1VHKA

Crystal structure of an hypothetical protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
252
structure length
235
Chain Sequence
QRYFIELTKQQIEEAPTFSITGEEVHHIVNVMRMNEGDQIICCSQDGFEAKCELQSVSKDKVSCLVIEWTNENRELPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYESAFSAIVSSLPKGSSLLIVFGPEGGLTEAEVERLTEQDGVTCGLGPRILRTETAPLYALSAISYQTELLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqeU
total genus 69
structure length 235
sequence length 252
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhkA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhkA02
3AIAA 3N4KA 2HA8A 3L8UA 1Z85A 3AXZA 5FAIA 4YQ6A 4YQ2A 4E8BA 3KNUA 4YQ5A 4MCBA 1VHYA 4X3MA 3NK7A 3N4JA 4YPYA 4JAKA 1J85A 3OIJA 4PZKA 3KY7A 4YQ7A 4YPWA 3OINA 3KW2A 3IC6A 4H3YA 2NWAA 4YPXA 4CNFA 1UAKA 4YQSA 1OY5A 5CO4A 3E5YA 2QWVA 2CX8A 4YQCA 4YQNA 2EGVA 5GMCA 1NS5A 1TO0A 4CNDA 1V2XA 4YQBA 4YQGA 1UAJA 4H3ZA 4YQKA 4YQ0A 4KGNA 4YVKA 3KTYA 2V3KA 3DCMX 1X7OA 2EGWA 2V3JA 1O6DA 1V6ZA 4YQLA 4YQAA 4CNEA 4CNGA 4YVJA 4YQRA 4YVHA 4YQOA 4MCDA 4YQPA 4YQDA 4YQIA 4YVIA 2YY8A 1VH0A 2QMMA 4KDZA 2I6DA 4XBOA 4YQ3A 1UAMA 4IG6A 4YQ1A 4YQQA 4YQ4A 1NXZA 4YVGA 4FAKA 1K3RA 4L69A 3OIIA 5D9FA 4RG1A 4YQJA 4X3LA 1GZ0A 5GMBA 3ONPA 4YQ8A 3ILKA 2O3AA 3O7BA 1UALA 4YPZA 3GYQA 1IPAA 1ZJRA 3BBEA 4JALA 3NK6A 5GM8A 1X7PA 2Z0YA 4YQTA 1MXIA 4MCCA 3AI9X 4J3CA 3BBDA 1VHKA 3BBHA 3IEFA 1P9PA 4YQ9A 3QUVA
chains in the Genus database with same CATH superfamily
2PICA 4JXZA 3AIAA 3N4KA 5GAGW 3J7ZV 2HA8A 3L8UA 1O0CA 1Z85A 3AXZA 4JXXA 5FAIA 4YQ6A 1UDXA 2ZJQS 2RE8A 4YQ2A 2G6GA 4E8BA 3KNUA 4JYZA 4YQ5A 4MCBA 1VHYA 4X3MA 1QTQA 3NK7A 3N4JA 1DFUP 4YPYA 2G5DA 4JAKA 1J85A 3OIJA 4PZKA 3KY7A 4YQ7A 4YPWA 1EXDA 3OINA 2GAEA 3KW2A 3IC6A 4H3YA 2NWAA 2HZ7A 4YPXA 4CNFA 1UAKA 4YQSA 1OY5A 5CO4A 4JWFA 3E5YA 2QWVA 2CX8A 1ZJWA 4YQCA 4YQNA 2EGVA 5GMCA 3W2VB 1NS5A 1D6KA 1TO0A 1QRSA 4CNDA 1V2XA 4UY88 5DM6S 4JWHA 2ZJRS 4YQBA 4YQGA 4IO9S 2RD2A 1UAJA 4H3ZA 4YQKA 4IOCS 5GAHW 5HL7S 4YQ0A 5BNZA 4KGNA 4YVKA 4WFAS 3KTYA 5IZNA 2PJJA 1X7OA 2V3KA 3DCMX 2EGWA 2V3JA 1O6DA 1V6ZA 4WFBS 3PIPS 3CZBA 3CF5S 1GTRA 1FEUA 4H4KA 4YQLA 1QRTA 4YQAA 4JWGA 4CNEA 3DLLS 4CNGA 4YQRA 4YVJA 4YVHA 4YQOA 4MCDA 4YQPA 4YQDA 4YQIA 4YVIA 5GADW 1EUYA 2YY8A 1VH0A 2QMMA 4KDZA 2I6DA 4XBOA 4YQ3A 1EUQA 1UAMA 4FMWA 4IG6A 4P2BA 4YQ1A 4IOAS 3X1LB 4U67S 4YQQA 4YQ4A 1O0BA 1NYLA 1NXZA 4YVGA 4FAKA 1GTSA 1K3RA 2AE0X 4L69A 3AIIA 2ZJPS 4V194 5JVHS 3OIIA 5D9FA 4RG1A 2PI8A 4YQJA 4X3LA 4H3SA 1QRUA 1GZ0A 5GMBA 3ONPA 5DM7S 4YQ8A 3ILKA 2O3AA 3O7BA 3W2WB 3PIOS 1UALA 4YPZA 3GYQA 5GAEW 1IPAA 1ZJRA 3BBEA 4JALA 4WCES 3NK6A 5GM8A 1X7PA 2Z0YA 4YQTA 1MXIA 4MCCA 5JVGS 2PNWA 3AI9X 4WF9S 4J3CA 3BBDA 1VHKA 3BBHA 1B75A 3IEFA 1P9PA 4JWJA 4YQ9A 3QUVA 4WFNS
chains in the Genus database with same CATH topology
3AIAA 3N4KA 2HA8A 3L8UA 1Z85A 3AXZA 5FAIA 4YQ6A 4YQ2A 4E8BA 3KNUA 4YQ5A 4MCBA 1VHYA 4X3MA 3NK7A 3N4JA 4YPYA 4JAKA 1J85A 3OIJA 4PZKA 3KY7A 4YQ7A 4YPWA 3OINA 3KW2A 3IC6A 4H3YA 2NWAA 4YPXA 4CNFA 1UAKA 4YQSA 1OY5A 5CO4A 4JWFA 3E5YA 2QWVA 2CX8A 4YQCA 4YQNA 2EGVA 5GMCA 1NS5A 1TO0A 4CNDA 1V2XA 4JWHA 4YQBA 4YQGA 1UAJA 4H3ZA 4YQKA 4YQ0A 4KGNA 4YVKA 3KTYA 2V3KA 3DCMX 1X7OA 2EGWA 2V3JA 1O6DA 1V6ZA 4YQLA 4YQAA 4JWGA 4CNEA 4CNGA 4YVJA 4YQRA 4YVHA 4YQOA 4MCDA 4YQPA 4YQDA 4YQIA 4YVIA 2YY8A 1VH0A 2QMMA 4KDZA 2I6DA 4XBOA 4YQ3A 1UAMA 4FMWA 4IG6A 4YQ1A 4YQQA 4YQ4A 1NXZA 4YVGA 4FAKA 1K3RA 4L69A 3OIIA 5D9FA 4RG1A 4YQJA 4X3LA 1GZ0A 5GMBA 3ONPA 4YQ8A 3ILKA 2O3AA 3O7BA 1UALA 4YPZA 3GYQA 1IPAA 1ZJRA 3BBEA 4JALA 3NK6A 5GM8A 1X7PA 2Z0YA 4YQTA 1MXIA 4MCCA 3AI9X 4J3CA 3BBDA 1VHKA 3BBHA 3IEFA 1P9PA 4JWJA 4YQ9A 3QUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AIA A;  3N4K A;  2HA8 A;  3L8U A;  1Z85 A;  3AXZ A;  5FAI A;  4YQ6 A;  4YQ2 A;  4E8B A;  3KNU A;  4YQ5 A;  4MCB A;  1VHY A;  4X3M A;  3NK7 A;  3N4J A;  4YPY A;  4JAK A;  1J85 A;  3OIJ A;  4PZK A;  3KY7 A;  4YQ7 A;  4YPW A;  3OIN A;  3KW2 A;  3IC6 A;  4H3Y A;  2NWA A;  4YPX A;  4CNF A;  1UAK A;  4YQS A;  1OY5 A;  5CO4 A;  3E5Y A;  2QWV A;  2CX8 A;  4YQC A;  4YQN A;  2EGV A;  5GMC A;  1NS5 A;  1TO0 A;  4CND A;  1V2X A;  4YQB A;  4YQG A;  1UAJ A;  4H3Z A;  4YQK A;  4YQ0 A;  4KGN A;  4YVK A;  3KTY A;  2V3K A;  3DCM X;  1X7O A;  2EGW A;  2V3J A;  1O6D A;  1V6Z A;  4YQL A;  4YQA A;  4CNE A;  4CNG A;  4YVJ A;  4YQR A;  4YVH A;  4YQO A;  4MCD A;  4YQP A;  4YQD A;  4YQI A;  4YVI A;  2YY8 A;  1VH0 A;  2QMM A;  4KDZ A;  2I6D A;  4XBO A;  4YQ3 A;  1UAM A;  4IG6 A;  4YQ1 A;  4YQQ A;  4YQ4 A;  1NXZ A;  4YVG A;  4FAK A;  1K3R A;  4L69 A;  3OII A;  5D9F A;  4RG1 A;  4YQJ A;  4X3L A;  1GZ0 A;  5GMB A;  3ONP A;  4YQ8 A;  3ILK A;  2O3A A;  3O7B A;  1UAL A;  4YPZ A;  3GYQ A;  1IPA A;  1ZJR A;  3BBE A;  4JAL A;  3NK6 A;  5GM8 A;  1X7P A;  2Z0Y A;  4YQT A;  1MXI A;  4MCC A;  3AI9 X;  4J3C A;  3BBD A;  1VHK A;  3BBH A;  3IEF A;  1P9P A;  4YQ9 A;  3QUV A; 
#chains in the Genus database with same CATH topology
 2PIC A;  4JXZ A;  3AIA A;  3N4K A;  5GAG W;  3J7Z V;  2HA8 A;  3L8U A;  1O0C A;  1Z85 A;  3AXZ A;  4JXX A;  5FAI A;  4YQ6 A;  1UDX A;  2ZJQ S;  2RE8 A;  4YQ2 A;  2G6G A;  4E8B A;  3KNU A;  4JYZ A;  4YQ5 A;  4MCB A;  1VHY A;  4X3M A;  1QTQ A;  3NK7 A;  3N4J A;  1DFU P;  4YPY A;  2G5D A;  4JAK A;  1J85 A;  3OIJ A;  4PZK A;  3KY7 A;  4YQ7 A;  4YPW A;  1EXD A;  3OIN A;  2GAE A;  3KW2 A;  3IC6 A;  4H3Y A;  2NWA A;  2HZ7 A;  4YPX A;  4CNF A;  1UAK A;  4YQS A;  1OY5 A;  5CO4 A;  4JWF A;  3E5Y A;  2QWV A;  2CX8 A;  1ZJW A;  4YQC A;  4YQN A;  2EGV A;  5GMC A;  3W2V B;  1NS5 A;  1D6K A;  1TO0 A;  1QRS A;  4CND A;  1V2X A;  4UY8 8;  5DM6 S;  4JWH A;  2ZJR S;  4YQB A;  4YQG A;  4IO9 S;  2RD2 A;  1UAJ A;  4H3Z A;  4YQK A;  4IOC S;  5GAH W;  5HL7 S;  4YQ0 A;  5BNZ A;  4KGN A;  4YVK A;  4WFA S;  3KTY A;  5IZN A;  2PJJ A;  1X7O A;  2V3K A;  3DCM X;  2EGW A;  2V3J A;  1O6D A;  1V6Z A;  4WFB S;  3PIP S;  3CZB A;  3CF5 S;  1GTR A;  1FEU A;  4H4K A;  4YQL A;  1QRT A;  4YQA A;  4JWG A;  4CNE A;  3DLL S;  4CNG A;  4YQR A;  4YVJ A;  4YVH A;  4YQO A;  4MCD A;  4YQP A;  4YQD A;  4YQI A;  4YVI A;  5GAD W;  1EUY A;  2YY8 A;  1VH0 A;  2QMM A;  4KDZ A;  2I6D A;  4XBO A;  4YQ3 A;  1EUQ A;  1UAM A;  4FMW A;  4IG6 A;  4P2B A;  4YQ1 A;  4IOA S;  3X1L B;  4U67 S;  4YQQ A;  4YQ4 A;  1O0B A;  1NYL A;  1NXZ A;  4YVG A;  4FAK A;  1GTS A;  1K3R A;  2AE0 X;  4L69 A;  3AII A;  2ZJP S;  4V19 4;  5JVH S;  3OII A;  5D9F A;  4RG1 A;  2PI8 A;  4YQJ A;  4X3L A;  4H3S A;  1QRU A;  1GZ0 A;  5GMB A;  3ONP A;  5DM7 S;  4YQ8 A;  3ILK A;  2O3A A;  3O7B A;  3W2W B;  3PIO S;  1UAL A;  4YPZ A;  3GYQ A;  5GAE W;  1IPA A;  1ZJR A;  3BBE A;  4JAL A;  4WCE S;  3NK6 A;  5GM8 A;  1X7P A;  2Z0Y A;  4YQT A;  1MXI A;  4MCC A;  5JVG S;  2PNW A;  3AI9 X;  4WF9 S;  4J3C A;  3BBD A;  1VHK A;  3BBH A;  1B75 A;  3IEF A;  1P9P A;  4JWJ A;  4YQ9 A;  3QUV A;  4WFN S; 
#chains in the Genus database with same CATH homology
 3AIA A;  3N4K A;  2HA8 A;  3L8U A;  1Z85 A;  3AXZ A;  5FAI A;  4YQ6 A;  4YQ2 A;  4E8B A;  3KNU A;  4YQ5 A;  4MCB A;  1VHY A;  4X3M A;  3NK7 A;  3N4J A;  4YPY A;  4JAK A;  1J85 A;  3OIJ A;  4PZK A;  3KY7 A;  4YQ7 A;  4YPW A;  3OIN A;  3KW2 A;  3IC6 A;  4H3Y A;  2NWA A;  4YPX A;  4CNF A;  1UAK A;  4YQS A;  1OY5 A;  5CO4 A;  4JWF A;  3E5Y A;  2QWV A;  2CX8 A;  4YQC A;  4YQN A;  2EGV A;  5GMC A;  1NS5 A;  1TO0 A;  4CND A;  1V2X A;  4JWH A;  4YQB A;  4YQG A;  1UAJ A;  4H3Z A;  4YQK A;  4YQ0 A;  4KGN A;  4YVK A;  3KTY A;  2V3K A;  3DCM X;  1X7O A;  2EGW A;  2V3J A;  1O6D A;  1V6Z A;  4YQL A;  4YQA A;  4JWG A;  4CNE A;  4CNG A;  4YVJ A;  4YQR A;  4YVH A;  4YQO A;  4MCD A;  4YQP A;  4YQD A;  4YQI A;  4YVI A;  2YY8 A;  1VH0 A;  2QMM A;  4KDZ A;  2I6D A;  4XBO A;  4YQ3 A;  1UAM A;  4FMW A;  4IG6 A;  4YQ1 A;  4YQQ A;  4YQ4 A;  1NXZ A;  4YVG A;  4FAK A;  1K3R A;  4L69 A;  3OII A;  5D9F A;  4RG1 A;  4YQJ A;  4X3L A;  1GZ0 A;  5GMB A;  3ONP A;  4YQ8 A;  3ILK A;  2O3A A;  3O7B A;  1UAL A;  4YPZ A;  3GYQ A;  1IPA A;  1ZJR A;  3BBE A;  4JAL A;  3NK6 A;  5GM8 A;  1X7P A;  2Z0Y A;  4YQT A;  1MXI A;  4MCC A;  3AI9 X;  4J3C A;  3BBD A;  1VHK A;  3BBH A;  3IEF A;  1P9P A;  4JWJ A;  4YQ9 A;  3QUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...