1VHKA

Crystal structure of an hypothetical protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
252
structure length
235
Chain Sequence
QRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYESAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVTCGLGPRILRTETAPLYALSAISYQTELLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqeU
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 69
structure length 235
sequence length 252
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhkA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhkA02
2EGVA 4X3MA 2V3JA 4FAKA 4CNFA 2CX8A 4KGNA 3E5YA 4YQ3A 3NK6A 1VHKA 4YQ0A 2EGWA 1Z85A 1OY5A 2HA8A 4YQSA 4XBOA 1V2XA 4CNEA 4YPZA 4YQ2A 3DCMX 4MCBA 1X7PA 4YQJA 3BBHA 1J85A 3OINA 4YVJA 4YQPA 4YVGA 1O6DA 4H3YA 4MCCA 4YQTA 1V6ZA 1MXIA 4YQ5A 3O7BA 3L8UA 2O3AA 4CNDA 5GM8A 3BBDA 4YQ6A 3QUVA 3AXZA 4YQGA 4YQKA 4YQQA 1IPAA 4H3ZA 4J3CA 1VH0A 4YQOA 4YQLA 4PZKA 4YQ4A 2QMMA 3ILKA 1K3RA 1P9PA 3KW2A 4CNGA 4YQAA 4YQNA 4YPWA 2I6DA 4YVIA 5CO4A 3IEFA 4YPYA 5FAIA 4L69A 2Z0YA 3N4JA 4RG1A 3GYQA 4YPXA 3NK7A 2QWVA 4YQ1A 2NWAA 1UAKA 1ZJRA 3KY7A 4YQ9A 5D9FA 1UAMA 1UALA 1UAJA 4YVKA 3AIAA 1X7OA 5GMBA 3ONPA 2YY8A 1VHYA 4IG6A 1NXZA 4YQ7A 4YQIA 3KTYA 3KNUA 4YQBA 4YQ8A 4YQDA 4MCDA 1GZ0A 4YQCA 4YQRA 5GMCA 3BBEA 4KDZA 4X3LA 3IC6A 1NS5A 3OIIA 4YVHA 4E8BA 4JALA 2V3KA 1TO0A 3AI9X 3OIJA 4JAKA 3N4KA
chains in the Genus database with same CATH superfamily
2RE8A 2EGVA 4X3MA 2V3JA 2PJJA 4FAKA 4JWHA 4WF9S 4CNFA 2PNWA 2CX8A 4KGNA 4WCES 5JVGS 3E5YA 4YQ3A 3NK6A 3X1LB 1VHKA 4YQ0A 2EGWA 1Z85A 1OY5A 3W2WB 2HA8A 4YQSA 4XBOA 5IZNA 4IO9S 1DFUP 1V2XA 4JWGA 4CNEA 3PIOS 4YPZA 4YQ2A 3DCMX 3PIPS 4MCBA 1B75A 1X7PA 3W2VB 4FMWA 2GAEA 4YQJA 3BBHA 1QRUA 1J85A 3OINA 5BNZA 1EUQA 4YVJA 4YQPA 4YVGA 1O6DA 4H3YA 4MCCA 4YQTA 1V6ZA 1MXIA 4YQ5A 4WFNS 3L8UA 2O3AA 3O7BA 5GM8A 4CNDA 3BBDA 4YQ6A 3QUVA 1UDXA 3AXZA 4YQGA 4JXXA 3CZBA 4YQKA 4YQQA 1IPAA 4H3ZA 2ZJPS 3CF5S 4J3CA 1VH0A 4YQOA 2RD2A 4YQLA 4V194 4P2BA 4PZKA 5GADW 2HZ7A 3AIIA 4YQ4A 2QMMA 3ILKA 4UY88 1QRTA 1K3RA 1P9PA 3KW2A 4CNGA 4YQAA 5GAHW 4YQNA 4YPWA 4JWFA 2I6DA 4YVIA 2G6GA 5JVHS 5CO4A 3IEFA 4YPYA 5FAIA 4L69A 2Z0YA 3N4JA 4RG1A 1QTQA 3GYQA 3NK7A 2QWVA 4H3SA 4H4KA 4YPXA 3J7ZV 2ZJRS 4YQ1A 1EUYA 2NWAA 1QRSA 1UAKA 5GAGW 1ZJRA 3KY7A 4IOAS 1EXDA 4YQ9A 2PI8A 5D9FA 1UAMA 1UALA 1NYLA 1D6KA 1O0CA 1UAJA 4YVKA 3AIAA 1FEUA 1X7OA 5GMBA 2PICA 3ONPA 5GAEW 2YY8A 1VHYA 5HL7S 2AE0X 4JXZA 4IG6A 1NXZA 2G5DA 4YQ7A 4YQIA 3KTYA 3KNUA 4YQBA 1O0BA 4YQ8A 4YQDA 4JWJA 4WFAS 4MCDA 4JYZA 1ZJWA 1GZ0A 5DM6S 4YQCA 4YQRA 5GMCA 1GTRA 2ZJQS 3BBEA 4KDZA 3DLLS 1GTSA 4X3LA 3IC6A 3N4KA 4U67S 1NS5A 3OIIA 5DM7S 4E8BA 4JALA 4YVHA 2V3KA 1TO0A 3AI9X 3OIJA 4WFBS 4JAKA 4IOCS
chains in the Genus database with same CATH topology
2EGVA 4X3MA 2V3JA 4FAKA 4JWHA 4CNFA 2CX8A 4KGNA 3E5YA 4YQ3A 3NK6A 1VHKA 4YQ0A 2EGWA 1Z85A 1OY5A 2HA8A 4YQSA 4XBOA 1V2XA 4JWGA 4CNEA 4YPZA 4YQ2A 3DCMX 4MCBA 1X7PA 4FMWA 4YQJA 3BBHA 1J85A 3OINA 4YVJA 4YQPA 4YVGA 1O6DA 4H3YA 4MCCA 4YQTA 1V6ZA 1MXIA 4YQ5A 3O7BA 3L8UA 2O3AA 4CNDA 5GM8A 3BBDA 4YQ6A 3QUVA 3AXZA 4YQGA 4YQKA 4YQQA 1IPAA 4H3ZA 4J3CA 1VH0A 4YQOA 4YQLA 4PZKA 4YQ4A 2QMMA 3ILKA 1K3RA 1P9PA 3KW2A 4CNGA 4YQAA 4YQNA 4YPWA 4JWFA 2I6DA 4YVIA 5CO4A 3IEFA 4YPYA 5FAIA 4L69A 2Z0YA 3N4JA 4RG1A 3GYQA 4YPXA 3NK7A 2QWVA 4YQ1A 2NWAA 1UAKA 1ZJRA 3KY7A 4YQ9A 5D9FA 1UAMA 1UALA 1UAJA 4YVKA 3AIAA 1X7OA 5GMBA 3ONPA 2YY8A 1VHYA 4IG6A 1NXZA 4YQ7A 4YQIA 3KTYA 3KNUA 4YQBA 4YQ8A 4YQDA 4JWJA 4MCDA 1GZ0A 4YQCA 4YQRA 5GMCA 3BBEA 4KDZA 4X3LA 3IC6A 1NS5A 3OIIA 4YVHA 4E8BA 4JALA 2V3KA 1TO0A 3AI9X 3OIJA 4JAKA 3N4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGV A;  4X3M A;  2V3J A;  4FAK A;  4CNF A;  2CX8 A;  4KGN A;  3E5Y A;  4YQ3 A;  3NK6 A;  1VHK A;  4YQ0 A;  2EGW A;  1Z85 A;  1OY5 A;  2HA8 A;  4YQS A;  4XBO A;  1V2X A;  4CNE A;  4YPZ A;  4YQ2 A;  3DCM X;  4MCB A;  1X7P A;  4YQJ A;  3BBH A;  1J85 A;  3OIN A;  4YVJ A;  4YQP A;  4YVG A;  1O6D A;  4H3Y A;  4MCC A;  4YQT A;  1V6Z A;  1MXI A;  4YQ5 A;  3O7B A;  3L8U A;  2O3A A;  4CND A;  5GM8 A;  3BBD A;  4YQ6 A;  3QUV A;  3AXZ A;  4YQG A;  4YQK A;  4YQQ A;  1IPA A;  4H3Z A;  4J3C A;  1VH0 A;  4YQO A;  4YQL A;  4PZK A;  4YQ4 A;  2QMM A;  3ILK A;  1K3R A;  1P9P A;  3KW2 A;  4CNG A;  4YQA A;  4YQN A;  4YPW A;  2I6D A;  4YVI A;  5CO4 A;  3IEF A;  4YPY A;  5FAI A;  4L69 A;  2Z0Y A;  3N4J A;  4RG1 A;  3GYQ A;  4YPX A;  3NK7 A;  2QWV A;  4YQ1 A;  2NWA A;  1UAK A;  1ZJR A;  3KY7 A;  4YQ9 A;  5D9F A;  1UAM A;  1UAL A;  1UAJ A;  4YVK A;  3AIA A;  1X7O A;  5GMB A;  3ONP A;  2YY8 A;  1VHY A;  4IG6 A;  1NXZ A;  4YQ7 A;  4YQI A;  3KTY A;  3KNU A;  4YQB A;  4YQ8 A;  4YQD A;  4MCD A;  1GZ0 A;  4YQC A;  4YQR A;  5GMC A;  3BBE A;  4KDZ A;  4X3L A;  3IC6 A;  1NS5 A;  3OII A;  4YVH A;  4E8B A;  4JAL A;  2V3K A;  1TO0 A;  3AI9 X;  3OIJ A;  4JAK A;  3N4K A; 
#chains in the Genus database with same CATH topology
 2RE8 A;  2EGV A;  4X3M A;  2V3J A;  2PJJ A;  4FAK A;  4JWH A;  4WF9 S;  4CNF A;  2PNW A;  2CX8 A;  4KGN A;  4WCE S;  5JVG S;  3E5Y A;  4YQ3 A;  3NK6 A;  3X1L B;  1VHK A;  4YQ0 A;  2EGW A;  1Z85 A;  1OY5 A;  3W2W B;  2HA8 A;  4YQS A;  4XBO A;  5IZN A;  4IO9 S;  1DFU P;  1V2X A;  4JWG A;  4CNE A;  3PIO S;  4YPZ A;  4YQ2 A;  3DCM X;  3PIP S;  4MCB A;  1B75 A;  1X7P A;  3W2V B;  4FMW A;  2GAE A;  4YQJ A;  3BBH A;  1QRU A;  1J85 A;  3OIN A;  5BNZ A;  1EUQ A;  4YVJ A;  4YQP A;  4YVG A;  1O6D A;  4H3Y A;  4MCC A;  4YQT A;  1V6Z A;  1MXI A;  4YQ5 A;  4WFN S;  3L8U A;  2O3A A;  3O7B A;  5GM8 A;  4CND A;  3BBD A;  4YQ6 A;  3QUV A;  1UDX A;  3AXZ A;  4YQG A;  4JXX A;  3CZB A;  4YQK A;  4YQQ A;  1IPA A;  4H3Z A;  2ZJP S;  3CF5 S;  4J3C A;  1VH0 A;  4YQO A;  2RD2 A;  4YQL A;  4V19 4;  4P2B A;  4PZK A;  5GAD W;  2HZ7 A;  3AII A;  4YQ4 A;  2QMM A;  3ILK A;  4UY8 8;  1QRT A;  1K3R A;  1P9P A;  3KW2 A;  4CNG A;  4YQA A;  5GAH W;  4YQN A;  4YPW A;  4JWF A;  2I6D A;  4YVI A;  2G6G A;  5JVH S;  5CO4 A;  3IEF A;  4YPY A;  5FAI A;  4L69 A;  2Z0Y A;  3N4J A;  4RG1 A;  1QTQ A;  3GYQ A;  3NK7 A;  2QWV A;  4H3S A;  4H4K A;  4YPX A;  3J7Z V;  2ZJR S;  4YQ1 A;  1EUY A;  2NWA A;  1QRS A;  1UAK A;  5GAG W;  1ZJR A;  3KY7 A;  4IOA S;  1EXD A;  4YQ9 A;  2PI8 A;  5D9F A;  1UAM A;  1UAL A;  1NYL A;  1D6K A;  1O0C A;  1UAJ A;  4YVK A;  3AIA A;  1FEU A;  1X7O A;  5GMB A;  2PIC A;  3ONP A;  5GAE W;  2YY8 A;  1VHY A;  5HL7 S;  2AE0 X;  4JXZ A;  4IG6 A;  1NXZ A;  2G5D A;  4YQ7 A;  4YQI A;  3KTY A;  3KNU A;  4YQB A;  1O0B A;  4YQ8 A;  4YQD A;  4JWJ A;  4WFA S;  4MCD A;  4JYZ A;  1ZJW A;  1GZ0 A;  5DM6 S;  4YQC A;  4YQR A;  5GMC A;  1GTR A;  2ZJQ S;  3BBE A;  4KDZ A;  3DLL S;  1GTS A;  4X3L A;  3IC6 A;  3N4K A;  4U67 S;  1NS5 A;  3OII A;  5DM7 S;  4E8B A;  4JAL A;  4YVH A;  2V3K A;  1TO0 A;  3AI9 X;  3OIJ A;  4WFB S;  4JAK A;  4IOC S; 
#chains in the Genus database with same CATH homology
 2EGV A;  4X3M A;  2V3J A;  4FAK A;  4JWH A;  4CNF A;  2CX8 A;  4KGN A;  3E5Y A;  4YQ3 A;  3NK6 A;  1VHK A;  4YQ0 A;  2EGW A;  1Z85 A;  1OY5 A;  2HA8 A;  4YQS A;  4XBO A;  1V2X A;  4JWG A;  4CNE A;  4YPZ A;  4YQ2 A;  3DCM X;  4MCB A;  1X7P A;  4FMW A;  4YQJ A;  3BBH A;  1J85 A;  3OIN A;  4YVJ A;  4YQP A;  4YVG A;  1O6D A;  4H3Y A;  4MCC A;  4YQT A;  1V6Z A;  1MXI A;  4YQ5 A;  3O7B A;  3L8U A;  2O3A A;  4CND A;  5GM8 A;  3BBD A;  4YQ6 A;  3QUV A;  3AXZ A;  4YQG A;  4YQK A;  4YQQ A;  1IPA A;  4H3Z A;  4J3C A;  1VH0 A;  4YQO A;  4YQL A;  4PZK A;  4YQ4 A;  2QMM A;  3ILK A;  1K3R A;  1P9P A;  3KW2 A;  4CNG A;  4YQA A;  4YQN A;  4YPW A;  4JWF A;  2I6D A;  4YVI A;  5CO4 A;  3IEF A;  4YPY A;  5FAI A;  4L69 A;  2Z0Y A;  3N4J A;  4RG1 A;  3GYQ A;  4YPX A;  3NK7 A;  2QWV A;  4YQ1 A;  2NWA A;  1UAK A;  1ZJR A;  3KY7 A;  4YQ9 A;  5D9F A;  1UAM A;  1UAL A;  1UAJ A;  4YVK A;  3AIA A;  1X7O A;  5GMB A;  3ONP A;  2YY8 A;  1VHY A;  4IG6 A;  1NXZ A;  4YQ7 A;  4YQI A;  3KTY A;  3KNU A;  4YQB A;  4YQ8 A;  4YQD A;  4JWJ A;  4MCD A;  1GZ0 A;  4YQC A;  4YQR A;  5GMC A;  3BBE A;  4KDZ A;  4X3L A;  3IC6 A;  1NS5 A;  3OII A;  4YVH A;  4E8B A;  4JAL A;  2V3K A;  1TO0 A;  3AI9 X;  3OIJ A;  4JAK A;  3N4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...