1VHPA

Vh-p8, nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
117
structure length
117
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKEREIVSAVSGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLKKYAFDYWGQGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VH-P8
publication title Rearrangement of the former VL interface in the solution structure of a camelised, single antibody VH domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 12
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 1996-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vhpA00
1YQVL 1KCUL 4KI5F 1NMBL 1CICD 3LKPA 3TWCL 1HILA 2HMIC 4GKOA 5J13C 2FGWH 3BJ91 3CXHJ 4JRXE 3B4NA 4DW2L 4LLAA 5E2WL 3EOBB 1UACL 1UB5B 5JXAL 2NMSA 3S36X 1BF8A 5E94B 5B8CA 1G9NH 1FAIH 2AS5M 2V7HB 2A6KB 3WXVL 3DXAB 2ORBL 1JV5B 4N0YH 3UJJH 1B0WA 3QIWA 1YECL 2IBZX 3ARWA 1FORH 4KKAD 1NFDB 4LPWA 2EKJA 1ZLWH 1FL3A 4HWNA 4DWHA 3S37X 5FECA 1CLCA 1OSZA 1YEJL 4LLWA 4L4VE 3JTTB 1YN6B 2VO5A 4NCC1 2PXYC 4LIQH 4NQDD 5JHDD 5EO1B 1TPXB 3ZKSD 1LE5A 3QFJE 1U8PB 3BH8A 5C9KA 5E6YA 3JV6A 5E6ID 4XPHH 3X14B 5HVHC 2J5LC 4ODSL 2D3VA 1A5FH 1V3KA 2DL2A 3FB5B 4L1HA 4LCWB 3BKJL 2HH0H 4KKAC 3EJJX 3EYVA 3REVB 1T6VN 1EXUA 5I71B 2NY0D 1A6AB 4QXUH 4ZFFB 1N0LA 1WV7T 5CHNB 1KLFA 2ZSWB 4NPYB 4QHUB 5IKCA 4X6CA 4CRPA 1WVZA 1P4LB 5DD1H 3QZWB 4M61B 4RISL 3QNXB 4P57A 1DEEB 4G9FA 4GMTL 1XEDA 5E6IC 3KGRA 5GJSH 5BO1L 3Q1SL 3G5YA 5F7KC 3TIEA 4Q0XL 3HAEG 4BZ1H 2VDQH 1DFBH 3ARXA 3FO9A 2R2BB 2JIXD 1IGFH 5TQ0H 1JE6A 3VMNA 1UADC 3M17B 1KJ2H 1J5OL 5FHBH 1TQCC 3VA2C 2VDKL 3QNYA 4NFCA 1JVKA 4Y7MA 3O0RH 3R06A 4NCC2 3TV3H 5E08L 1DBKL 3FO1A 4TUKL 2J88L 4MQ7B 1EPFA 2VH5L 4M7ZC 4KZEH 4HK0B 1TTGA 5J1TC 2GJ6E 4EVNB 3O4LE 5AEAA 2N1KA 5IFAL 3RAJH 2J6EH 1YEHH 1KOAA 1NKRA 2V2WA 4LCYB 3BD5A 2DQTL 1J0IA 4OBRA 2JB5H 4LDOB 5D5MF 4XCYB 3S34H 3GUTB 3QJFA 3T2OA 4D9RD 2GW5A 4LLVB 5LBSH 3LS4H 5M94B 1CDYA 1HYSD 4HS3A 1QOKA 2H41A 1J1PH 7CGTA 2KZWA 3OPZH 1ZLUH 3WO3B 3NVQA 2ZG3A 4OUUB 2XXMB 3SDCA 1QFWL 3K2UL 1JHKL 4PJ7F 3SGJA 1U42A 3K1KC 4PY7B 1S7QB 1MY7A 3L3JB 4LCUB 4X0KB 5EUOF 3BIAX 3NGBC 5IB4B 4M03A 4PLOB 4NQXA 1D5ZB 5IWLA 4OB5H 4DQOL 2HJLB 1NL0L 1W72L 5C2UB 3L5WB 3GI9H 4I48A 4M6ML 2YPLA 4ZODA 3ZSSA 4L3CA 4JQVA 2A9NH 3HAEB 5E00B 1C8PA 1G6RH 3SE9H 2XNAB 3LRSB 5E4EB 4YE4H 5DD0H 5HVHB 1HYSC 3BPOC 1IFHL 2JJSA 4TNWK 5IR1B 1Z3GL 1KT2B 3RZCB 2J5LB 1QSEB 5CP7B 1EAJA 1OGAB 4XRCA 3K74B 1AJ7L 2AERT 2FWOA 5FCSH 4MQTB 3QIWD 1YYMH 3NH7H 4C54A 4UT9L 2Y25A 1CGUA 4K23L 4HBCH 5C0CB 3G5VA 3GHBL 1A6WH 4JKWA 4PRDA 2OK0H 3FB6B 1UWXH 1NANH 2QKIB 2ZCLL 2FECL 1UKTA 2RJMA 2YN5A 4J3OC 2QV2A 5JDJA 2OL3B 5CKAA 4RFNC 3C8HA 3CK0L 2Y72A 1AGFB 3T0XA 1BQSA 3NCFB 1MFDL 3A6CH 4X5WB 2YMXH 4U6TA 4KH2A 5MEQA 3FOMA 1QTYT 3G6DH 3BVNB 3M45A 1ZHLA 4YIQB 1DBAH 1KIRB 4KTEH 5B8CC 3U79A 5IW6B 2P5EA 4ZTPL 43CAB 4LKXB 2D0GA 3QIWC 4WDIA 4Z7VE 2Z93A 4QLRA 5I8OH 4HUXA 3SKMA 1EV2E 1U3HA 5FAAA 2M8XA 4V2CB 2W9LA 3JUZA 4GRWE 4EJ1C 2VC2L 1QFUL 3KYNA 5HGDB 4JY5H 4NCDA 5I8CA 4FQXA 4FFWD 2FX7H 1ETZB 5D93C 3BOVA 3G6JA 4GW1A 5EORL 4J3XA 2IANA 2WUCH 5D2NA 3EYUL 3QNZB 1FL5A 3P2TA 4JHWL 4HK3N 4HWEL 4NO3B 4WTZA 4Y4FB 2P8MA 5C07A 4MD5B 4IMLA 3C60B 1VFMA 4H5SA 4PJXE 4NNXB 4PYGA 4Y16A 2QQNL 1ACYL 5JUEL 4EIGB 4U7KA 4QCIB 1BZ9A 4NQED 2VN7A 1UM6H 5FO8A 4P5TA 4HIXL 2EDJA 8FABB 4V1DB 4OTXH 4FFWC 3QDGA 3UO1L 4HMCA 4OIBA 4EXKA 5E5MB 5JHDE 5I1JL 1MJJB 1NJ9A 4YLQT 5DC0A 2ZUTA 1OTTD 2VWEE 5FO7A 2VLMD 2GAZA 2VZSA 3O6ML 1YEKH 3RPKA 5HYIA 1JWUA 4FQCL 2BY3A 1Q72L 4FFYH 3MJGX 3SDCD 4XC1L 3LIZH 4ZUUA 4NKOB 3NPSB 4GAYA 1A1MB 4OLVH 4QHLB 3FQWA 4HKJA 1QQDA 1ZVYA 2HG5B 1DANT 1BD2E 2H45A 4NZDA 1BBJA 3ARFA 1WICA 1N7MH 5DWUH 2VITB 1JZ6A 1TTUA 3RGVB 1KB5A 2IF7A 4UQ2B 2OP4H 4WO4B 1UYWL 5FKPA 4FA8A 2YPLD 4U2ZA 4OCWH 3IFNH 1J11A 5MENE 1MRDH 4ZUSA 5L2JA 1JYNA 3N1QC 1M71B 5IT2L 3ZSTA 1JMXA 1H3PH 4D3CL 4NSKB 4HKXB 5BMFL 1NUNB 2FJGA 4KVCH 3SDCC 4Y5VB 2C1OA 3LAFA 4TTDC 4WJ5B 3H9ZA 4HEME 1INQA 4J3TA 1JWMB 3PABB 1Y6KR 2IH3A 5CZXD 5CGYD 1QLRA 1TQBC 4G8EA 2IADA 3TFKD 5F3HA 1YEIL 2Z91B 1I1AB 2C3VB 2CXKA 2ILLA 4U1IB 4POZD 3GMMB 1S7SA 5IOPB 4LKCA 3TZVA 4J4PA 4JQVC 3F58H 2B0SL 2OZ4A 3HC4H 3I02B 2E6QA 4NQTA 4NQCA 2P47B 4Z76B 3TWCH 3OXSA 4ZYKA 2EE3A 4LCCC 2Y36L 3KPLB 2Z4QB 4MLIA 2VAAA 5J1AA 4C4KT 5CZXC 1HSAA 5CGYC 5FA4B 3T2NH 3DO3A 1KIQA 3VD5A 3TFKC 5HHPB 4LEXH 1U3HD 1BMGA 4S0TD 2C26A 4MJ6A 5J11C 4POZC 4Y5XB 5D96B 4AEHL 1DLFH 3KS0H 4O00A 4NKMB 4XX1E 4RIRB 4S10A 1JP5A 1A9EA 4FQXD 3L3IA 4D0CA 3P11L 1BVLB 2F5BH 2WP3O 4F3FB 3B5HA 4HWZB 5MEPA 3HMXA 4G42B 4MJIE 5GIRA 1XGUB 4XPGH 4PJEB 1WAAA 4R7DB 5DA0B 4ZUTB 3GJFH 3GDBA 1L6ZA 4G9DB 1BFOA 5HYJE 4KDVA 4FXLA 5C07D 1LD9B 1NC4B 3VH8A 1MFAH 3WIIH 3ZHLA 3IS1X 5D5MB 3O6FC 1U3HC 4B41A 4XH2A 1TNNA 5GSVA 5F89A 4OQTA 1U8OA 3M8OH 2Q76A 5ID1B 1BM3L 1AXTL 3VG9C 1QR1A 3BFOA 4P5TD 4WGWB 3QQ4A 1GCFA 4CVZA 5IJVA 1T2QH 1U8IA 3H3KA 5SWZB 1CK0H 3ECBB 3QDGD 5D7SL 3VRLF 3OMZA 1KFAH 1OPGL 4WENB 1AI1H 5D2NC 1IGCH 1M7IA 1RZJL 5JW4R 1JTOA 5JNYA 1XF4A 1KUMA 1JGVL 3VFRA 1MCWM 1R0AL 2DM2A 3DX8B 3QBTB 3LKRB 1K6QL 3HNTL 2UZIL 3IDJB 4EN3B 2YA2A 5DC4B 1S7RA 1RZ8A 4WV1A 3LQAH 1SM3H 3BQUB 1MFNA 1B2WL 3L7FA 5HHOA 5FHAL 3MV9B 4RGNE 5EZJA 2IG2H 1MFBL 1P84K 2I5YL 3OAYH 1T21B 1CL7L 5JQ6H 4JM4L 5CKGA 3KYKH 1TQBB 2V5SA 2NY6B 5IVZB 2C9AA 2Z92B 3MLWL 4R0LA 1AGDA 1BJ8A 2Y06L 3S36H 2VDKH 5FV2A 5A2KH 1NPUA 1R3JA 3ZKXB 4OKDA 3LRHA 3ARFD 1FVEA 2FBJH 3QQ3A 2EH8H 4QHKI 3K4ZA 4U1NB 2DTSA 5CIPA 5HDQL 2A6DB 4G9FE 1S9VA 2BCKA 4MNGB 4PLJD 3GMNB 1ZT1B 3V5KA 1K8DB 3L3DB 5DUPL 4MMZC 3EOTL 2NZ9D 4P2OB 3TBTB 4I18C 3QPXL 4BA8A 2SEBB 3RUGE 4TOYL 1X5YA 3EUUA 4NWTL 1D5BA 4M5ZH 4XBGA 2Y23A 3CFIC 3TA3B 5DXWA 3GM8A 5D1ZB 3DSNA 1EVUA 2ZG2A 4WHDA 4O2CA 1HNFA 2PTVA 4OD2B 4P2CG 2FDBP 4ODVL 2M2DA 4RFEB 4Z0BL 3FCTA 5DHVB 4WW1B 5SV3A 1TETH 5K9KA 5A40E 4L8DB 2EDQA 3ARFC 4LLUB 5KZCB 4WGVB 4UAOC 2IPUK 5I8KL 1MCBA 5A1AA 3H3PL 2FX9H 2W38A 2X4RA 4LDEB 3TZVD 3D69A 1YPZF 1WWBX 4PLJC 3MCLL 3TPKA 4JVPA 3D3VB 4X9IA 5LAXA 4GG8B 2NZ9C 2BNQA 2R23A 2DN7A 2F53D 4NQCD 3OGCB 4NYLB 1D3CA 4MCYB 2J8HA 5ISZB 1RJYB 1Z3GH 5I30L 1F13A 4NZRL 2VDOH 2MFNA 2VDPL 3O4OC 1R6VA 3O6FB 3V6OA 5E95B 4KWUA 4OSUH 1UEYA 1KJVA 4PGCA 1G9ML 3ZT7A 1IGYA 3UCRA 3B43A 1XR8A 4M9PA 5D70L 1EFQA 3TZVC 1EEUA 1U92B 4NM4H 4OGXL 3IKKA 3CC5A 1V7NH 5C8JB 1BVKA 3UPRA 1H0DB 4NKDB 4Y4KA 3SKJH 3C2SA 1NQBA 4H1LG 2J8UE 3MLUH 3CK0H 1PKQA 1HYRC 3UPCA 3BAEL 3NIGE 4Z7WF 3MJ7A 1W2KT 1AKJA 4LAQH 1T1YA 3V5HA 3UZVB 5EBMB 4L8CA 4JHAL 1Q38A 25C8L 2G60L 3LEVL 1NUFA 1OVZA 4OM1H 3KWWA 3OXRA 1MNUL 1BWMA 3T0VA 5JTWA 5BV7H 1IAOB 3BH9B 3HE6A 2MJWA 1MVUB 2KH2B 4C57C 3ILQD 3B9KB 3HRPA 3P30L 4L4TE 4JZNB 5GGTL 2VC2H 2FHBA 2VYRE 1FGVH 1FVCB 3MCKA 3S5LA 5LWYH 2CIKB 2IQAB 4JY6B 4QOKB 2WIIB 2PCPA 3T2PA 5EORH 3EO1A 3VFNB 5DI8A 3UAJD 4ZQKA 4LHQB 1MCWW 3GMQB 4PREA 1JUFA 4I18B 3R0NA 3JV4B 4GQ9H 3TJEH 5EC1B 3N9GL 5CBAB 2E9WA 1N6QL 5EIVA 1A3RL 1QFPA 5C0IA 2P5EE 3UTTA 4FNLL 4PR5A 5F7YC 1WC7B 2ICCA 3LN9A 2FEDC 1KPRB 2R4RH 2B1HL 2BC4A 4MA8L 1DP0A 3WUWB 3VGAC 1HQ4A 2A9ML 5KANI 3HFML 1FZKA 1A1NB 3ILQC 4JO1L 4LLDA 1TTFA 1FNSH 4OLYH 3DLQR 1WITA 4O51B 5CEXA 5D7KE 3MLVH 4KHTL 4HLZH 4ETYA 4KDWA 5FF6B 1CQKA 3G6JE 4J6RL 3IFLL 2LTQB 4D8PA 4F7CA 1ZANH 3UAJC 5TPWL 2IANE 4U7SA 2E7LA 2HVKB 2NY1B 3BKML 4R3SB 4YXKL 3EOBA 1JMZA 3ZYIA 5JHLH 1FO0A 1I9RL 4NQVB 2OJZH 1FSKC 2GY5A 5EOCL 4WV1C 2YUVA 3EOAB 4KTYA 2B4CC 1K85A 4Q7DA 4Z77A 5I2IB 3IDIA 3O3AA 4PG2A 3BI9X 4HX1B 4HT1L 3OGOE 1N6VA 5HJ3B 1SYVA 1DUYA 4XVUD 3NFSH 1XGQA 4G8GB 4U1MB 3QJHA 4R0LC 3U0TB 3HC3L 3P4LA 5IHBA 3Q0HA 5DDHB 2JK5A 2CUHA 3CXDH 2PO6A 2W0PA 4IHOA 5CD5D 5I19L 5L7XL 4G80A 2HVJB 3BKCH 3PWJB 3MXWH 2EDRA 1ZHBB 3AAZB 4ZXBB 3UJTL 5CJ8A 3SGEH 4QT5A 2VUYA 3X14A 3SJVA 3KYOA 3CVHL 1MUJA 1I4FB 4GLRH 5D6CA 5HTSA 1P7QB 2BNQD 3S4SB 3NFPA 1GC1H 4X7TB 3V4UL 5F70A 1MCSA 4G7VL 4X6BA 2EIBA 1LK3H 2Z8VC 4JFDA 4BFEA 1U93A 4D3CH 2BOBA 4MD0A 1QFWI 1AGCA 5D9SA 5DURB 1PVHA 1AE6H 4XVUC 1CXEA 5ESAA 1QACA 3JWDC 1JNHA 1R5WB 4YHYC 1J10A 4ODWA 4XWGL 3SKNB 3RPIA 2VDLL 3AXLA 3OHXA 3MV8A 4OF0A 2G9HB 3WHXA 5CD5C 3P9MB 5F97E 4WU7A 1WEJL 4M61A 2R2EB 5EO9B 2DL9A 3VW3H 4PJDF 3WFBH 5K9OB 3NABH 1FLTX 4UB0H 2ITCA 1NBYB 4OM0L 1C12B 2AK4E 4Y4KD 4YHZL 3GSVA 1TCRA 1ZA6A 1AD0A 2PR4L 5I1AA 1GRWA 5D4QA 5DJYB 5JOFA 4K7FB 4AEFA 4P2RE 2EYSA 5KN5B 2GI7A 1AKJD 1FNHA 3L7EB 4PS4L 1W0VB 3QA3A 1UXSB 5T3ZH 4ODXA 3W9DA 4X7DC 4MX7A 4U1LB 1EAPA 3VGAB 3HUJB 1K2DA 3HE6D 1CIUA 2WIMA 4WFHE 3MACH 1MJUH 2WQ8A 1A0QL 1AD9A 4E42B 2Q86B 3H9YA 1TZGL 1KTKE 2FECI 4LCYA 4DTGH 3FQNA 2E8YA 4XCYA 4Y4KC 5FM5M 3WFZA 5HD8D 3GSRB 5AZ2L 2Q8BL 3T0EB 3P11H 5D7JA 3CX2A 4HUVA 3Q6GL 3HC0A 1J1OL 4PRPE 2ZJSL 2QHLA 3OR7A 2CLZA 4M6OL 4UV7H 5IVXB 3S35X 2XT1B 5D2LA 1ZT7B 2H2SC 1A6UL 3UTTD 4LBEB 3LSOA 2L0DA 3IETA 3DX9B 2DD8H 3H3BC 3QUXB 2OBGA 4NQUA 3VI3F 3HE6C 3IXAA 4MSWA 1VGEH 4OBSA 2MTPA 1RJCA 5DLML 2WWKO 2BOCB 5DEGB 1H8OA 1EMTL 1HH9A 3GHEL 1MF2L 3RBSA 5AG9A 1D5MB 2YD4A 3WN5C 1HHIA 3HAEA 4P9HC 3VJ6A 4KI1A 5HD8C 2JTDA 4U33A 2LVEA 3LRSA 2E6JA 2OM5A 4JQIH 3BPCB 1D6VH 3K4AA 2F58H 1OPGH 4XVSH 3W9EB 1U8NB 2XZZA 1NAMB 5CP7A 3O6LL 4KUCD 5IHUH 5L2KB 1TDQA 3EFFB 5JR1L 3VWJA 4LSQL 1S3KL 4MA7L 4JFZH 4XAWL 2PTTB 1R0AH 2PF6A 4RWHA 1TZIB 2X5PA 3Q3GA 1R5IB 5HXMA 1UVQB 2FO4A 3C5SB 1YEDB 2XQYK 1MFBH 4KAQH 1EK3A 4PGBA 2GT9B 2PO6D 3JWOL 4OKVA 5DRXB 2VL5B 3PWVB 3MLSL 3VFVA 4O58H 1BFSA 5I1EL 1MFCH 4XZUB 2EYTB 4MXWH 4DAGL 4LSPL 3SJVD 3T3ME 4LOUD 4H20L 1HDMA 1VPOL 3ZTNH 3PDGA 3VFSB 2XA3A 1AP2B 3FRUA 4YIQA 1KIRA 5IW6A 3ARDD 3I3EA 4LKXA 5T3XL 4G43A 3NIDE 2EO9A 4JFDD 3ULUE 3P3YA 3RWFB 4TOYH 1UH4A 4A2LA 4NWTH 5HHOE 1I8KB 1Q0YL 4PTUB 4ODUA 1U8QB 3MRHB 5LGKA 5FUOH 2Q3ZA 1I3UA 3U30B 1RZIA 1QRNA 2C4FT 5HGDA 3FQTB 2PO6C 3MV8D 3WFDH 1E4WH 5F7WC 4M1CD 3L1OL 2H6PA 4WFEE 3RY5A 4E41E 1T5XB 3GB7B 1RK1B 1UJ3C 2JCCB 5BS0E 5DEFB 2OL3L 2QQKL 3UC0H 3QNZA 4LOUC 4L8SC 5EOQH 1BEYH 3DVNA 4GW4B 4XPBL 3C5JA 3V79C 3BW9A 1QBMH 3ARDC 2ZOKA 3BWUC 3DTXB 4MD5A 3WBDA 3ARED 2VQ1B 3L5XL 1ZWIA 4NNXA 4H26A 4GH7B 3HR5B 1NSNH 1YJDC 3T1FB 4BQCA 2H26B 3GSOA 3BN3B 3P9WB 4RGMC 3BP6A 4JO2H 5GRJH 5TE7H 3OF6D 8FABA 2IAMA 5I73B 4M1CC 1MCDA 3WFEH 1ZSDB 4YPGA 1UKQA 3DRTB 4Y5YC 1S5IH 5F1NB 4L5FH 4U6VL 4X6FB 1PG7X 4OGZA 2Y6SD 1AQKH 5D70H 3VI4F 5HHQA 3WKML 3V4VL 5D7JD 3AREC 3GRWH 4HF5L 1KLUB 4X99A 3UTSB 1GOGA 5L9DL 2DKMA 2HT4D 2JELL 3PWNA 4UDTA 3RVTD 4NKOA 3FN3A 5T5FL 4U3XA 2NY4D 2ZUQB 3CH1A 3TCLB 1WWWX 4FQLL 2PW2A 3FO0L 2G60H 3V6OE 2YD8A 2XN9A 2V2TA 3ZDXF 1MNUH 1VADA 2R56L 3AFLA 3VFUA 5IEHA 1JZ4A 1JN6A 1P2CA 4WO4A 5FKAA 3UBXG 4JVWA 3L9RB 6FABL 5CILL 2Y6SC 3LS5L 1MPAL 1DN2A 2FX8H 2P24A 5D7JC 2N4IA 5DZNA 3FAXA 2UWEF 1A3LL 2Z31B 2MCPL 3V7AE 1T2JA 1T22B 2RCSL 2HT4C 2NLJA 2Q6WB 3VWJD 4FTVE 3ZL4H 2XRAL 3WD5H 2NY4C 1PX3A 2VIRA 1CF8L 43C9B 3WSQH 3C9NA 3D25B 4KK9D 4KZDL 1I1AA 1T0MB 3IRPX 5CEZD 4A6YH 4IBLT 4S2SB 2X4PA 2ERJC 2OMNA 5FYLL 4O9HH 5IOPA 4JGJA 4N0UB 1C5DB 4NZJA 4FP8H 3QFDB 3L6FB 4F9LA 2OSLB 4YXLH 4DOHB 3DOSA 4B53A 5E56A 4JANB 1S7XB 4G6AD 4Z76A 5DYOB 1V7ML 3RI5F 3B2UD 1F97A 1QBAA 4XP4L 4YHNA 5H37H 1J1XH 5CFHA 3P0VL 3ZE0E 4LPTA 3VRIB 1JFQL 1ZXQA 4OD1H 3W0WE 1OF2B 4KVNL 1OP5K 5EOCH 4KK9C 3GK8H 5EULV 3UTTE 1YDPA 1IZJA 1I3GH 2EE9A 5GS0D 4WNQA 4JEGB 4YGAB 4RGMB 1CL7I 2P5WE 3NFNA 1FP5A 1O0VA 2AK1H 1KENH 1F02I 1QRND 3MNWA 4S1SL 4TPRH 3KPOB 5CJBA 1MCPH 1EEZB 1UM4L 5CJ5A 3MNVA 4O4YL 3HC3H 1FIGH 1CFTA 4CBPA 1N2RB 4HWZA 4Z7UB 3MA9H 3MRNB 2LAGB 5A16B 4X7SH 5BVJA 3P73B 1RURL 4B0MM 3DIFA 2Q7NA 3PNWA 4I0CC 5HI3C 4G9DA 4LPYA 4O2FB 4ZOCA 2MKWA 4H8WC 1N64L 2DQCL 1JRHL 3MRRA 5EOTA 3QEQD 1MCNA 1PAMA 2VXSL 5D5MA 5D7LD 1AR2A 1OTUC 3QH3B 1NFDE 5GS0C 3D85A 2OR7A 3NZHL 1TIUA 1GGIL 2DQUH 1DJSA 4UQ3B 4NO0A 2VR4A 3OR6B 5IB2B 3U7WH 2W92A 2XXCB 4ZUVB 1AIFA 4OJFL 1LO2L 3ECBA 4YFDB 3QT2A 2IAMD 4PJ7A 4KJYB 5JW5A 2DM7A 3V95A 4XHJD 2FLRT 1YEEL 1PGRB 2DI7A 4F7PA 4OLWH 2XTLA 5EUOA 1LO3L 1JPFB 4KTDL 4OLXL 4J1UB 2CUMA 5TQ2H 3L3KA 2ZSVB 4NO5B 1UH3A 3JV0A 1ZLVK 3QUMH 3BQUA 4NRXA 4OT1H 3ZE1F 5ITBL 1T03H 4KI5D 4KKLC 1NFKA 4LCWE 3QXVA 1ITBB 5KS9B 2FZ3A 1U58A 4GW5A 1VEOA 2XA8L 3PUCA 4TVSa 5L0QC 1MCRA 3HZMA 5IVZA 4G8IA 3VXPA 2IAMC 4WW2B 2XN9D 3KHOA 1EJOH 3DBXA 1QNZL 4OLZH 3CPLB 2G2RB 2R0KH 4RAUA 4XHJC 3KHQA 4M02A 4M62L 2UYLA 3IDYC 3GMPB 4XPTH 4R4FH 2YWZA 1K8DA 4MZ2A 4EKXA 3N85H 5DS8A 4R6UA 1P5UA 4KUZH 2A74B 2I24N 4XVJH 3WFCH 3MNZB 4KI5C 2DQEH 2CD0A 3L95A 3P9LB 4WU5B 2QR0A 5CJQH 1K4DA 3QDMB 3Q6GH 1KTLA 1T1ZB 2VDML 4GMSH 4IOFD 1F6AA 1L9NA 5EB9A 1DQLL 3HNVL 1MI5B 3S8WA 5CMAA 3G5XB 2DBLL 3OJDB 1QBLL 4K9EC 1ZVHA 4XP6L 2ICWJ 3KPQA 3QRGH 2XACC 4YAQB 1EUUA 2BVPB 1TFHA 3CU7A 3D0VB 3O9WB 4HC1A 3KLDA 2RBLA 5F7DA 3D3VA 2RQ8A 1YC8A 3EYFB 1EMTH 3GMLB 3VGFA 3WIHL 5GGUB 3I2CH 4MCYA 4FOMA 2VISB 3RL2A 1RJYA 2BNRA 4NDMA 4KY1L 4UIKH 3VFOB 3WS3B 1DANU 3H9HB 3O6LH 2R8SH 4L9LB 1A6ZB 3UYPA 3MRMB 2NXZD 4DJMA 1HSBA 1KPVA 3KR3H 3V9FA 1MJ8L 5FK9B 1QG3A 4ZFZA 1ODAA 1DN0B 2JE8A 1RUAH 3LB6D 5CS7A 1HCVA 3D9AL 4JKPL 4HUUA 1PJ9A 1I3RB 1IGJB 4RZCA 4HMEA 3B6SB 1Q9KB 3CFCH 1U8KB 4PGZA 3P4MB 4F9LC 5C8JA 3DGCR 1H0DA 1NGWB 3OZ9L 2GCYA 2V5TA 4FQ2L 1Z5LA 1FVDA 2MNUA 1OL0A 5IQ7L 2E7MA 1ZLWK 3IFOA 5F7FA 3T4YA 3S96A 5T3XE 5EBMA 4H20H 1YNKL 3K8LA 2X4SA 1OGAE 5F96H 2R1WA 4X9GA 2NXZC 1QFHA 1IM3B 1BOGB 3DMMA 5F44A 5K93A 1ZGLM 2WMPA 1HIML 4HJGA 5LGHH 4ZFGL 1ADQH 3D85D 4RX4A 4UIMB 5C0CE 2WM0A 3LB6C 3TNMB 3WL9A 3SDXB 4NO0D 4YBQD 4G8FA 3VXUB 5CEZE 4NT6B 1L7TH 2F54A 5ENWA 4X4XB 3CD4A 4I9WD 4XGZB 3M07A 4TUOA 5GGSB 1Y18A 1NGYB 5FYJL 2YD2A 1A4JB 1SBBA 2ICEB 1DQDL 3D39A 4JY6A 3THMH 2GJZA 4X9FA 1IAKA 1E28B 5BVPH 4JZJB 2HJKB 2XTJD 3VXSD 5C0AD 1M6OB 3ALPA 2AJYH 1N59B 2R1XB 4JFPB 1J8KA 2EYRA 5CBAA 2W59A 1S9YB 4Q2ZB 1G1YA 3QXDA 5C0JA 3ARPA 4RDQF 4OUOA 4HK3J 4N9GA 3ZDYF 2CRZA 2VR5A 3VXRA 4H25A 4P3WA 4G3YL 3X13B 4XB7A 1OM3H 1IC5L 4P23A 4UV4L 5IESL 1DDHA 1FYTB 1RJZB 4YBQC 2HT3D 5JPMB 5JDSA 4U1SB 4PV9A 4FXGA 4YO0B 3CZFA 2EDFA 1G9NC 4LQFH 3O81A 1YMMB 1HXMB 4KXZI 1FH5H 4H1LA 3GGWA 1U8HB 2AEPL 5F3BB 2HJFA 1BIIB 5IBUB 4DN4L 4QF1A 2O5YH 2XTJC 3ES6B 2E3VA 3GSNL 3CJJA 2V5RA 4I8DA 3DO7B 5A2IH 4Z0XB 4UNUA 2X1PA 3OJ2C 4GBXC 4JO3H 4R4BB 2DIAA 1M7DA 4EIZC 2NW2A 3BGAA 3TBSB 5E0QA 2APFA 5I2IA 3OX8A 2VXTL 4HX1A 4QTHB 1DL7L 4JFEB 2V9RA 4Y89A 1CDHA 1ED3B 3EO9H 4U1MA 2IBGA 3IDGB 1UJTA 3PIQB 4X83A 4Z7VF 4XP5H 1NH6A 2C7UB 1OAUH 1QFOA 1X44A 3MRPB 1QD0A 3FO0H 4LSSH 4V1DE 4ZXBA 4GRWF 1ZLUK 3SEPA 5HGAB 1PKOA 4U2YA 1XCQA 1MELA 1KB5L 3GBML 4MNHB 2G5RA 1H3WM 5GHWH 1ONQA 4E5XB 4WEMB 1VENA 1UZ8B 4U6XA 1XF1A 4MJ5B 4HH9A 4GOSA 3LS5H 1FFOB 2W65A 3KXFA 4W6XB 3NCMA 3U4BH 2D31B 1G7HA 1NGXB 4IJ3B 2BNRD 4L9DA 5GRZA 4YFLI 4EI5B 1BQHG 2Y07L 5E99H 5EA0L 3GO1L 4DVBB 5IMOA 4PJ5B 2WINB 3DGGA 5GGVH 4Z78B 5IW1B 4PJXF 3BT2L 3QXAB 2VOTA 5FYLE 1NDGA 5I9QC 2X7LB 2DI9A 5EO9A 3MRQB 2CDFB 4NKIH 1CD0A 2DMKA 1NBYA 4LP5A 1C12A 4DZ8B 2AV1A 5F8RC 5HGBA 2VXQL 3NA9L 4M4PA 4NJAL 3V8CA 5H2BA 1NLBL 4C56B 2NY7L 5F93C 3ZDZF 4YDIL 4M7KH 3MLXL 4F7MA 3HG1A 3S98A 4GSDL 1UWXK 4HXBH 1X5XA 5I16B 1LO4L 5JW3L 1RIUH 4LLMA 3CFBA 3OKMA 1UXSA 3MPCA 2DLFL 1PG7H 4R8WH 1I1CA 3DMMD 4ORZC 2XQBL 5I74B 1JFQH 5A2LH 3UPAA 4NZTL 1OHQA 2W9DL 3TVMA 1HZHL 3GNMH 4XWOD 5IB5A 3V8OA 1J05A 4UBDC 4APQA 2Q86A 2F54D 1I7RB 1BPVA 1U91B 1JNJA 5ADOL 4XXCA 4MXVF 4QRRA 1IC7H 1SMOA 4DZBB 3D39D 3GSRA 2DWEB 5C70A 2MPAL 3OQ3B 4ZNEA 1PSKL 4P46B 1OLLA 4OD3H 2Q7YB 1MHHA 1IAIL 1RZ7L 3VGBA 4WHTB 3RVUD 1HCFX 5GRUH 2OQJA 4GBXB 4AMKL 4F80A 4OCSH 4LSDA 4C55A 4KRPB 3FQUB 3HNSL 1SJEB 3N1FC 3DMMC 5LCVH 4D9LH 2QHRL 3DX9A 3VXRD 4I2XA 1LE9A 1NGQL 3HI1A 1PEWA 4P23D 4XWOC 5ALBH 2CQVA 2DB8A 3V5DA 1A14H 5DEGA 4LSRL 1GGIH 1Z9LA 1G0DA 4RFOL 4P5KB 5DJCA 1IQWL 4LGRB 1LO2H 3CLEL 1E6OH 1SJHA 3MLZH 4XTRD 3MJ9A 1RIHH 5TE4H 4PJEE 4Y19B 3RVUC 5K59E 3BP5A 1LP9B 4LFHG 5CCKH 5L2KA 1Q0XL 5ANMA 4PRNA 3MCG1 1UCBL 4M7LT 1A6TA 3MSPA 2GK0B 5E1AA 3EKCA 2CK0L 3QCVH 4ZSOB 1GOFA 1XZ0B 1YPZA 2IC2A 5KVGH 1R5IA 1VFAB 4QYOA 1UVQA 3I6KB 1PG7W 1H5BA 2R9HD 5D5ME 5TDPB 3QQ9D 4OV5A 4DKEL 4K3DL 3BMVA 3K2MC 1LEKB 3KVQA 1WF5A 5DRXA 3REWA 4KRLB 2VL5A 5CZVH 1I3VA 3MLYH 3NCJL 1K3ZA 4EDXB 1KJ2B 4QRUA 1SHMA 2J8OA 4NRYA 5F72S 4XTRC 3FQXB 3VXOB 1GVIA 4RDQG 1OAXL 2R2HB 1OD7A 2BVQA 3HS0B 3MRBB 1P69B 8CGTA 5T33H 2Z8WC 1AHWB 3BWAB 3KXFD 3EZ8A 3HLAA 2XWBA 1NAML 3WE6A 3LPWA 5FCUH 2HFGH 1ZHKB 4KK8D 1SBSL 2FB4L 4K2UH 4W6WB 3RWFA 2OR9H 4N8CL 4GKNB 3I9GL 4PTUA 2R9HC 1U8QA 3QQ9C 2XZCH 4QNPF 2EXWD 1I1RA 2E5EA 4KJQC 1OSPH 4WWKB 3PHOA 3MXVL 1QRKA 4Z7WA 3F7RA 4ONGH 1SJXA 5IB3B 1G84A 2HN7B 3U9PH 4M7JL 3C2AH 2EDKA 3UTPD 2AW2A 3DYPA 3DPBA 1FFNA 5DD6B 1QBLH 3D2UB 2IPTL 4LSTH 1T6WA 5ITFA 1CDGA 4DGYH 2EIZB 5I1LB 4MNGE 5FOJA 3LKOB 4Y1AA 2LAAA 1NGZB 4AIXA 1D9KB 3EJYD 4MAYA 3HG1D 5BQ7A 2OTWB 1MCOL 5DZLA 4HWBL 2BHUA 5F7EH 4DKAA 1DUZB 4KK8C 2YPVH 4JY4A 1HHJB 4YC2B 3RWHB 4GXVH 3VMOA 1P1ZB 3HZKB 1G6RB 1SY6A 3PGCB 4BZ2H 4KQ3H 4U05A 4HUMB 5E8NA 5A2FA 5EBWB 2R69L 3TVMD 1S7UB 2V9QA 1YN7A 4NJ9H 1Q9OA 5JPNB 1JHLH 4X5XB 5EPMA 4APQD 5L6YL 1V05A 4R4ND 1ZMYA 4PB0L 2DQIH 4JAMB 1YEGL 1KG0B 5J56B 1O7SA 4YDKH 1MFEL 4W4OC 4QRRD 1JBJA 5DT1H 3IU3A 1KN2L 5EU3A 2I60L 3OSKA 1IMHC 2AEIT 1WBYA 3D3VE 1T2XA 1BFVH 1INDH 3V0VA 3EJYC 2J12B 1KLUA 5IBTH 4P2QA 4XNMA 4CDHA 3O3UN 4Z5RA 4PBXA 4M8VA 4LASL 5ISZE 1XIWA 2VR9A 4XNQA 3UYRH 2IALB 1CZ8H 3O2WL 5DK2A 5C0EB 1QSZA 3RUGF 1R3HA 4V2BA 3TCLA 2P8LB 4PJIB 5H35A 3RWCB 1KBGL 3TVMC 4NN7C 1XGPB 2AXJA 1H9VA 3RX8A 4JLRA 2JLLA 1A2YA 2DIBA 3MTRA 4APQC 2EKSA 4R4NC 5MI0C 4IRSA 5FYJE 4XXCC 3GJFK 3W11C 1R3IL 2YUXA 4WY7L 4PJ9A 4BH8B 3QHTC 5ICZA 3VCLA 4RGOH 1WBZA 1OP9A 4H0IA 2FJHB 2F8VA 4LNRA 1TJIL 5D72H 2O93L 5DMKB 2G5BB 1MEXH 1OAKL 4Z18A 3HZYB 1WBXA 5I75B 3C8DA 1CE1L 4EOWL 1S7TB 2ZCKL 4P49A 3DROB 1CR9H 3FB7B 1FNEB 3IDNB 5F9JB 5A3ID 1MJ7H 4ZNCD 4UI2A 43C9A 4R26H 2JJUA 4NWUL 5KTEL 5J89A 2GFBB 1S5HA 3BSZL 4N5UA 2ZPKL 4K94C 1RAMA 4M7LL 1FQ9C 3GMRB 4PJAB 5ICYA 5L8LB 4M5YL 3H9SB 4S11A 2PYEB 1F8TH 2B7DT 4TQEH 2H8PB 2NY5C 3T65B 2F5AL 2O26U 2F54E 1CLOL 1C5DA 4UILH 3OV6A 5ID0B 3LN5B 3QFDA 2OSLA 3VGEA 4PFEA 5I1GH 1IBGH 4EUPG 5DD3L 4QO1A 2F8OA 5C1MB 3OAYK 1ZA3A 3QUZC 2VJXA 5IG7B 1XF3B 2ICWA 4F7TA 1G7LB 4PJDA 3WXWH 2J8UF 2NW3B 5A3IC 3UJIL 4XI5D 3T77B 3NIGF 3VXQB 4KMQA 3T0BA 1H5BC 2BSSB 4IDJL 2GITB 4LK4A 4ONHA 1T4KB 5I6XC 4G6JH 3CSGA 3UBXA 4NBYB 4JREC 1CTNA 5FDYA 5D8JL 4DVRL 4K3EH 1G7MA 1MRCH 4U3HA 4H0HB 4JM2B 1N2RA 3WS6A 5DGRA 3MRNA 3OAZH 4OGYL 5CSZA 1LWRA 1XF2A 2VDRL 3CGTA 5E2UH 2GSIA 5FYKL 3EIFA 3HMWL 3VA6A 3CMOL 3DNKA 4I4WB 1KB5H 2VZTA 4Y1AD 4YHKL 4P4RB 4XNYL 2YPKA 4MAYD 5DJDB 5C09A 1ZS8B 3GSXA 4X8JB 4XI5C 5IK3A 1IEBA 4X8XA 1Q94B 4MDIA 4QRQA 3DETD 2ESVB 1U8MB 1NGPH 3DURB 1QSFA 5DF0A 2Y07H 1IM9B 3QO1B 5CD3A 4NN7B 4LLYA 5TGBB 5IB2A 1DE4B 4G8GE 2O5ZH 4ZUVA 4XX1G 2NXYD 3L3OB 4LP4A 4Q9QL 3VFMB 5MI0B 3U0PB 2EEDA 5F9OL 4HUWA 2AABL 3L3HB 1OLZA 1BJ1H 1FDLL 3UYOD 1JPFA 1OB1A 3DV6A 3DVIA 3STLA 4OZHB 2VABA 4GAGL 5FFLA 4I0PC 1BZQK 2FSEB 2A83B 4JQXA 3FB8B 4P2QD 2R0ZH 3DETC 5DD5H 3SDDB 3GSQB 4YDIH 2O5XH 2OZ4H 5INDA 5MHSE 3KYMA 5EIIB 1XIWD 1PYWB 2C4FU 2JB6B 1L6XA 3S88L 1EHNA 3SKUD 4NHCH 5TFSH 4RMQA 3BKYL 1NFIB 2DLFH 2NXYC 3W39B 4QXTB 3HPJB 1UXWA 1YNLL 1PFCA 2AXGB 4IRSD 1R24A 2BZDA 3OWEA 2HRPL 3RX7A 4BSWA 4EI6A 3FFCB 5INCA 4LHUG 4PJ9D 1VFOA 1GHFH 3HTLX 3OKDA 3LDBC 4XMPL 1X4ZA 2MWCA 2WBJA 1I8MB 3BGMB 4XPAH 4PRHB 3QIBB 4F58L 1CXKA 4FQIL 4OAWB 2BRQA 3QUZB 5I17B 3EYSH 4X98A 2H9GB 1DSFH 1PSKH 3P9LA 4WU5A 1XIWC 3HMXH 4JG0L 1YYLL 5FA3B 5T1DL 4L3EA 5ADPL 4OCXH 3WDIA 5AD0B 4GUPB 1XGYL 3RWGA 1E6JH 1X6NA 3V52L 4O2EA 1HI6A 3MRLB 1P9MC 1TNMA 2BRRL 3HUJE 1YY9C 5MP6H 3GJFB 1IKNA 4JREB 4IRSC 3ULSA 1A6VH 2D7OA 2BVPA 2AEQH 3C8KB 3QEGH 4L8BA 4F57H 1T83C 2AJVH 5CP3A 1NLDL 3BRFA 4OQTH 1W8NA 2VLRA 1I75A 5D1XC 3GMLA 4JB9H 1EHAA 4P5MB 4K8RL 2VLJD 3P40A 4TNVK 3SY0A 1ZAGA 1KXVC 3T0EE 1EO5A 2VISA 1JNLH 5HYSG 4HS8L 3QDJB 3MYJA 3CDGB 3W2DH 1H3TA 1SEBB 5T1LA 5F9AC 3RDTB 1B4RA 3F12A 2JJTA 5FDWA 1N5YL 4Q6IB 2R29L 1T04B 3SQBA 5CBEA 3OB0H 4ZS6D 5IVXE 3OKOB 4FHBD 2DQFA 2EIEA 1KULA 2AJXL 3QG7L 4MWFB 4I77L 5AYUL 2GY7B 3ULUH 2FEEI 3PWUA 3SE3A 2FJFA 3Q48A 4BYHA 4D9QD 2B4CH 2VL4A 5E2TH 3O3DB 4MQSB 2VKWA 2Z35B 5DRNA 1R3KA 3U2SB 4ZOAA 1F3DH 4XCNB 4HIJA 5J6HA 2PKDA 2EDWA 1JPST 5BV7C 5E5RB 3NCJH 5EN2B 1GIGH 2D7NA 2CDEA 2CJUH 5L88L 3RU8L 4I0PB 3VFPB 2OLDA 4FQ1L 2ZNWA 5CIPH 3FT4B 2XZQH 4MA3B 5L2KE 2QQQA 5J6GA 1OAXH 5C09D 5ANME 4W4NA 5D71H 4ZS6C 3S7GA 2E7HA 3LD8C 3JTSA 3IJYA 1I1FA 4TSBL 2Y5TB 1YPZE 1QSFD 3PP3H 4J8RB 3VXUA 5T1MA 1HKLH 3I9GH 4JPIA 5AUMB 4XGZA 2LFGA 2ZUXA 5B39G 5JORA 1HK6A 3RA7L 3MLRL 1GGCH 3I50H 4ODTL 1MHCB 2P48B 4N68A 1OAYL 2IH1B 3ESVF 4AZ8A 3MROB 5IHLB 3JWDH 2DDQL 1QLEH 3LHPL 5BRZA 3RNQA 3O8XB 4XCEA 4M7JH 5M7QA 5HPMA 1GYAA 1NMCC 3E6HA 3I6GB 5HYSB 1BX2A 5DJ8B 1JF1B 4LU5H 5LXGH 1M6OA 1CFSA 2EECA 1N59A 3MR9B 4UT7L 1RZFL 1KEML 5M95B 4RQQA 4IIQC 1MCLA 1GOHA 4ZFOA 1PZ5B 3HKFA 4JFYA 4Z8FH 1AR1D 5D7IB 1VACA 3PL6D 4OFPA 1W72B 4MHHG 3F7VB 3LZFL 2UWEA 3ARGA 4ZDHB 1KCRL 1JZ7A 5BOZG 3ARZA 3VDBA 3SGKA 3R1GL 4NNPL 5EUKB 4AG4H 4YO0A 4ZTOL 3KLAB 4PLKD 5BZWB 3TH3T 1FGNH 4Z7WE 5IFJA 1U8HA 1AFVL 2APTA 5SWQB 3ZHDA 2JCCE 4M1DH 5D1XB 3ULVL 2WBJD 1T0NA 1D5IH 4NN5B 3ARQA 4N90E 3SOBL 3MUHL 5FYJU 1C5BH 1HOCA 4JQXC 3U9UB 2BVOB 3NAAL 2K1MA 3NZ8B 5IM7B 3VWKB 1AXSA 4QTHA 4A2MA 4E0RA 3PL6C 1JZ2A 5FGCB 2BXYA 4ONFH 2J3SA 1ZLSL 3BEWA 4WHYH 4JFEA 5HHNA 4L3ED 3G04A 3NIDF 3PIQA 4JO4L 3RTQC 4PLKC 2YD5A 4N0RA 4F7EB 1N3NA 3AMKA 3MGTB 1UWEL 4U4BA 3FTGA 5HGGS 2NY3B 5EC2A 2WW8A 3AS0A 5MEOA 4POYA 5JZ7D 1CLYL 2RIKA 3SQOH 2VLRD 2WBJC 2NY2D 4YK4B 3I75A 3SHSA 4E5XA 4JGUA 5BV7B 1Q1JL 4MJ5A 1M05B 2ITDB 4XAKD 1FFOA 3E2HB 3DI2B 5JW4N 4WI7A 1G7JA 2D31A 4Y4HB 4HJJH 2CLRB 3FAWA 4RMTA 4P9HH 2X05A 3U6RB 3UTSE 1ORQA 3MV7B 2X70A 5T1LD 3WJJA 5CUSL 1BLNA 2Q87A 4IMKC 4OF7A 4AM0B 2ZCKH 5IIEA 2W91A 2VRAA 5EZIL 3ZKND 1IKNC 3WO4B 1FC1A 3O45A 2B1AH 1GPOL 3TYFA 3TBYB 1FZJA 3DHMA 1RU9H 3KPMB 3PWPD 3STBA 3BEVA 2NY2C 1ES0B 2P43B 4XP1L 5A43C 3TJHD 4XP9L 3PWLA 4FABH 4H88L 4KGJA 1AO7A 4LPUA 1DBMH 3P0GB 1EGJL 1NCCL 1N4XL 4OZGB 2H1PL 3EYOA 4FQQB 2JJTC 3C6LA 1BZ7B 4NBZB 1DQJA 2FHFA 1CVSC 4WUUA 3O3EA 3WLBB 3CSPA 1PLGH 3EYQD 1MH5A 1FO0H 1KC5H 1IC4L 1WZ1H 3ZKNC 2ADJB 3QUKA 1CQYA 4TVPD 3KPNA 3SE3C 1QYGH 3EDKA 1EFXB 3VXUD 1DBJH 1I7RA 3BPLC 1P6AB 3KPPB 4JRXA 1G7PB 5KVEL 1J88A 5DQ9B 1QVOB 3B83A 1HEZB 4IRZL 5BRZD 1I9JL 1T1XB 3PGFL 2XKNB 4OFIA 3QIUA 3I3DA 4P46A 4DOHE 2P7TB 2GTZA 1JPTL 1BQHA 1RUQL 4UT6H 1RIVH 1G7IB 1NBVH 3BP7B 1HINL 4JPKL 4PRBA 4X6DF 4G6FD 4ZPTA 4PJ8A 3GSUA 5IV2B 4JRYA 1F3JA 3GKWH 4BJLA 3DX6B 4U6YB 4HZAA 3O2DA 3EYQC 5J3HD 3KJ6H 2CMRH 5DRWB 2VXUH 2CLVA 3QFJA 3PV7A 2WLZA 3X11A 4HCRA 3ARGD 2GUOA 3RTQB 1Q9LA 2DTML 4ONOA 4FQPA 1IGMH 2FGWL 1JGDA 4ODHH 5DUMH 4D9QE 4P3CH 5B4MC 3QULA 4QRTB 1MREH 1YJDH 3EDFA 2AJ3B 5SX4I 2B2XH 1G9NL 1FAIL 3V6FA 4M1GH 1JK8B 5GS1C 1I8IB 1RUMH 3UJJL 4Z7UE 3ZT5A 1FORL 3FHQA 4MGXA 4M6AA 3STZB 4K71B 1RPQA 2R0WH 3WJLC 3KNBA 1B4JH 4CADB 3CVIH 5EU5B 4MQXC 1FNGA 1W0WA 2EH7H 4U1KB 4LIQL 5J3HC 1MCEA 2CIIB 1EEYB 3AB0C 4CW1A 3ROLB 5I0ZA 2OJEB 2ZNXA 5TDPA 1Y0LB 3ARGC 3ZE0F 5TE6H 3VXTA 4HFUH 3SGKC 5DJXB 4XPHL 4HHAA 4JKKA 5EU7C 2VE6A 4HIHB 1LEKA 3B5TA 3BGFB 1U3ZA 1A5FL 1OQOA 4LAJH 4EDXA 2X4UA 3BYTA 3TH2T 1YY8B 3BN9D 4PRIB 1LEIB 5IFHH 1B0RB 1UQSA 2HH0L 2AP2A 2HKHH 3SE4C 4EEEA 5FO9A 2HRPH 1XFPA 4GXUN 5I1DB 5J57B 5FB8A 3VI3E 4QXUL 4W70A 4XMPH 1S9KC 1P4BH 5EBLA 4ZO8A 3QUYA 3U46A 1FFQA 1WCBB 1U8LB 3QO0A 2VNCA 4FQIH 3MGOB 3O3BB 3P4NB 3LMJH 1AQDB 3O4LA 4GG6F 5KSVB 2YN3A 5KS9E 5C0BB 4YHIB 5GJSL 5GRVK 1ACZA 2IPKB 1CTOA 1XGYH 1ZHNA 1CE6A 4BZ1L 1NFDF 2VDQL 1DFBL 2AXFA 4LDLB 2OYPA 4PLNC 15C8H 3U4EB 3B3IB 3BN9C 2V7NB 4XT1C 3E0GA 1VEPA 1IGFL 5TQ0L 5IB1B 1NEZB 4EZMA 1MAMH 3RWIA 1CFQA 2KZ1B 1IAMA 3GBLA 3SPVA 2CKBA 1KJ2L 5I1LA 5FHBL 4U0QB 4NRZA 1S9WB 4HZLA 5EU6B 1KCLA 3O0RL 3TV3L 1AO7D 1KYOJ 2OTWA 4LVNC 1DUZA 3HAEH 4QRPB 1HHJA 3MRGB 5BZDB 2DJUA 4XXDB 4KZEL 3LEYL 1KCSH 3KPRB 3NIFF 3WJJC 3C6LD 2GSGB 2J6EL 4WUUD 3QDME 1YEHL 3RAJL 3PGCA 1A7RL 3PV6A 1N26A 3VGHA 2JB5L 5EBWA 3S34L 5GPRA 5TH2B 2R29H 5LBSL 1MI5E 4HIEB 3ISWA 2PETA 3ZKQD 3LS4L 3OAUH 3FT3B 4X5XA 2A6JA 4KU1A 5AYUH 1J1PL 3BDXA 4GRLA 1IKFH 3OPZL 4KMLB 4PRAB 2FHCA 3FHAA 4RAHA 4UUJA 2L4OA 4JRXD 5BJTB 5CEZH 1Z9OA 5GS1B 2K7PA 1J8HB 3BHBA 2VLRE 2AQ2A 3SCMB 3QIUD 3LV3A 1RFDL 5DJAB 5IJKA 2HLAB 4XAKE 4HQQH 4CL7A 4OB5L 4PJ8D 4JRYD 3O2VL 3AB0B 1KEGL 2GYSA 1CD8A 4JKLA 3PQYB 1U2CA 2P8LA 4JPWH 3RWCA 4JFOA 5DGQA 2A9NL 1AY1L 1G6RL 5E9DB 5HHMB 3SE9L 1XH3B 3QFJD 3F5WB 5F1IA 3QWOA 4S1QH 2X4TB 4YE4L 1TENA 4H8WH 5DD0L 3SKOB 2X9YA 1VCAA 3U1SL 2WUBH 3T4AB 5C7XL 2BSRB 5GS0H 4JZOB 1B0GB 5DUBA 3LN4B 1EJ6A 3DSFH 5CGTA 4I0KA 1OCWH 4RAVA 3QIUC 4UTBL 5DHYB 1OAYH 1YYML 3NH7L 4HBCL 1A6WL 3PDOA 5BXFB 4IS6A 3S3JA 2OK0L 4TULL 3W81A 4FQHB 3AUVA 2VLLA 1FG9C 5F1KC 4HPOH 4UT7H 4K7PH 2HKFH 2JJWA 2EC9U 5ABDE 1HWHB 2ARJQ 4OLEA 1TZHB 4PJAA 1ZT4A 2ICWI 3QWRD 3VI4E 4XNZC 2DRUA 3MLTA 1JIBA 2PW1A 3A6CL 3SDXE 4MYWB 3TNNB 3VXUE 1KCRH 3MRCB 4DFIA 1FIEA 3G6DL 3MO1B 2ARJA 1DBAL 4KTEL 5DZOA 3V4PH 1Q9WB 1DVFB 1A1OB 3LQZB 1XGTA 3OKEB 3UBXI 3ULVE 3SN6N 1C1EH 2R4SH 1FZOB 4PJXA 1S7WA 1OGTB 3V7AG 5H94B 1AFVH 3V0WH 1MQKH 5AYQA 2LU7A 2EDEA 4EBQH 5B38A 4EDWH 1RUKH 4WI3A 3QUYD 4KQ4L 5HDLA 1A7OH 1F4WH 3HPLB 4UDUA 2FBOJ 2FX7L 4ISVA 3NAAH 2QL1A 1TXKA 3P77B 3H7LA 4PB9H 2GITA 2GJ6D 1T4KA 4KK6D 3O4LD 1WZMA 4RBPH 2WUCL 3MJ6A 1FYTE 4QEGA 4CMMB 3MBXH 5E4IA 4M4RA 2UWEE 6CGTA 2EC8A 4LSVH 4O5LH 1JHTB 4AIZA 5CSGA 4WWID 5ESQA 1JI2A 2D03L 3P0YH 3H7BA 4YHLH 2D9QB 1FNAA 1YMME 2ENSA 5C0GB 4KHXH 3UDWA 3N1PC 5ACMA 4LFHD 2V6HA 4CMHC 1OAQL 4K9EH 1F11B 4DKFH 2DWDA 5CWSB 4P4RA 1UM6L 2FYYB 4QY8B 3SDAB 1ND0A 3QP3A 4N5ED 4PGJA 3D0LA 3BPNB 1HQRA 4OTXL 4QHMA 5TDOA 4HFWB 4U1HB 1HHKA 1IGTA 4KK6C 3PHQB 4JFFA 5I1HH 4JFEE 3DYMA 1G7QA 1LDSA 1YNTB 1T89A 3TO2A 5ACLA 2ZOLA 4PGEA 3RIFK 2F74A 5MENA 1YEKL 4OCYH 4WI8A 3KJ4B 4EUPA 4Y8DC 4GRLD 5C08B 3WIFA 1K8IB 1ZGLA 4FFYL 3GI8H 1NDMA 3LIZL 2BJMH 4WI6A 3G9VA 4OLVL 1FCGA 3IJHA 4MNQB 2GTWA 3MRIA 3U82B 1LO0H 2X44D 2FSEA 2A83A 4XP1H 5F7NC 2DQHH 4MCZA 2C1PA 3IAPA 4PJGB 3SDDA 3ZYZA 2P8PB 1CWVA 5EIIA 1IL1A 3GMOB 4MB5A 1PYWA 4L4VB 3QRFM 1N7ML 5DWUL 2WWMD 4OZ4A 5FYKU 3BZEA 3OKKB 2VAJA 3RWJB 2OP4L 2YRPA 4PJ5E 2A6IA 1TVBB 2QSTA 4OCWL 1JPSH 3IFNL 2IBBA 4P4KB 3F6LA 4QXTA 5B3NA 3CFDA 4XNUH 4NZUH 1MRDL 3MBEA 1TVHB 3FQRB 4F37K 2HP4A 4GRLC 3O6KH 5JIIA 4KVCL 3HE7B 2ADFH 3HCVA 2H32A 3BUYA 2AJUL 4MLSA 1PY4A 5C6PB 2W60B 3QIBA 4HAFA 4R96A 1G0XA 4N1HB 1HXYB 4C56E 3LRGA 1MLCB 5I17A 3CLFH 4F33A 2AV7B 4PP2B 3U36A 1X5GA 1AO7E 1VB9A 1JPTH 1RUQH 3IFPA 3MRKA 1RZGB 4WUUE 4LCIL 4N1CA 4X6EA 1MIEL 2E6PA 5J9PB 3AU1B 3HC4L 3ZT6A 3C5ZB 4GRMB 3C8KA 3CVHB 4MJIA 3KDMB 4Y2DA 4K94L 5F7LB 2VQTA 4HWUA 3U4AA 3QZWG 2YEZA 2QJDA 5DVKA 1ZEAH 4HIIA 1L9MA 5FM8A 4NGHH 4D0DB 2DTMH 3ZE1E 1A4KA 4JVUA 4UNTA 2XZAH 1IRAY 3LKNA 5HYJA 4AL8H 3EJZD 4GG6B 2DLTA 3CFEB 4P5MA 3T2NL 32C2B 5ACZB 1JTPA 3DV4B 3E8UH 1T20A 4LEXL 1UWGH 2HFTA 2J4WH 1WFTA 4R97C 4N8VB 3NTCH 4OFDA 4CN4A 1DLFL 4IRJB 1DR9A 3F7QA 3HRZA 2VLKB 4YUEH 2ED8A 2YKLH 3TN0A 2Y9RT 4JRYE 3QG6A 2CDGB 2F5BL 2HT2C 1D5XB 1I85A 1LHZA 2QLVB 4XPGL 4M6NL 1A7QH 1CICC 2LU3A 4LHUA 3QUMB 4JDZB 4JDVB 4Z7NE 2DI8A 1CD1A 1FNLA 1L0XA 1OAZH 3V6ZA 3U2SA 3B8SA 4P9MH 3TBVB 5IROA 3EJZC 5SWSA 4PIRF 3CZJA 2K7QA 1RZKC 3BD4A 1MFAL 1QEWB 3WIIL 1KELH 3KPSB 4NQSA 5GGRY 3G5ZA 1PD6A 2A73A 2ENYA 4JFXA 3MQIA 4N0FB 2ICES 3M8OL 4Y19E 1PQZA 5D1QB 3U0WL 3FT4A 3GJEB 1JPGA 2YD1A 1XT5A 4G6ML 1LP9E 4TNWF 5LVEA 1T2QL 1U95A 4ELMB 5JA9A 1BD2D 1CK0L 3FMGH 2E7BA 3DX7A 5HI5D 3BIKA 4ZSOE 2Y5TA 1KFAL 2X9XA 1AI1L 1IGCL 4YGVA 4JFFD 3NN8B 3MA7B 4LEOB 2VWEC 2KPNA 2OXHA 2QADB 2ADGA 5MEND 4CJ1A 4IOIB 4NNYB 5EDXA 5IGXH 3MROA 3PGDB 5EIQA 1FZMA 3LQAL 3RUGA 1SM3L 1HH6A 1VA9A 2MHAB 2IG2L 2E8ZA 1X4YA 1MWAL 5I66A 2OI9C 5JQ6L 1TITA 3KYKL 4PGDA 4YX2H 4XNXH 3JBG7 4HC1H 2X4NB 3RVXD 2NY0C 5KG9B 1ORSA 3S36L 1ZGLP 5EOCJ 5HI5C 1DQQA 2BNUA 4PJEF 5FXCH 2FBJL 1FFPB 5K59F 3BP4A 1KNOA 2EH8L 1W72A 3DUUB 1KIPA 3LEYH 4NC2B 2ATKB 4HDIB 4PG9A 4ZAKA 4GKZA 1T89C 5GGQL 5FM4A 1A7RH 1RHHA 3MBED 4PTTA 5DMGD 4BH7A 5JLZA 3Q5OA 1FG2A 5IF0B 4YDLC 5J13B 4M5ZL 4LLQB 1T5WB 1YMHB 2L7JA 1NCDH 3MMEB 1LNUB 1GZQB 2AKRA 1P7KA 4G7YH 4MAUH 5E6ZA 4CGTA 3RWEA 3RL1A 3FFDA 3RVXC 5D6DC 4YDVA 1BQUA 4BM7A 5IHZB 3D18A 1TETL 2NX5B 4AYFA 3TIDB 3ARUA 4FZ8H 1A7PH 3MJ8B 1RFDH 5KVFH 1SYSA 1NC2B 4JN2B 3TO4A 3VE0A 5E2JA 5CZKA 2FX9L 3MUGA 2YBRB 5B39A 2PXYB 4TSAH 3EGSB 4L1DA 3O2VH 1E27B 3H0TA 3S3SA 1KEGH 5DMGC 1CICB 1OWWA 1QA9B 4NHUB 4MJID 4Y2DD 1AY1H 2J8UA 3BIBX 5TF1H 3SE8H 3GBNH 4ERSH 2AJZA 3C6SB 4OI8A 3ZDYE 5HYJD 2VDOL 3U1SH 2QEJA 5ICXA 2I9LA 5KSAA 5C7XH 5TDNB 2CLRA 4UTBH 4C59B 4OSUL 2KBGA 4OZFG 3VXNB 4JJ5A 2HFFA 5CLTA 4U1JA 3WNKA 4TULH 5IW3A 2EEAA 2X1OA 5E5UB 1I9EA 4GS7C 3TN0D 1XCTA 4Y8AA 4L4TA 4NM4L 4NQDB 5JHDB 2FD6H 1V7NL 2XYCA 1A6PA 3SKJL 4PJIE 5IEKA 5DJ0A 5CJXA 2DS4A 1WFNA 3MLUL 3MRFB 3F7YB 3TBYA 3ZE2E 1P4IH 4LHUD 5E6IB 4YXHH 1CU4L 3O41B 1CDJA 3CFKB 5CGMA 4LAQL 1ZV5A 4TRPH 1NCBH 1S78D 1QO3B 1EO8H 5SWSD 5HGHA 1T7WA 2XWJB 4OM1L 4RNRA 4L3AA 3CUPB 5GSRA 4RMVA 4RGND 4H1LH 1IQDA 2EZ0D 5BV7L 4FFVD 1UZ6E 4IEFB 2NY0B 4PJHB 1CFNA 1TQCB 3I3BA 4YDJB 4DCQA 5E8OA 2YD3A 5T1KA 3TN0C 1FGVL 3R8QA 5C0FB 3LPGA 4KQ4H 2G75A 1I85C 4M7ZB 5F1OB 5LWYL 2HFEA 5KJRH 1XR9B 2EXYD 1TMCB 4Z7QF 1EFXA 2D2OA 5F1SA 1CXLA 4PJAE 1H15B 4G9FD 3H9SE 2PYEE 3AS2A 3PJSB 3KPPA 4ACPA 5FUZH 4GQ9L 4X5LA 4GJTB 1TJGH 2D4FA 3TJEL 1S78C 2ZG1A 1AGEB 3E3QE 2D03H 2JIXB 1FAKT 1RULL 3IXTB 4RGNC 2R4RL 2EZ0C 4OZFB 5CEYB 4FFVC 4ZPVA 4AQ1B 2ATPA 4PV8B 2NTFB 1KJMA 1OAQH 2DJSA 3EDJA 1FNSL 5DRZB 5HHVH 4OLYL 4AY0A 5IV2A 2VB5A 5I1CH 2ZUUA 1X7QA 1XF5B 1KLGB 3MLVL 5DTFA 3DX6A 4U6YA 3NGBB 5EZLB 4HS6B 4LARL 4U1GC 1T3FA 5J1SC 4XCCH 3ARVA 1FJ1B 3QEHA 5DMJB 4ZAKD 1ZANL 4FXKB 1CXIA 5FUCE 3ZDZE 4JCLA 4QRTA 1VGKA 5JHLL 4CKVX 2OJZL 3CFJA 4KROD 3BPOB 4C83A 3CNKA 2LU4A 4RA3A 1ZVSA 1BREA 2GIYA 5GRYA 5DK0B 2FH6A 4RWYH 4BK4A 4UOJA 3ILPB 4K3GA 4CADA 1J86A 2N7BA 3NFSL 3MRJB 4XBPA 3QDHA 4U1KA 1XGRB 4M43H 2C3HA 1GJIA 3BZ4B 2YC1A 3CXDL 1LK2B 4G6KH 3ZHKA 5ESVA 4HV8B 5FOBA 3BKCL 3MXWL 4MXVE 3TYGH 5DQDH 3LH2H 3HZVB 4N8PA 3TO4D 1I7UA 2ESVE 2HTKD 5B22A 4ZAKC 1R5VB 1K5NB 1WISA 5F6IC 3EO0A 2IJ0C 1MQ8A 4JFFE 1AXIB 3QHZH 4JE4B 3EBAA 4RFNB 3W82A 2AK4A 1OTTC 1YEFH 3ELAT 1GC1L 5C0DA 1HILB 1E4XH 1CBVH 4HKZA 1LK3L 4P2RA 3MFFA 1S8DA 4R7NB 5FGSA 5B8CB 5KSAD 1AE6L 1RY7B 3SGJC 3M1BA 4OZHE 2AJUH 3QIWB 3HI6H 1WCBA 1CIDA 5F9WC 1FL3B 2QBWA 1TJHH 5FECB 1OSZB 3TO4C 2DBJA 3FO2B 4LLWB 3ROOA 5IWLC 3VW3L 3FONA 1JWSA 2HTKC 2ADIA 3WFBL 3NABL 4YHIA 4UB0L 4L4TD 1C08A 4U6HA 2BSED 3IVKA 3BH8B 2V2XB 5D93B 5GS3A 4BSVB 4LCIH 4NC1E 1MIEH 4QRSB 3B3IA 2PTUA 1IEAA 3JV6B 1U3JA 3RJQB 2JJSC 1X5KA 1W8OA 4PRPA 3B8YA 4HPYH 1X5IA 4K94H 2FIRT 1YUHA 5F88B 5EO0A 5KSAC 5T3ZL 2YWYA 2NY5H 4PRHE 2P5ED 2DLEA 2XIDA 2O61A 3EYVB 3MRGA 5DMYA 1EXUB 1QBBA 3MACL 4KMTH 1MJUL 1QSVA 1IGIL 3MJ9H 5C6WH 5T1KD 4DTGL 4NO2A 1C5CL 5D7KD 4PUBH 4YHMH 4X6CB 1N8ZA 3UTZA 4CU8A 2MCG1 4LF3A 4P3DA 5CJXC 3L3GA 3OJMB 4P57B 3JUYA 3WMSA 3WNPA 3BXNA 3SDYH 5GXBB 2IAND 2KL6A 4LRIA 2BDNH 3G5YB 4NN6C 4M6NH 1V5JA 3ARBA 4UV7L 3QQNA 1JGEA 2P44B 3QEUA 5EU4A 4QNPE 3CMGA 2Z0BA 2DD8L 3D48R 5AWNH 1VGEL 4Y16D 4LMQE 4YNYB 3QNYB 3QDJE 4NQEB 5GGRB 2PYFA 4D0BA 4F15C 4AT6A 3R06B 5E8DL 5GJTH 3PQYA 3U0WH 4G6MH 1VEMA 3FO1B 1J7VR 4P48A 3DVGB 3OAZK 4FQXC 3G6AA 4JQIL 5F6IB 1D6VL 1NCUA 4HD9A 2F58L 2V2WB 4WFGE 4XVSL 2A1WH 4XMKH 1GSMA 3IRZA 5IHUL 3JWNC 3TPUA 5HYQB 3HUJF 4HS3B 4JFZL 1OOAA 5SWSE 3SDCB 4Y16C 3VRJA 5C9JA 3TC9A 3K7UA 2X41A 4UINH 3BX7C 4XBEH 1AGBA 1UFUA 1JZ5A 4KAQL 1MWAH 3C09C 1FL6A 4OCMC 3CCHB 4P5TC 1UCTA 4CN6A 4NQXB 3Q5YA 1MHPH 2DM3A 1EHLH 4O58L 2OTPA 1MFCL 1KTDA 2DYPA 3O11A 4E41A 4MXWL 4BKLB 5BS0A 3Q6FA 4I48B 2DM4A 5IVXF 2YPLB 1T1WB 3ZTNL 2AK4D 4L3CB 4R2GD 5GGQH 3S37H 3TEUA 4WFFE 3DUSA 3BRDA 1A1OA 4TTGA 4P2RD 2P46B 3K80A 2LVCA 1OGTA 4XRCB 4PBWD 2R39A 3RBGA 4LCCB 5F9DC 1ERNA 2FWOB 5IVNA 5FUOL 3MOAH 3WFDL 1E4WL 3OKNA 4PRDB 4WFHD 2NCMA 2VTFA 3JZ7A 5J11B 5D7IE 4ETQA 3LKSA 1J0YA 3UC0L 4CMMA 1DBBH 5EOQL 1BEYL 2X89A 5DR5H 3BDYH 4M48H 4FFZH 4J4PD 4R2GC 1QBML 3QI9A 2Y5EA 4B50A 5DSCA 3NPZB 4JPVH 3LOWA 3CU1A 3IDMB 5E8PA 3TCXA 2YZ8A 2EDHA 4N1EA 3KAAA 4PRPD 4XVTL 4N9OB 4ORGA 1ZHLB 3TGXA 1M4KA 1NSNL 4JFHD 2AGJH 4CNIA 4QY8A 4WDIB 3VFWA 2YSSA 4JO2L 5GRJL 5TE7L 4HUXB 5I1IH 1U3HB 4HFWA 2CRYA 3WFEL 1MLBA 2CKNA 3VG9B 3S97C 5FGCE 5GGTA 1S5IL 4L5FL 3KYNB 3WUWG 5FIEA 2E27H 4F8QA 5I8CB 1I1YA 3J7HA 4FQXB 4GKSA 3IJSA 1AQKL 3G6JB 4GW1B 3IYLW 4J4PC 1W0YT 5GZOD 2ZP0T 5FEBA 1I8LA 5D2NB 4X6DA 2FLBT 3GRWL 4UNVA 1FL5B 1ZTXH 3H2WA 2FL5A 3WUZA 5GISH 1VSCA 3ARBD 1I9IH 2CGRH 1CU4H 3CAFA 2P8MB 3OB0K 4MNQA 3RWDB 5C07B 4FTVA 4MB4A 4H5SB 2XG5A 1A02N 2Q8AH 1CDIA 1BAFH 2JCCF 1L4IA 3C08H 1I7TA 3GMOA 3FN0H 3RHWK 1BZ9B 2P45B 3C09B 3MREA 3TH4T 5FO8B 4P5TB 3GIVA 4K3HA 3AMLA 4U0RC 5DVNA 3QDGB 5GRVL 4DEPC 5GZOC 2YD9A 4YPJA 2D9CA 2FX8L 1TVHA 3X17A 2YXMA 1NJ9B 3HB3D 5KSUA 5I1KH 3GSNB 5FO7B 2LABA 2FATH 1IZKA 3CIQA 3HE7A 1A7NH 2GAZB 3ARBC 1BP3B 4XMLH 2AJSH 3ZL4L 2W60A 3WD5L 3WNLA 5IUSA 1HXYA 3W0WA 3S4SG 3ULUD 3WSQL 1IT9H 4PP2A 4ZUUB 3EDEA 3PP3K 5HHOD 2FIKA 1RULH 2NNAA 4A6YL 3VXMA 1LO5A 4OZGE 2BMKA 4BQ9A 2P5WA 4HKJB 4O9HL 2C4XA 2I9TA 1IC1A 2XKSA 5DJ6A 3BO8A 1RVFH 4OFYA 1BBJB 3ARFB 4FP8L 5J9PA 4GT7A 4YXLL 2IPUG 4WFED 2DYPD 1KB5B 4LARH 4UAOB 4E41D 3HB3C 4YHOH 3CXHK 3CVHA 5BS0D 2H3NB 1OY3B 3GFUA 1NAKH 5FKPB 1U8JB 5EWIH 4Q97A 1U6AH 4D0DA 3KLHD 4ZUSB 1J1XL 5L2JB 4GG6A 4OD1L 1UB5A 1MAKA 5ACZA 5E94A 2VXVH 2FJGB 3ULUC 4LVOC 1KACB 2V7HA 2C1OB 2A6KA 2X4OB 3DXAA 3GK8L 3PHSA 1JV5A 5BW7A 1I3GL 5DFTA 1NFDA 1INQB 3MC0A 2IH3B 3O4OB 1QLRB 1KENL 1MOEA 2AK1L 3NOIA 3WCYA 4TPRL 5F3HB 1MCPL 3ARSA 3JTTA 1YN6A 1FIGL 3ZLQC 1D5XA 3MA9L 3MRDB 5EO1A 5KVMC 4X7SL 1U8PA 3K46A 1S7SB 4LKCB 3TZVB 2X89D 1DQMH 3KLHC 1CLZH 3QI9D 2DQGH 2F53B 4NQCB 3Q5TA 1GAFH 3OXSB 4ZYKB 3VDAA 3FB5A 4M3KB 4N0FA 4LCWA 1IILE 1RMFH 5D1QA 2DQUL 3REVA 2VAAB 5J1AB 1RSFA 1HSAB 1KIQB 1A6AA 3U7WL 3TT1H 4ZFFA 3ARRA 4MJ6B 5CHNA 3RQ3A 2ZSWA 4NPYA 4QHUA 4Q9RH 4OLWL 1P4LA 3QZWA 5JO5B 1A9EB 3QNXA 1DEEA 1IEHA 3L3IB 5DMIH 4D0CB 5TQ2L 3IU4H 4Q6YA 1JGUH 5MEPB 3PGDA 5C2BH 3QUML 1X5HA 4OT1L 1T03L 1L7IH 4PRIE 1VKXB 2R2BA 1CDCA 5CJOL 4M93C 3WFHB 4FTVD 4JDTH 4JR9H 5CP3H 3M17A 3VH8B 1MCJA 3S6CA 4Z7UF 1EBAA 3V6OC 2CR6A 1EJOL 4XH2B 5GSVB 5F89B 1FFPA 3VD7A 2Q76B 4OLZL 5C0ND 1QR1B 3DUUA 2R0KL 4MQ7A 2YRZA 3VD3A 3QQ4B 2VDNH 4HK0A 4CVZB 5IJVB 4KRNA 4OIIH 4EVNA 4XPTL 4R4FL 4B5EA 1IGIH 5C0BE 1WGOA 1CGSH 3N85L 1C5CH 1M7IB 3GUTA 1P7HL 4LLVA 1Q8MA 4QWWD 4KUZL 5JNYB 4XVJL 3WFCL 4Z95H 1XF4B 2DQEL 1AC0A 2NQCA 5CJQL 1LNUA 1DEDA 4QGYA 3RX5A 4GMSL 4OUUA 4NIKB 1FSKB 1S7RB 1RZ8B 1GZPB 4WV1B 3W0WD 4JFHE 4PY7A 3L7FB 5EU6E 2UV3A 1S7QA 1DTUA 4QXGH 1PEZA 3I85A 4HXAH 2EE6A 3MZTA 5EZJB 3L3JA 2RB8A 4LCUA 5KOVC 4X0KA 3VXMD 5C0NC 3IT8D 3QRGL 5IB4A 4QRPE 1Y6NR 4JN2A 2P5WD 3KPRE 1D5ZA 5DA4A 4R0LB 1AGDB 1VFUA 5EZOH 3X3GH 1P84J 1R3JB 2HJLA 4OFYD 5E8DH 1FVEB 2X1WL 3QQ3B 1OP5H 4MHHI 3L5WA 1NUGA 1QA9A 3QHFH 3OTTA 5CIPB 5E00A 4QWWC 3I2CL 1S9XB 2XNAA 5KS9F 1S9VB 2BCKB 4B7IA 3V5KB 5IR1A 1KT2A 3C6SA 3RZCA 4OIAA 4PJFF 4TVPH 4UIKL 1SEQH 1QSEA 3PDDA 2R8SL 4WW2F 3NCYP 4YFEA 3AY4A 1OGAA 1J8HE 1D5BB 3KR3L 4XBGB 3BESR 3DXAD 4MXQD 4JJHA 3LEXB 4O2CB 1RUAL 1IJ9A 5C0CA 1KXQE 1J0ZA 3FB6A 4YHYB 3FCTB 2YK1H 2NR6D 2QKIA 2GJJA 3CFCL 5K9KB 2I07B 3PQYE 1HHHB 3NCBB 1HHGB 2ZCHH 1WJ3A 2OL3A 3UROR 4PJCF 3TF7C 5H8DA 5E9DE 3MRFA 3HA0A 1OP3K 1AGFA 2X4RB 3D69B 3VFTB 3O41A 2W0LA 2E7LC 4NOFA 5LAXB 4X5WA 3S5LG 2BNQB 2R23B 2ZZUT 2F9BT 4X7CC 5F96L 1H8SA 3DECA 3BVNA 2V5MA 43CAA 5BW7C 5LGHL 4JG1H 4LCWD 1ADQL 1SMAA 4MMXC 1GGYA 4NKQB 5ALCH 4PG2C 2DQDH 2MOVA 2XPGB 7FABH 1L7TL 2NR6C 3B5GA 3EW3B 5GGSY 2AVGA 1ZLVH 3LKQB 3BZFB 1KJVB 4PGCB 3THML 5EBGA 2NYYD 4DK3A 2Q1EA 1IGYB 5HHXH 4ZUWB 1ETZA 1V3JA 1H15A 3SGEI 5BVPL 5E2VH 5I15H 3UPRB 4Y4KB 2AJYL 4GLRI 2XWTB 4XCFH 3DRQB 3LVEA 2BFVL 2W9EH 1PKQB 4NO3A 4BK5A 2PN5A 4Y4FA 3MJ7B 2V17H 1AKJB 4OZFA 1T1YB 2QQLH 3C60A 5DJ2B 1OM3L 4L8CB 2E9BA 4XVTH 5I71C 2K3TA 4KKCD 3KWWB 4HW6A 3OXRB 4QGTA 2MQ3A 1MRFH 4QCIA 4UMGA 1BGXH 1KLGA 4WEBH 4LQFL 5HSFA 3HE6B 3K3QA 1FH5L 4X4ME 2NYYC 4V1DA 1U41A 2VQUA 5E5MA 2O5YL 1LDPH 1MJJA 2QSCH 3MCKB 3S5LB 3WN5B 4JRWA 3SO5A 3NCEB 4W68A 4JO3L 5LQBH 3EO1B 1JZ8A 5DI8B 4ZQKB 1E0OB 3SDXF 1JUFB 5DVOA 3QCUH 3ILPA 1NBZB 4PY8J 3EO9L 3UTTB 4PR5B 3ULVF 1A1MA 1XGRA 4XP5L 4QHLA 1LK2A 4RMUA 3QDAA 1OAUL 2BC4B 4HV8A 2MQCA 2HG5A 3ZTJG 4LSSL 2J1KA 1FZKB 1KCKA 2XQYG 3B9EA 4LLDB 3B9AA 3DYOA 5CEXB 2VITA 1K5NA 5GHWL 3BYYA 5C6TH 3RGVA 2HWZH 4UQ2A 1BBDH 4CVUA 3X3FH 4NUGH 3HI5H 3U4BL 4D8PB 4F7CB 5JIPA 4X6DE 2QTEA 1M71A 3ET9F 1T80A 5C08E 3RZCD 4J3SA 5T3XD 5E99L 1QSED 4NSKA 4R7NA 4FQJH 1FO0B 4HKXA 1T66D 4KK5D 4Y5VA 5ELIA 1OGAD 3RVTC 4KFZC 4DN3H 4WUKH 4WJ5A 2IEPA 5GGVL 2VZUA 4MNQE 1F58L 4Z77B 5SX5H 3IDIB 4D94A 1JWMA 2OS7A 3O3AB 3PABA 1WUNT 3FT2B 4PJGE 1SYVB 5C0CD 2EDTA 1DUYB 4LVEA 1XGQB 2Z91A 3FO2A 3JWOC 4OI9A 3QJHB 5A2JH 2C3VA 4NKIL 4U1IA 2JK5B 1CG9B 3GMMA 2PO6B 4IHOB 4G80B 1UM5H 2V2XA 4BSVA 4GAJH 4ZS7H 3QXUA 4QRSA 2DQJH 4M7KL 1UJ3B 4QT5B 2WANA 3O2DH 5E4EC 3I02A 3KYOB 3SJVB 4HXBL 1MUJB 5D6CB 4L8SB 3RZCC 5DFVD 1RIUL 2NPLX 1ZKAA 4WTWA 4HCRH 1T66C 3NFPB 5F71A 5F88A 4KK5C 3ARDB 4OCRL 3AY4C 1PG7L 4R8WL 4OGAD 4R90H 4X6BB 1VDGA 3VWJC 3KPLA 4PP1D 2Z4QA 2BHZA 4JFDB 1U93B 1FE8H 5FA4A 3GNML 2BOBB 4MD0B 1AGCB 5D9SB 5ESAB 1JNHB 5HHPA 1N0XL 4ODWB 3VXME 3RPIB 3AXLB 1D7FA 3OHXB 4Y5XA 1EO7A 3MV8B 3WHXB 4WU7B 1IC7L 2M26A 4NKMA 4RIRA 4WVRA 1MCKA 1BVLA 4C4KO 4F3FA 4OD3L 4Y5YB 5JW4Q 2ITCB 4G5ZH 3CDCA 4G42A 1XGUA 5DFVC 4PJEA 4G6AC 3GSVB 1TCRB 4Z6AT 1ZA6B 5GRUL 2ID5A 5JOPD 1AD0B 4OCSL 3MV01 4R7DA 3B2UC 5I1AB 3OKYA 4ZUTA 4OGAC 2AQ3A 4WCYH 2LE9A 5JOFB 2H2PD 3AREB 4Y4FD 5LCVL 2EYSB 1DLHB 4PP1C 4D9LL 4X4YB 4GG6E 3NACH 3C60D 1LD9A 2I25N 1NC4A 4RBPK 5ALBL 4YNYA 3QA3B 3DXAE 1BVZA 4ODXB 4NQEA 5GGRA 3W9DB 4TSCH 5KVDL 1A14L 4XHQA 4MX7B 5ID1A 1EAPB 1K2DB 3DVGA 2VLKE 3EFDH 4HMDA 1AD9B 4V1DD 5SWZA 3I6LE 1E6OL 4J3VA 3MLZL 1NEUA 2KQNA 4MB3A 1RIHL 5DVLA 5DVMA 3FQNB 5TE4L 5C0RH 2DMBA 5CCKL 1JNNH 2CR3A 3MFGB 3INUH 5HYQA 5IMKB 3NIFE 5D7JB 3DX8A 2H2PC 4HUVB 3HC0B 3LKRA 3QCVL 4Y4FC 1KCVH 3IDJA 4EN3A 5KVGL 3C60C 2WWKT 3KPSE 3OR7B 4YBLC 1FBIL 2CLZB 2OXGA 2CO6B 4DGIH 3MV9A 4NP4H 5CJOH 3DARA 1F42A 1FPTH 5D2LB 1T21A 2NY4B 3LSOB 4M3JA 3CCHA 3IETB 2CKBH 4YH6A 4PJFB 2Z92A 3IXAB 3B2VH 4MSWB 1CFVL 3MLYL 5CZVL 4ELME 1F4XH 5FYLD 3OG6B 3TT3H 5HYFA 1CT8B 4FZEH 4X7FC 5HVGB 4BKLA 3QAZC 2ERJB 4U1NA 3RGVD 1HH9B 4WO4D 1T1WA 1HHIB 2A6DA 3VJ6B 3WIHA 3AS3A 4P99A 1BQLH 4YWGH 5T33L 4MNGA 3GMNA 1ZT1A 3L3DA 3BJLA 4P2OA 3TBTA 4NC0B 5FCUL 2HFGL 2SEBA 4K2UL 4Z7NF 2OR9L 5DHXB 4LCCA 3TA3A 4PJCB 3LY6A 3VWJB 2XZCL 5D1ZA 3NPSC 4CVXB 2WSKA 4OD2A 1OSPL 2CRMA 3Q3GB 4RFEA 4ONGL 3TESA 3U9PL 5DHVA 3C2AL 2FO4B 4WW1A 1I1AD 4L8DA 3ABZA 1LP9F 4LLUA 3UMTA 3RGVC 4PGBB 1MCIA 4LSTL 3IS0X 4OKVB 4WO4C 4ALAH 4DGYL 4XPFH 3VFVB 1FN4B 1V3LA 1X5LA 2APWA 5JIHA 4GG8A 3IDMA 5F7EL 1HDMB 2YPVL 4LQ1A 3OGCA 4GXVL 4NYLA 3FRUB 4Y5VC 5ISZA 3A6BL 2OTUB 4BZ2L 4KQ3L 4G43B 3IAGC 4LVHC 2F19H 4IOFC 1NCWH 4K55A 3O6FA 2DMCA 3I84A 4NJ9L 2NX5E 2BERA 4ODUB 1JHLL 1F90H 1I1AC 3T2QA 2DQIL 2KUTA 5TF0A 1WZLA 1N6UA 1RZIB 1QRNB 4YDKL 4DUVA 1X5AA 5DT1L 4L4JA 4GRWH 2H6PB 1U92A 1BFVL 1INDL 3ZMRA 4NKDA 2BY0A 1ULVA 4CUCA 5IBTL 3PXHA 2RAMA 3DVNB 5CINH 3C5JB 3SGDI 5DQJB 3BW9B 3UYRL 5IQ9B 1FLRH 2ZOKB 5IBUG 3RWDA 1CZ8L 5KW9H 1QSEE 1ZWIB 5MERB 4YBLB 4H26B 3QEQB 4NBXB 1NC4D 3WHE1 1WWCA 5D7LB 1SQ2N 4DKDC 1RZKH 3NMEA 1FRGH 1IAOA 3BH9A 5L0QB 5LKNA 3GSOB 5D96C 1MVUA 3BP6B 4Y5XC 3B9KA 2IAMB 2DKUA 3MOBH 4TYUA 4NQDE 4JZNA 5SWZD 4RGOL 2Y4SA 3QAZB 4P59H 4YPGB 1FVCA 3S35H 1C16B 5D72L 5ETUB 2CIKA 3GSNA 2IQAA 3IDYB 1MIMH 4QOKA 2WIIA 4F2MB 1MEXL 3VFNA 5HHQB 3NCYS 3GMQA 1PZUB 1CR9L 4I18A 3JV4A 4QXWA 1MJ7L 4X99B 1UC6A 1FFRA 5EC1A 4EN3D 1NMAH 1WFOA 4R26L 3BQUD 2D0HA 3PWNB 2BFVH 4UDTB 2LV4A 4TTDD 3PF2A 2CUIA 1WC7A 3MV9D 1O7VA 1BJMA 1KPRA 4BELD 1F8TL 1NCAH 4PJHE 4TQEL 3CH1B 3WUWA 2PW2B 1IVLA 2NY6D 1P53A 2VERN 1A1NA 4DUWA 2XN9B 4UILL 2V2TB 4O51A 1VADB 2BSTB 12E8H 5I1GL 5L8JB 1IBGL 4IDLA 3BDBA 3VFUB 5B3JF 5FF6A 5IEHB 1JN6B 1P2CB 2H3NA 5FKAB 1U8JA 1CXHA 4CAGA 2XY1A 2P1YA 4PJIF 2HVKA 2P24B 3CH8A 1S7VB 4R3SA 3WXWL 3IDXH 5JOPE 3H42H 4P2OD 3ZE2F 4NQVA 4EN3C 2X4OA 3BQUC 3EOAA 2DOCA 4EUPH 3TA3D 5ILTH 2NLJB 4LVHB 5D1ZD 2WK2A 2ZWLT 3R8BB 4G6JL 1CDBA 5HJ3A 4I3SH 2VIRB 2NY6C 5C71A 4K3EL 4QTIL 3C9NB 4G8GA 2HT3C 1IARB 3U0TA 1MRCL 3JV5A 4I3RH 1INEH 5DDHA 4YQXH 3ZKXC 3L5JA 1UZ6F 3F65A 3MRDA 2X4PB 5I8EB 5KZCD 3PP4H 3NBNA 2HVJA 3PWJA 1ZHBA 3AAZA 5E2UL 3RP1A 4DGVH 1QR4A 4LRNH 4KDTA 5K9JH 1ZOXA 1YQVH 1I4FA 1KCUH 2F53A 3D3VD 4D9RE 1P7QA 2FNBA 4P2OC 1NMBH 3S4SA 4PJAF 4X7TA 3HR6A 2M1KA 4YHNB 4S1DD 3TA3C 5ISZD 1NGPL 4DW2H 5D1ZC 2ZUWA 4BFGA 4EQ3A 5E2WH 1UACH 4OFVA 5JXAH 1XMWA 2NXZB 2H32H 2O5ZL 3WXVH 1R5WA 3O6FD 2ORBH 1YDPB 3DI3B 2GEEA 1YECH 3SKNA 1F58H 4IM8A 2XICA 4WNQB 2C5DC 5GS2D 2G9HA