1VHKA

Crystal structure of an hypothetical protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
252
structure length
235
Chain Sequence
QRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYESAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVTCGLGPRILRTETAPLYALSAISYQTELLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqeU
total genus 69
structure length 235
sequence length 252
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhkA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhkA02
4YQSA 3OIIA 4MCBA 4YQ4A 1TO0A 1K3RA 4CNFA 3O7BA 4YQ9A 4YQKA 3IEFA 3KY7A 3GYQA 2NWAA 4YQ7A 4YQ2A 3N4KA 4H3ZA 4YPWA 4PZKA 1NS5A 2EGVA 3E5YA 4YQ3A 2V3KA 4MCDA 4XBOA 3KNUA 1O6DA 1VH0A 3NK7A 2V3JA 2O3AA 4YQTA 4YVHA 4YQ8A 2CX8A 4KGNA 3AIAA 4IG6A 4KDZA 1UALA 1ZJRA 1UAMA 4YQOA 3IC6A 5GMCA 4L69A 3L8UA 3NK6A 2YY8A 4CNEA 4YQPA 3N4JA 4YQRA 1X7OA 3DCMX 5FAIA 1OY5A 2EGWA 5D9FA 4YQ1A 1UAKA 4YPZA 4YQLA 2QMMA 2I6DA 4YQ5A 1MXIA 4CNGA 1X7PA 1UAJA 3BBEA 4YVIA 4YPXA 4YVJA 3AXZA 4X3LA 3QUVA 3KTYA 2QWVA 4FAKA 1V2XA 5GMBA 5GM8A 3BBHA 4YQDA 4YVKA 1VHKA 1GZ0A 1Z85A 3ONPA 4X3MA 3KW2A 1NXZA 4YQNA 4YQQA 2HA8A 3AI9X 4YPYA 4RG1A 2Z0YA 4YQAA 4YQCA 3ILKA 1IPAA 4J3CA 4YVGA 4YQ0A 4H3YA 4CNDA 4YQGA 4JAKA 1J85A 1V6ZA 4MCCA 4YQ6A 4YQJA 4YQIA 3BBDA 3OIJA 3OINA 5CO4A 4E8BA 1VHYA 1P9PA 4YQBA 4JALA
chains in the Genus database with same CATH superfamily
4YQSA 4UY88 3OIIA 2AE0X 4MCBA 3W2VB 4YQ4A 3J7ZV 5JVGS 3X1LB 1TO0A 1K3RA 4CNFA 3O7BA 2PNWA 4YQ9A 1D6KA 4YQKA 1EXDA 1QRUA 3IEFA 3KY7A 3GYQA 2NWAA 2GAEA 4YQ7A 4YQ2A 3N4KA 3AIIA 4H3ZA 4YPWA 4PZKA 1NS5A 2EGVA 3E5YA 4YQ3A 2V3KA 3W2WB 4MCDA 1O0CA 4XBOA 3KNUA 1O6DA 1VH0A 1NYLA 3CF5S 3NK7A 2V3JA 2O3AA 4YQTA 1DFUP 4YVHA 4YQ8A 2CX8A 4KGNA 3AIAA 4IG6A 2G5DA 4KDZA 4P2BA 1UALA 4IOAS 1ZJRA 1UAMA 4YQOA 3IC6A 5GMCA 4L69A 3L8UA 3NK6A 2YY8A 4CNEA 4JWFA 4YQPA 3N4JA 4YQRA 4WCES 1X7OA 3DCMX 5FAIA 4JXXA 4V194 1OY5A 2EGWA 1FEUA 5IZNA 5D9FA 1B75A 4YQ1A 5DM7S 1UAKA 4YPZA 4YQLA 2QMMA 2I6DA 4JWGA 4JXZA 4H3SA 4YQ5A 1QTQA 1MXIA 4CNGA 1X7PA 1UAJA 3DLLS 2G6GA 3PIOS 3BBEA 4JWJA 4YPXA 4YVJA 2PICA 4YVIA 3AXZA 4X3LA 3QUVA 3KTYA 2QWVA 4FAKA 4WFAS 3PIPS 1V2XA 5GMBA 5GM8A 4U67S 2RD2A 3BBHA 2PI8A 4YQDA 1VHKA 5GADW 4YVKA 1GZ0A 1Z85A 3ONPA 4JWHA 1NXZA 3KW2A 4X3MA 4YQNA 1O0BA 4YQQA 2PJJA 2HA8A 2RE8A 3AI9X 4YPYA 4RG1A 2Z0YA 2ZJQS 4H4KA 4YQAA 4YQCA 3ILKA 1IPAA 1GTRA 4J3CA 2ZJPS 4JALA 2HZ7A 4H3YA 4YVGA 1GTSA 4YQ0A 5GAHW 4CNDA 3CZBA 4YQGA 4JAKA 5JVHS 1EUQA 1J85A 5HL7S 1ZJWA 1V6ZA 4WF9S 4MCCA 1UDXA 4YQ6A 4YQJA 4WFNS 1QRSA 4YQIA 2ZJRS 3BBDA 3OIJA 3OINA 5CO4A 1QRTA 4E8BA 5BNZA 1VHYA 5GAEW 1EUYA 1P9PA 4FMWA 5DM6S 4IO9S 4IOCS 4YQBA 5GAGW 4WFBS 4JYZA
chains in the Genus database with same CATH topology
4YQSA 3OIIA 4MCBA 4YQ4A 1TO0A 1K3RA 4CNFA 3O7BA 4YQ9A 4YQKA 3IEFA 3KY7A 3GYQA 2NWAA 4YQ7A 4YQ2A 3N4KA 4H3ZA 4YPWA 4PZKA 1NS5A 2EGVA 3E5YA 4YQ3A 2V3KA 4MCDA 4XBOA 3KNUA 1O6DA 1VH0A 3NK7A 2V3JA 2O3AA 4YQTA 4YVHA 4YQ8A 2CX8A 4KGNA 3AIAA 4IG6A 4KDZA 1UALA 1ZJRA 1UAMA 4YQOA 3IC6A 5GMCA 4L69A 3L8UA 3NK6A 2YY8A 4CNEA 4JWFA 4YQPA 3N4JA 4YQRA 1X7OA 3DCMX 5FAIA 1OY5A 2EGWA 5D9FA 4YQ1A 1UAKA 4YPZA 4YQLA 2QMMA 2I6DA 4JWGA 4YQ5A 1MXIA 4CNGA 1X7PA 1UAJA 4JWJA 3BBEA 4YVIA 4YPXA 4YVJA 3AXZA 4X3LA 3QUVA 3KTYA 2QWVA 4FAKA 1V2XA 5GMBA 5GM8A 3BBHA 4YQDA 4YVKA 1VHKA 1GZ0A 1Z85A 3ONPA 4JWHA 3KW2A 1NXZA 4X3MA 4YQNA 4YQQA 2HA8A 3AI9X 4YPYA 4RG1A 2Z0YA 4YQAA 4YQCA 3ILKA 1IPAA 4J3CA 4YVGA 4YQ0A 4H3YA 4CNDA 4YQGA 4JAKA 1J85A 1V6ZA 4MCCA 4YQ6A 4YQJA 4YQIA 3BBDA 3OIJA 3OINA 5CO4A 4E8BA 1VHYA 1P9PA 4FMWA 4YQBA 4JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQS A;  3OII A;  4MCB A;  4YQ4 A;  1TO0 A;  1K3R A;  4CNF A;  3O7B A;  4YQ9 A;  4YQK A;  3IEF A;  3KY7 A;  3GYQ A;  2NWA A;  4YQ7 A;  4YQ2 A;  3N4K A;  4H3Z A;  4YPW A;  4PZK A;  1NS5 A;  2EGV A;  3E5Y A;  4YQ3 A;  2V3K A;  4MCD A;  4XBO A;  3KNU A;  1O6D A;  1VH0 A;  3NK7 A;  2V3J A;  2O3A A;  4YQT A;  4YVH A;  4YQ8 A;  2CX8 A;  4KGN A;  3AIA A;  4IG6 A;  4KDZ A;  1UAL A;  1ZJR A;  1UAM A;  4YQO A;  3IC6 A;  5GMC A;  4L69 A;  3L8U A;  3NK6 A;  2YY8 A;  4CNE A;  4YQP A;  3N4J A;  4YQR A;  1X7O A;  3DCM X;  5FAI A;  1OY5 A;  2EGW A;  5D9F A;  4YQ1 A;  1UAK A;  4YPZ A;  4YQL A;  2QMM A;  2I6D A;  4YQ5 A;  1MXI A;  4CNG A;  1X7P A;  1UAJ A;  3BBE A;  4YVI A;  4YPX A;  4YVJ A;  3AXZ A;  4X3L A;  3QUV A;  3KTY A;  2QWV A;  4FAK A;  1V2X A;  5GMB A;  5GM8 A;  3BBH A;  4YQD A;  4YVK A;  1VHK A;  1GZ0 A;  1Z85 A;  3ONP A;  4X3M A;  3KW2 A;  1NXZ A;  4YQN A;  4YQQ A;  2HA8 A;  3AI9 X;  4YPY A;  4RG1 A;  2Z0Y A;  4YQA A;  4YQC A;  3ILK A;  1IPA A;  4J3C A;  4YVG A;  4YQ0 A;  4H3Y A;  4CND A;  4YQG A;  4JAK A;  1J85 A;  1V6Z A;  4MCC A;  4YQ6 A;  4YQJ A;  4YQI A;  3BBD A;  3OIJ A;  3OIN A;  5CO4 A;  4E8B A;  1VHY A;  1P9P A;  4YQB A;  4JAL A; 
#chains in the Genus database with same CATH topology
 4YQS A;  4UY8 8;  3OII A;  2AE0 X;  4MCB A;  3W2V B;  4YQ4 A;  3J7Z V;  5JVG S;  3X1L B;  1TO0 A;  1K3R A;  4CNF A;  3O7B A;  2PNW A;  4YQ9 A;  1D6K A;  4YQK A;  1EXD A;  1QRU A;  3IEF A;  3KY7 A;  3GYQ A;  2NWA A;  2GAE A;  4YQ7 A;  4YQ2 A;  3N4K A;  3AII A;  4H3Z A;  4YPW A;  4PZK A;  1NS5 A;  2EGV A;  3E5Y A;  4YQ3 A;  2V3K A;  3W2W B;  4MCD A;  1O0C A;  4XBO A;  3KNU A;  1O6D A;  1VH0 A;  1NYL A;  3CF5 S;  3NK7 A;  2V3J A;  2O3A A;  4YQT A;  1DFU P;  4YVH A;  4YQ8 A;  2CX8 A;  4KGN A;  3AIA A;  4IG6 A;  2G5D A;  4KDZ A;  4P2B A;  1UAL A;  4IOA S;  1ZJR A;  1UAM A;  4YQO A;  3IC6 A;  5GMC A;  4L69 A;  3L8U A;  3NK6 A;  2YY8 A;  4CNE A;  4JWF A;  4YQP A;  3N4J A;  4YQR A;  4WCE S;  1X7O A;  3DCM X;  5FAI A;  4JXX A;  4V19 4;  1OY5 A;  2EGW A;  1FEU A;  5IZN A;  5D9F A;  1B75 A;  4YQ1 A;  5DM7 S;  1UAK A;  4YPZ A;  4YQL A;  2QMM A;  2I6D A;  4JWG A;  4JXZ A;  4H3S A;  4YQ5 A;  1QTQ A;  1MXI A;  4CNG A;  1X7P A;  1UAJ A;  3DLL S;  2G6G A;  3PIO S;  3BBE A;  4JWJ A;  4YPX A;  4YVJ A;  2PIC A;  4YVI A;  3AXZ A;  4X3L A;  3QUV A;  3KTY A;  2QWV A;  4FAK A;  4WFA S;  3PIP S;  1V2X A;  5GMB A;  5GM8 A;  4U67 S;  2RD2 A;  3BBH A;  2PI8 A;  4YQD A;  1VHK A;  5GAD W;  4YVK A;  1GZ0 A;  1Z85 A;  3ONP A;  4JWH A;  1NXZ A;  3KW2 A;  4X3M A;  4YQN A;  1O0B A;  4YQQ A;  2PJJ A;  2HA8 A;  2RE8 A;  3AI9 X;  4YPY A;  4RG1 A;  2Z0Y A;  2ZJQ S;  4H4K A;  4YQA A;  4YQC A;  3ILK A;  1IPA A;  1GTR A;  4J3C A;  2ZJP S;  4JAL A;  2HZ7 A;  4H3Y A;  4YVG A;  1GTS A;  4YQ0 A;  5GAH W;  4CND A;  3CZB A;  4YQG A;  4JAK A;  5JVH S;  1EUQ A;  1J85 A;  5HL7 S;  1ZJW A;  1V6Z A;  4WF9 S;  4MCC A;  1UDX A;  4YQ6 A;  4YQJ A;  4WFN S;  1QRS A;  4YQI A;  2ZJR S;  3BBD A;  3OIJ A;  3OIN A;  5CO4 A;  1QRT A;  4E8B A;  5BNZ A;  1VHY A;  5GAE W;  1EUY A;  1P9P A;  4FMW A;  5DM6 S;  4IO9 S;  4IOC S;  4YQB A;  5GAG W;  4WFB S;  4JYZ A; 
#chains in the Genus database with same CATH homology
 4YQS A;  3OII A;  4MCB A;  4YQ4 A;  1TO0 A;  1K3R A;  4CNF A;  3O7B A;  4YQ9 A;  4YQK A;  3IEF A;  3KY7 A;  3GYQ A;  2NWA A;  4YQ7 A;  4YQ2 A;  3N4K A;  4H3Z A;  4YPW A;  4PZK A;  1NS5 A;  2EGV A;  3E5Y A;  4YQ3 A;  2V3K A;  4MCD A;  4XBO A;  3KNU A;  1O6D A;  1VH0 A;  3NK7 A;  2V3J A;  2O3A A;  4YQT A;  4YVH A;  4YQ8 A;  2CX8 A;  4KGN A;  3AIA A;  4IG6 A;  4KDZ A;  1UAL A;  1ZJR A;  1UAM A;  4YQO A;  3IC6 A;  5GMC A;  4L69 A;  3L8U A;  3NK6 A;  2YY8 A;  4CNE A;  4JWF A;  4YQP A;  3N4J A;  4YQR A;  1X7O A;  3DCM X;  5FAI A;  1OY5 A;  2EGW A;  5D9F A;  4YQ1 A;  1UAK A;  4YPZ A;  4YQL A;  2QMM A;  2I6D A;  4JWG A;  4YQ5 A;  1MXI A;  4CNG A;  1X7P A;  1UAJ A;  4JWJ A;  3BBE A;  4YVI A;  4YPX A;  4YVJ A;  3AXZ A;  4X3L A;  3QUV A;  3KTY A;  2QWV A;  4FAK A;  1V2X A;  5GMB A;  5GM8 A;  3BBH A;  4YQD A;  4YVK A;  1VHK A;  1GZ0 A;  1Z85 A;  3ONP A;  4JWH A;  3KW2 A;  1NXZ A;  4X3M A;  4YQN A;  4YQQ A;  2HA8 A;  3AI9 X;  4YPY A;  4RG1 A;  2Z0Y A;  4YQA A;  4YQC A;  3ILK A;  1IPA A;  4J3C A;  4YVG A;  4YQ0 A;  4H3Y A;  4CND A;  4YQG A;  4JAK A;  1J85 A;  1V6Z A;  4MCC A;  4YQ6 A;  4YQJ A;  4YQI A;  3BBD A;  3OIJ A;  3OIN A;  5CO4 A;  4E8B A;  1VHY A;  1P9P A;  4FMW A;  4YQB A;  4JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...