 2GLZA 3VMFB 5JCOC 5LYJA 1H7MA 4EI8A 3ELCA 4HNAA 2L26A 3F0FA 2F9ZC 3N2GB 3D54A 5GONA 3PAFA 3RYHB 1OFUA 5EYPA 2RHOA 4TUYB 3VTIC 1T0AA 1Q8RA 3FBAA 1CK2A 3TD4A 1W5AA 2HRUA 5ITZB 3RYFA 1N8RH 4O4HA 3WGJA 2Z1TA 1QU9A 3MBMA 1IPAA 3JAKB 3JATA 2I6DA 3JARB 3R0PA 5JVDB 5GANK 2UYPA 3HKBB 3JAWB 3LFOA
chains in the Genus database with same CATH topology
3IKEA 3Q8HA 3GHZA 1JY8A 1U3PA 4C8GA 4C8IA 1U43A 3K2XA 2UZHA 5B8FA 3P10A 1IV2A 1U40A 3ELCA 3T80A 3F0FA 1GX1A 4C82A 3QHDA 3B6NA 3F6MA 1H47A 3RE3A 1VHAA 3F0EA 1H48A 3K14A 1T0AA 2PMPA 3EORA 1JN1A 3ERNA 3ESJA 3FBAA 1YQNA 1IV3A 1VH8A 1KNKA 3IKFA 1W57A 3KE1A 4C8EA 2GZLA 1U3LA 3MBMA 4C81A 1IV1A 3IEWA 3JVHA 1IV4A 1W55A 3F0DA 3FPIA 2AMTA 3IEQA 3P0ZA 3F0GA 1KNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKE A;  3Q8H A;  3GHZ A;  1JY8 A;  1U3P A;  4C8G A;  4C8I A;  1U43 A;  3K2X A;  2UZH A;  5B8F A;  3P10 A;  1IV2 A;  1U40 A;  3ELC A;  3T80 A;  3F0F A;  1GX1 A;  4C82 A;  3QHD A;  3B6N A;  3F6M A;  1H47 A;  3RE3 A;  1VHA A;  3F0E A;  1H48 A;  3K14 A;  1T0A A;  2PMP A;  3EOR A;  1JN1 A;  3ERN A;  3ESJ A;  3FBA A;  1YQN A;  1IV3 A;  1VH8 A;  1KNK A;  3IKF A;  1W57 A;  3KE1 A;  4C8E A;  2GZL A;  1U3L A;  3MBM A;  4C81 A;  1IV1 A;  3IEW A;  3JVH A;  1IV4 A;  1W55 A;  3F0D A;  3FPI A;  2AMT A;  3IEQ A;  3P0Z A;  3F0G A;  1KNJ A; 
#chains in the Genus database with same CATH topology
 2KGW A;  4X1K A;  3KHN A;  1W59 A;  3DDN A;  2V9Y A;  4DRX A;  2OTM A;  2ZF8 A;  4X20 B;  3K2X A;  2KTU A;  3C9R A;  4KWE A;  1Z5W A;  3T80 A;  4C82 A;  2ZOD A;  5KMG B;  3S03 A;  2HQS C;  2CSL A;  3I3F A;  4M8I A;  4O4J A;  1IV3 A;  4E6E A;  1RQ2 A;  2FC3 A;  2CHT A;  5JQG A;  2VAM A;  4X1Y A;  1IV1 A;  5LP6 B;  1RLU A;  5CA0 B;  5LA6 A;  5EAZ A;  3KJJ A;  1YIT F;  2KTV A;  1YJW F;  1W2B F;  3JAS B;  1QVF F;  3J7A R;  2VXY A;  3VI6 A;  2UYN A;  1VQL F;  2KG4 A;  3HTN A;  1FFX A;  1W5B A;  3TD5 A;  2Q1X A;  4BT5 A;  4BT6 A;  1VH8 A;  2HP3 A;  2VGM A;  3WJR A;  3P4E A;  1RLG A;  4O2B B;  1VQ6 F;  5JH7 B;  3HWU A;  3S0Y A;  4TV8 A;  1X25 A;  2BTQ B;  4YJ3 A;  1ONI A;  3CYQ A;  4FFB B;  3ZP7 A;  3WGN A;  3IEQ A;  5HWE A;  3P0Z A;  3S0W A;  2HP0 A;  2ZVY A;  3Q8H A;  1JY8 A;  4C8G A;  2OTJ F;  3JAM M;  4WBN B;  2OZB A;  2N48 A;  3CMA F;  3VYS C;  1J7H A;  3N2K B;  2PMP A;  5EIB D;  5EZY A;  5FJ4 C;  4PWT A;  3N2G A;  3LWV C;  2ALE A;  3LDT A;  3RYH A;  2FGY A;  1DT9 A;  4TUY A;  1XBI A;  1JD1 A;  1S72 F;  1KQS F;  4LCK A;  5MN4 A;  1YIJ F;  3S02 A;  5HP7 A;  2BO1 A;  5ITZ A;  3VOA A;  3JAK A;  3FD5 A;  3P10 A;  5HY0 A;  1E7K A;  3JAR A;  5JVD A;  3CCV F;  3HKB A;  3OW2 F;  1SA0 B;  3FFM A;  3JAW A;  2W8B C;  2ZAU A;  2IG8 A;  4G4W A;  5AVM A;  3EOR A;  1SDS A;  3V3T A;  1JN1 A;  5BMV B;  3N4Z A;  5G4U C;  1XRG A;  3MQW A;  4X20 A;  1KNK A;  4EB6 B;  3SIU A;  3RYI A;  1X7P A;  3LWO C;  1RA4 A;  1W40 A;  5KMG A;  2I6R A;  3V7Q A;  3PLA C;  2MQE A;  3GYQ A;  1FNJ A;  3V4D A;  2AIF A;  3WGM A;  3O85 A;  2ZVZ A;  1M90 H;  1CN7 A;  1SZQ A;  4F6R B;  2BTO A;  5LP6 A;  3E22 B;  1X52 A;  4NUT A;  3LWQ C;  3D01 A;  2R75 1;  5CA0 A;  2IAF A;  2H8E A;  5FNV B;  1QD9 A;  4BY9 D;  1GO0 A;  3CCU F;  2RHL A;  3GTZ A;  3JAL B;  4BT3 A;  3JAS A;  3I7T A;  5HY4 A;  4I4T B;  5HY2 A;  2CZW A;  2QTP A;  4O2A B;  2LBX A;  3JVH A;  5EWR A;  1KNJ A;  3E1Y A;  2QEX F;  4TZZ A;  1U3P A;  1VQ4 F;  4O2B A;  5JH7 A;  3QTY A;  5IJ0 B;  2R6R 1;  1W41 A;  3ZO8 A;  4FFB A;  3VYT C;  3C9U A;  3WPW A;  3IMP A;  3UT5 B;  1FNK A;  4ZHQ B;  3TD3 A;  3QUW A;  1YQN A;  4WBN A;  3DC2 A;  3CPW F;  4NWO B;  2CW4 A;  4IIJ B;  3LWR C;  1VQK F;  5J2U B;  3ON1 A;  3N2K A;  4ZK7 A;  1UI9 A;  4LNU B;  3FPI A;  4BVS A;  2LBT A;  3BYQ A;  4BT2 A;  4ZI7 B;  2H6L A;  1K73 H;  1U43 A;  2UZH A;  1JFF B;  3G6E F;  3CCR F;  5IJ9 B;  2OHW A;  3M4S A;  3CCQ F;  2Q1Y A;  2HS3 A;  3KJK A;  4ZHW A;  4TV9 B;  3HKC B;  1SA0 A;  4G4X A;  4C81 A;  3IEW A;  3CC7 F;  5BMV A;  3WJP A;  2G9I A;  2AMT A;  3RA5 A;  1Z5V A;  4EI7 A;  5EB1 B;  5GAP K;  1KD1 H;  3VO8 A;  4C8I A;  1TVK B;  3CC2 F;  2LBW A;  5CA1 B;  1XHO A;  3K14 A;  1VQN F;  3S06 A;  3VIU A;  2Z1F A;  3ERN A;  3CCE F;  4F6R A;  4BT7 A;  1Q86 H;  1T0K B;  4U3J B;  4YJ2 B;  4C8E A;  3ZOP A;  4B45 A;  1VQ7 F;  4XCQ A;  2IQQ A;  2RHH A;  3IR9 A;  1K8A H;  4O4L B;  3CD6 F;  5KX5 B;  1W5F A;  4BVQ A;  1YGY A;  5FNV A;  1VQM F;  1JJ2 F;  3JAL A;  2GVI A;  1X7O A;  5GIN C;  3CME F;  5JQG B;  5FLX M;  4G4Z A;  4X1Y B;  4I55 B;  3CXC F;  3OON A;  1H48 A;  3HKD B;  1YI2 F;  3C8L A;  2H8C A;  3CPQ A;  5IJ0 A;  5LA6 B;  5MN5 A;  3SIV A;  4ZHV A;  1W57 A;  4R40 B;  2UYK A;  3OBW A;  1KC8 H;  2K1S A;  5CB4 B;  1ODE A;  2HRY A;  3UT5 A;  2JNB A;  3N4Y A;  3LWP C;  3CB2 A;  3NVI B;  4G4Y A;  1FFX B;  4IIJ A;  2DYY A;  5J2U A;  5A2Q M;  3G71 F;  4BVT A;  4LNU A;  1NQ3 A;  5C8Y B;  3RE3 A;  5IT9 M;  2CHS A;  4YJ3 B;  4ZI7 A;  1QAH A;  3U0O A;  5HXU A;  1FSZ A;  3LYB A;  3RA6 A;  1JFF A;  2RHJ A;  4DXD A;  4I50 B;  1W5E A;  1VQV A;  4ZOL B;  5IJ9 A;  5GIP C;  1XV2 A;  1IV4 A;  3RYC B;  2YYE A;  2P6Y A;  3L7Q A;  1VQ5 F;  4TV9 A;  3HKC A;  5EZY B;  5MN6 A;  1TUB B;  4X3L A;  2OTL F;  3F6M A;  1VHA A;  2WAL A;  4U39 A;  5HY1 A;  2CVL A;  2QA4 F;  4BVR A;  2B33 A;  4O4I B;  4X1I B;  3KIZ A;  3MDO A;  3J80 M;  3CCM F;  3IKF A;  3CC4 F;  1TVK A;  3M84 A;  3HKE B;  3WGK A;  3NMU C;  5CA1 A;  1DBF A;  2ZOV A;  2VGN A;  2HS0 A;  2RB9 A;  3WGL A;  4U3J A;  5LOV B;  3GHZ A;  4YJ2 A;  5DCV A;  3AGK A;  5HXZ A;  1QVG F;  1VQ9 F;  3JCM M;  3WJQ A;  1YJ9 F;  4O4L A;  3RYI B;  3WPX A;  1VK3 A;  5KX5 A;  4RQO A;  3NK7 A;  5J2T B;  1RQ7 A;  2PHN A;  3K12 A;  2Z1E A;  5IYZ B;  4IHJ B;  3I55 F;  5LXT B;  4C4W C;  1M1K H;  4I55 A;  4G88 A;  5LYJ B;  3HKD A;  4HNA B;  3FD6 A;  2BTU A;  3F0D A;  5GON B;  5JCO A;  5EB0 A;  5EYP B;  2HS4 A;  2EWC A;  2VAW A;  3V7E A;  4B5C A;  5CB4 A;  4EB6 A;  1COM A;  5B8F A;  3RYF B;  1IV2 A;  3OBY A;  2UYJ A;  3E20 B;  5EIB C;  4B46 A;  1Q81 H;  4O4H B;  2Z01 A;  5G4V C;  1Q7Y H;  1R1M A;  3JAT B;  1CLI A;  2VAP A;  1W42 A;  3CG6 A;  2HVY D;  5LP6 C;  4X3M A;  1VQ8 F;  4B62 A;  4X1K B;  1PF5 A;  3E22 A;  2CWJ A;  1U3L A;  5C8Y A;  4DRX B;  2DT4 A;  3D00 A;  1K9M H;  1PXW A;  3K0T A;  3MCA B;  1W55 A;  2NMU A;  3C9S A;  3C9T A;  1VQP F;  1Q82 H;  3NVK E;  3F0G A;  1VQO F;  2Z1U A;  3CCL F;  1YHQ F;  4I50 A;  4ZOL A;  4O4J B;  5HP8 A;  3G4S F;  4I4T A;  3VOB A;  4O2A A;  1U40 A;  3RYC A;  3HJW C;  3B6N A;  1H47 A;  2AIZ P;  3F0E A;  2LCA A;  3VCZ A;  3HAX D;  3ESJ A;  1TUB A;  4ZHY B;  1GO1 A;  4EI9 A;  1W3E X;  2GZL A;  4BT4 A;  3I56 F;  4O4I A;  1NMU B;  4ZHQ A;  2QI2 A;  4X1I A;  3VYU C;  2UYN B;  1W58 1;  3MCQ A;  3HKE A;  3S0H A;  5GIO C;  3NK6 A;  1GX1 A;  1OAP A;  2HX0 A;  4TV8 B;  5LOV A;  1ZWZ A;  2YXZ A;  3M1X A;  1GZ0 A;  4G4V A;  2HP0 B;  4BW0 B;  5J2T A;  4NQ3 A;  4RHA A;  4ERH A;  3WXM B;  3LME A;  3CCS F;  1UFY A;  3ZP4 A;  3KE1 A;  3QHD A;  4IHJ A;  5IYZ A;  1NJI H;  1YJN F;  3IKE A;  3CCJ F;  5LXT A;  5EO3 A;  3CYP B;  3J81 M;  2GLZ A;  3VMF B;  5JCO C;  5LYJ A;  1H7M A;  4EI8 A;  3ELC A;  4HNA A;  2L26 A;  3F0F A;  2F9Z C;  3N2G B;  3D54 A;  5GON A;  3PAF A;  3RYH B;  1OFU A;  5EYP A;  2RHO A;  4TUY B;  3VTI C;  1T0A A;  1Q8R A;  3FBA A;  1CK2 A;  3TD4 A;  1W5A A;  2HRU A;  5ITZ B;  3RYF A;  1N8R H;  4O4H A;  3WGJ A;  2Z1T A;  1QU9 A;  3MBM A;  1IPA A;  3JAK B;  3JAT A;  2I6D A;  3JAR B;  3R0P A;  5JVD B;  5GAN K;  2UYP A;  3HKB B;  3JAW B;  3LFO A; 
#chains in the Genus database with same CATH homology
 3IKE A;  3Q8H A;  3GHZ A;  1JY8 A;  1U3P A;  4C8G A;  4C8I A;  1U43 A;  3K2X A;  2UZH A;  5B8F A;  3P10 A;  1IV2 A;  1U40 A;  3ELC A;  3T80 A;  3F0F A;  1GX1 A;  4C82 A;  3QHD A;  3B6N A;  3F6M A;  1H47 A;  3RE3 A;  1VHA A;  3F0E A;  1H48 A;  3K14 A;  1T0A A;  2PMP A;  3EOR A;  1JN1 A;  3ERN A;  3ESJ A;  3FBA A;  1YQN A;  1IV3 A;  1VH8 A;  1KNK A;  3IKF A;  1W57 A;  3KE1 A;  4C8E A;  2GZL A;  1U3L A;  3MBM A;  4C81 A;  1IV1 A;  3IEW A;  3JVH A;  1IV4 A;  1W55 A;  3F0D A;  3FPI A;  2AMT A;  3IEQ A;  3P0Z A;  3F0G A;  1KNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...