1VHQA

Crystal structure of enhancing lycopene biosynthesis protein 2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
216
Chain Sequence
MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enhancing lycopene biosynthesis protein 2
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 73
structure length 216
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhqA00
3P9RA 2ZUUA 1P7YA 4D1YA 4Y0NA 2RK3A 1FY2A 1GGFA 2FEXA 2VDJA 4ADSG 1KA9H 4ENTA 4ENVA 4B5KA 3PQ5A 4L78A 2ZUVA 5SY6A 1SY7A 3B3AA 1I7SB 1C30B 2ABWA 4ZDIA 1OX4B 2W7TA 3L4EA 1U9CA 4P34A 4OJYA 3PQ7A 3ZJ4A 1T3TA 1N57A 3EN0A 1WL8A 4UCFA 4Y1RB 1KEEB 4AUMA 3TTSA 2LXNA 3F71A 3FIJA 3F5DA 3MGKA 3TTVA 5JZMA 5JZOA 3P9QA 3NVAA 3P9PA 1OX5A 4PXYA 4ENQA 3B36A 2VPIA 3NONA 3PQ3A 1QDLB 4BIMA 4MTCA 3UJNA 1CS0B 1G2IA 1VCMA 3B38A 4UNIA 4Y1GA 3TTTA 5SY4A 3PQ8A 1P7ZA 3CZ9A 3UOWA 3WFZA 1P5FA 4XLLA 3ZR4B 4ZDJA 4GE0A 1PDWA 3OT1A 1QVZA 3P9SA 4OIFA 1A9XB 1M6VB 4AUNA 4ENWA 4L8WB 2YWBA 4WXYB 3EFEA 4GE3A 4ZGGA 3R76A 1VCOA 1Q2UA 3L18A 2GK3A 1T0BA 3BWEA 4RKYA 1VHQA 5K4AA 2V4UA 2IUFA 2NV2B 2RK4A 4I46A 4ENRA 1KWKA 2VKTA 1CE8B 1GPWB 2AD5A 2WJZB 4UOZA 1GPMA 4E08A 3MIIA 4N12A 3D54D 1O1YA 1OY1A 1UCFA 2D7JA 1BXRB 1PE0A 4GUDA 4B2YA 4E5VA 2AB0A 4MNTA 4ENPA 4ZDKA 2YWDA 4L7QA 2GHRA 3R74A 2VXOA 4LGYA 4QYXA 3TTUA 3UK7A 1ONSA 1VCNA 1JDBC 3CY6A 3L3BA 4UZSA 2YWJA 4WINA 2ZUWA 4AULA 2R1TA 3OT1B 1T36B 1FYEA 3KKLA 3NOOA 1K9VF 1GGKA 3L7NA 2ZUTA 1SOAA 3SF8A 1PV2A 3VU3A 1P80A 1QWSA 4P35A 2A9VA 3FSEA 4L8YA 4P2GA 5BV2P 3SOZA 4OQ4A 4Y1FA 4BFLA 4L95C 4ENSA 3GRAA 1GG9A 4Y1EA 1QVVA 3R75A 4AJ9A 3TQIA 1IPHA 3CYFA 2ISSD 4JQSA 1GGJA 3PQ6A 4B31A 4BTEA 2XF2A 4S0ZA 1QVWA 1PDVA 2R1UA 1CF9A 2R1VA 1IZYA 1C3OB 4P5PA 3TTYA 3BHNA 2ZUSA 2H2WA 3ER6A 1I1QB 1S1MA 3EWNA 3NORA 1OI4A 4I4NA 2R1TB 4HCJA 4L8FA 3NOVA 4B7AA 3UMMA 2VRNA 4P36A 1KXJA 2RK6A 3SF8B 5DFAA 4RKWA 5SYAA 4R7GA 1QF7A 2NV0A 5IP5A 1KWGA 4UOQA 1OX4A 4OFWA 4QYTA 3TTWA 3TTXA 3EZGA 5LIRA 2YWCA 4Y1RA 4MGHA 1P81A 4AUEA 1R9GA 3CNEA 4LRUA 4N0MA 3CZAA 3PQ4A 5E9AA 4K2HA 1J42A 2R1VB 4OGGA 1GGHA 3ZJ5A 4B40A 1L9XA 3PQ2A 1GGEA 4OGFA 1IZZA 1OX6A 3EJ6A 3NOQA 3M3PA 4I2NA 4ENUA 1I7QB 3RHTA 5SY9A 3N7TA 1JVNA 3UGJA 1Q7RA 2OR3A
chains in the Genus database with same CATH superfamily
1KZ7B 5KAMA 4I4TB 4JQOA 1Z35A 2PAFA 1OLUB 2ILTA 3FXAA 4LOJA 3FNFA 2IZ6A 5EXXA 4FYPA 5BYBA 2KYRA 3VZDA 1NRIA 2WWTA 5TSDA 2H4WA 3SQDA 5K09A 5EI5A 3HO1A 5E0OA 5ALEA 4K40A 5FLYA 4V0KA 1SD1A 2HA4A 3FCXA 1G8MA 3JQAB 1MNAA 3FDXA 3RTBA 2I8CA 1UC5B 2QY9A 3O7MA 1MAVA 3PITA 1E77A 2FQYA 1V35A 5H59A 1Q6YA 4BIMA 1UC4B 1ZBQA 2C7VA 1CS0B 4M8SA 4Q1EA 1F17A 1NASA 5TQJA 4PZUA 1L1RA 2WWWA 2RBGA 3TZ6A 1J99A 5CP8A 3C70A 5IUJC 5K3CA 4MSUA 4B6SA 1NVKA 3T52A 1AOXA 1V4NA 3HCCA 5CJPA 3C7AA 1L5GB 5K0CA 3T1YB 4CETA 2GHIA 2HQOA 5BW5A 3EEOA 1RHKA 2GZHA 1ZVJA 3ND6A 1YZYA 3PK0A 4MW0A 1U0GA 4J1TC 1Y34E 1UMKA 1J06A 1YS2X 2P4QA 3ZDZB 4UCWA 4F04A 3E22A 4HQLA 3QBEA 3JQ9A 4H1TA 4ZO9A 4YRQA 5KMGB 1H3EA 2Q5FA 3R7NA 4BGVA 1V3VA 2YRXA 3FJOA 3HM2A 3KT8A 4NVRA 3J7TA 4OY3A 2PSDA 3OM8A 1XTSA 3VC3A 4UTVA 3A11A 2D5BA 3ETHA 4IDBA 2Q28A 1DC4A 3ZXUB 5LU9A 2J3EA 3RJMA 4A8TA 2OENG 3FHJA 2R5NA 1P2GA 2WDPA 2DCMA 1T26A 3N07A 1CYDA 4JI6B 1SQ6A 2H5EA 3EA5A 2CNDA 4CMBA 1EX7A 2CVFA 4TROA 4G9EA 1U0NA 3QWAA 2B3DA 3GNSA 4IJ6A 1EHCA 2Y2UA 3T5DA 2GX6A 2ZJAA 3V8MA 1E98A 4JP3A 4K46A 4TSRA 3NGMA 4ASUD 4YDQA 5ELXA 1NT2A 2BEJA 2F1KA 2FFQA 2Q6OA 2ZLBA 2FSSA 1T4CA 5H83A 2HIHA 3QTBA 2QDKA 3R5HA 3MEQA 2IYUA 4NPAA 5KJ6A 1WHTB 4G65A 3BFJA 1CY4A 3R9WA 3WDMA 3AFIA 5HEKA 5FI5A 4R0VA 5C1PA 4Z4GA 1TKAA 5J2TB 1EVLA 2CFSA 3OLYA 2MYUA 1MZPA 1RI2A 3FR8A 1GV0A 2FW0A 3JVVA 5EWLB 4RYLA 4PX5A 4J94A 2H2WA 2AYZA 1W25A 3G2OA 4HB0A 3RUHA 1UAGA 3ZW8A 3U0VA 4PHHA 2J9RA 4MQBA 4YHBA 4JUFA 4CF3A 3IOCA 2XVYA 3P0JA 4U5QA 4DPMA 4BNLA 1QIKA 3SC6A 5IVHA 1XIVA 1ZMRA 4C7OB 2F2TA 3TD9A 4BY9E 4A8HA 5KAPA 5LNK6 2GFQA 3ZWXA 2VYFA 1GQYA 4YECA 5LZ4A 4HUJA 1WPQA 1KMQA 3OTIA 3VR5A 4POAA 4MWTA 5EJ8A 4HFRA 5KC8A 13PKA 2GDJA 5FO0A 5K01A 5JNLA 3PVCA 3FCCA 4CLOA 4EHLA 2P4SA 4X66B 1FVOA 3WWZA 4I50A 3O9MA 3MAAC 4PZZA 4FTWA 3SS9X 1QKIA 4RTMA 2AEFA 2PFGA 1EM6A 3HXTA 2X0FA 2J5KA 5LA6A 2HK9A 1IXZA 4JYMA 4OXQA 1ZIPA 4ZCSA 2OYCA 4MKZA 2P6PA 4HH0A 4C08A 3ZGZA 1DWPA 1FTGA 1SZPA 2PPLA 1EB8A 2Z8ZA 3GRFA 2OV1A 3L9XA 3QXHA 2MINA 5BRJA 1PD1A 2IXGA 5K0SA 3IRUA 4K87A 1UOPA 3EXG1 3WVNA 4EPTA 1Y5MA 1BE8A 1T2FA 1LPAB 3N59A 1N57A 1SZCA 3RWMB 4C4PA 3UAGA 2Z3VA 1KAHA 3NEJA 4FHCA 4G5OA 2WWHA 4BDSA 1IPFA 3LI2A 4RBNA 2WG1A 4FP9A 1QK4A 2FX5A 5BWBA 3GF4A 3LD9A 1G5PA 3SN6A 4QBFA 4DCMA 2VSXA 3CZ9A 4C43A 1U7WA 2ZBPA 1JR3A 3PDIA 4M0FA 5B7GA 5H70A 4RZHA 4EYOA 1C4XA 1E0DA 5JZBA 5KNLA 3EF1A 2CUZA 4KIJA 3D4BA 3KFXA 2CSXA 5LQAA 1FDTA 3TXXA 1GL7A 2G09A 4IZHA 1Z08A 5BT9A 5SICE 3SIPA 2BFEB 5KDDA 3DT8A 2H63A 2XADA 3PP8A 4Q9NA 3SAJA 2Y3IA 3U3XA 3HBJA 2BISA 1M72A 1EPUA 2A1IA 3OOYA 2F8MA 4GICA 5D84A 3WYGA 4POOA 4YUZA 4I5GA 2NIPA 2IV2X 3LQ2A 5A6SB 3RS8A 3VM6A 3ZE1B 2JFPA 4BFUA 4Y98A 1CUEA 5EUCA 3CBQA 1QRDA 1NQTA 5AP9A 2GEUA 3A6FA 4IDQA 3ZH2A 3K9CA 2Q62A 3RSZA 5IKEA 1ZA1A 1P9LA 4G4JA 5CVDA 3GD5A 2Q1XA 4O2RA 1YXMA 2XTZA 5I01A 4F9EA 2HEGA 2ONYA 2NU7B 3A04A 2HA5A 2ZUWA 3NG1A 4PG6A 1FMFA 4DLNA 2NADA 4G0QA 4EZIA 2X76A 2L42A 1I6LA 3P19A 3KEQA 1W4AA 5FWYA 2PU5A 4B4UA 1T9GS 4G3XA 4DMCA 3FMVA 4RJIA 1T9BA 2EX4A 2SKEA 1GHTA 1NW4A 4NHEA 1N5JA 5H0IA 3AVYA 3IQFA 3VR4A 3UENA 1C4KA 3K0SA 3MERA 4EHFA 1B8OA 1SXJA 3JS5A 4IW3B 3IELA 1U1CA 4HH4A 5BN5B 1QVWA 2C7BA 3QPWA 1N5LA 4JEUA 4REOA 4X63A 3NMUF 2OV3A 3N8DA 2HA7A 3OZUA 4RTSA 4TYQA 4MV3A 1EUDB 4UEQA 5HP4A 1TT5A 4MQFB 1UZNA 4KQCA 5F1OA 1CG6A 1JALA 3GUCA 2ZWVA 4OKIA 3TCKA 1DELA 1E7YA 5KS2A 3SPXA 4MPJA 3LPLA 2H4JA 3LLVA 4ZYYA 1JKJB 2LNDA 3CSUA 1T91A 1UBNA 4M60A 3L6EA 4HWRA 2B99A 1DQRA 4WQMA 4FYWA 3BICA 5LQRA 1LSJA 3KKEA 2AX4A 2JHGA 2JGDB 4ZCIA 4ZVOA 4OFXA 1SUAA 3H65A 4WNYA 5JPCA 3MJ4A 3ZW9A 5KVVA 2WICA 1KGSA 5D3QA 3DDNA 1OXBB 1T0PA 3A3NA 3GGGA 2W6ID 3NRCA 3SLRA 2R79A 2NVUA 3VSAA 4HEQA 4BB0A 3SJAA 3CN9A 3EULA 4GLJA 1NBIA 4PO1A 1A2OA 1UXIA 4L78A 4LHZA 1TCUA 4CNQA 5T5QA 3B5EA 3LXUX 4PEVA 3HZOA 2R48A 2ZRCA 4L3VA 5CNKA 3EPRA 4OM8A 1BXZA 3IDQA 1Z39A 3EEBA 4X8LA 4GLOA 3MELA 3SJUA 1JJBA 2ZJ2A 4F92B 5ESRA 3U49A 1QG4A 4IWNA 4OJMX 3QX8A 4YMIA 3I3OA 1I2ZA 3SXUB 2PYDA 4GZ3A 4JKYA 3TTVA 4OI0A 1I3KA 1SHUX 3GGCA 5EE5B 5EWMB 2PNJA 3TJZA 1AGXA 3ECAA 4BZZA 2RI0A 3WKEA 4FBMA 4YA6A 1OHHD 5BNFA 3K1ZA 1XTRA 3QU5A 3T3DA 1VSUA 3ZDFA 3K9GA 2R6R1 3KZNA 3ABQB 5J2UB 4YCJA 3NAZA 5DX8A 1WZUA 3LQ4A 4NFSA 4E2FA 2H1RA 2PUEA 3R7WA 4JLSA 4EFKA 1XRRA 2P6OA 1I94B 1TEHA 3K92A 4NMHA 1GGNA 3HVIA 3AZQA 4J2TA 1HOTA 4WESB 5JC8A 4NCBA 3I1YA 4E5YA 1Y9JA 3O8BA 3BMOA 3WS7A 4CEJA 3HI4A 3ORYA 1SEVA 3DDUA 4E21A 1NNLA 4ZOEA 4BJ3A 2JKVA 3BSFA 1XTPA 2JCGA 2QD3A 1N5RA 2O5EA 4G9GA 4TKUB 1LEHA 1E1YA 1RM5A 1KETA 1OXTA 1I01A 3M3HA 1L5LA 4ALKA 4HWKA 2WC1A 2AWOA 4PV7A 4CKEB 2CVHA 4WVFA 2O8FA 2B8TA 2HX1A 1RXVA 1EVKA 2GK4A 4NL4H 1UDXA 2JLAA 2BGRA 2CZCA 1HDYA 1VMAA 4FONA 4KWEA 4C5CA 5E95A 3WIVA 3GGPA 5C4IA 2C9OA 2COKA 2H92A 3IERA 1U5AA 1V3QE 3DFIA 4LRYA 1HT1E 2B9EA 1QQAA 3UOAB 2QUZA 2IIPA 4TYPA 4PN3A 3EVFA 3KEFA 5JYCA 3AEQB 4WLEA 4KDRA 1V43A 3R4VA 1JH8A 1P45A 5C0OE 3RRYA 1ZR4A 1R64A 4L50A 3Q11A 3QW2A 2EJBA 2M9MA 2HA0A 1XA0A 4NATA 5C3UA 4W6ZA 1HH4A 4XX1A 4OLAA 2ZT7A 3DC2A 4DMRA 2HPZA 3DW3X 4M7WA 4M1OA 3IQXA 4WEQA 4HLUC 3Q7RA 3O6VA 4ZALA 3FW1A 2ADFA 1D2AA 3P4UA 4AY2A 4DWOA 2OGTA 3WRWA 4WPGA 3WRYC 2I7CA 1UZLA 3IXMA 4F3CA 1K6XA 3PLAE 4D8XA 4MINA 3NHZA 1E1NA 3NKVA 4UFPA 3L6CA 2DJ5A 1JJ7A 1CUXA 2JIDA 4RW0A 1CR2A 3LZ6A 3R8CA 3R7LA 2Q2QA 1SKUA 2A9RA 3W04A 2BEVA 1QZTA 2FEWB 2JCVA 2VF2A 4PWYA 3RSSA 3RK1A 4AZ3A 2X9VA 1DOHA 1ILEA 2Y76A 1TCAA 3ROGA 1P9OA 2ZOSA 4RZUA 3UT5B 1U2GC 4QT0A 3MFYA 4Q4JA 9ABPA 3T1TA 4FM9A 1YDFA 3K2IA 5AR1A 4MITA 1DQSA 3FF1A 4HEJA 2G9RA 1GGHA 4EJ2A 4CMKA 4MXDA 2PX8A 4OB7A 1FXUA 2HMYB 1FFYA 4CF6A 4M1MA 4J0CA 1L4MA 2J3MA 2MSLA 2FW6A 4QU8A 3DEAA 2EKDA 1JEJA 4TOIA 4U7DA 3IE1A 1X7XA 2JI4A 2PH7A 4X64B 3PI6A 4OK5A 1FDSA 3QXJA 5EP2A 2REOA 3HUTA 2YZGA 4LDRA 5BSWA 4A16A 3AR6A 2PQ0A 1TKCA 4OEHA 1YVEI 3L4EA 1DX4A 3MJVA 3KAKA 3R40A 3V7WA 4C1NA 5JROA 1C3EA 3IUSA 3F4LA 4YCDA 1BDIA 5KTYA 2WHQA 3EA0A 2HNAA 3GT0A 3T95A 2C2KA 2QA5A 3EWSA 3H1GA 4C7MA 4J8PA 1JU3A 4MWGA 2KMLA 1BGVA 1VXOA 3AVQA 1VL1A 4OOEA 4TTIA 1T1SA 2WJYA 4ZZIA 5EESA 3LU1A 2YMPA 1BA2A 4LPKA 5AKLA 2ISQA 1AE1A 3GRVA 3HHPA 4KFUA 2H07A 4L4RA 3KS9A 4DA6A 2EIHA 3F7NA 3RAPR 2XVAA 4TLMB 1U9ZA 3U9SA 1EYZA 2PZ8A 1D04A 3DBRA 1QSGA 3MT8A 1UAYA 1UWKA 2A5GA 4TTAA 2AUNA 2ENUA 4YDSA 4B32A 2AN5A 5I7SA 1N77A 1QLJA 1X3LA 3P0FA 4V2UA 5EXTA 4IXTA 3UF0A 1QCZA 5B58T 3UFXB 2FE4A 4C4OA 1GUFA 3P0EA 3UG6A 3AP3A 2WVGA 2IGBA 4R71A 1WW2A 2E5FA 1O87A 4FZVA 3E5HA 3L06A 4EB6B 1C1HA 3E2MA 1DRKA 1GNTA 4QFCA 3GZTB 2PFKA 4WUVA 1FSPA 3QF7A 4KQFA 5EKTA 3SE0A 4BQNA 1ETUA 2JFGA 4G6ZA 3DSRA 3WRXA 1AMUA 3T7RA 1UBUS 4ITRC 1D2CA 3K05A 4PONA 4XFKA 2ONJA 5J2UA 2G08A 1W4BA 3WB0A 1CQXA 4BEBA 3TIIA 2ZG6A 5JJBA 4S0XA 2DJIA 3AF5A 5GZ3A 2OXTA 1QHNA 1SURA 4YMWA 3UWOA 1PQUA 3PGMA 1MJHA 4NBRA 3RSOA 4CQLB 2JZCA 4H1UA 5BMVF 2IZZA 1V6AA 4DXDA 1COWD 5HIAA 1XO1A 5CB6A 1ZWKA 4O1MA 4IS3A 4QQNA 4XEHA 5K6AA 3CBGA 3G9XA 5A04A 3I09A 5EKDA 3STWA 2CJWA 1NMQA 3C3JA 4U39A 1E64A 2QAJA 3U56A 2C7GA 1L5VA 3AH8A 4RZIA 4US1R 4ZOLA 2IHNA 1UANA 2E4WA 1KZ1A 1AZSC 1G9XA 1XAJA 1R10A 4JYBA 1DCFA 1AKMA 1Q1BA 1U7DA 1I0ZA 1U7TA 5AK6A 3T9EA 3TVYA 4ZHQA 2XRZA 1DCKA 2QMQA 3S1SA 2JAQA 4XB1A 2Y4NA 3U19A 1MIHA 5DVZA 3RODA 3M4XA 1PSWA 1JFFB 2W6OA 4IHJB 4L73A 1FX0A 1I3NA 3MZ0A 4UHEA 3V48A 4B79A 2FEMA 2ZBDA 4PRYA 4RX1A 4UVEA 4EL0A 2OZKA 4MZXA 3IMCA 3PD1A 4QOSA 2B98A 1Z45A 1A04A 5EJ7A 4WCDA 3EGDB 1IU9A 2CXTA 1WBBA 4R1TA 2HU7A 3FNEA 4JY7A 3FPGA 1B2RA 4Z1MA 1PG2A 2ERYA 2UKDA 2JH3A 3F4BA 1JVNA 2XYVA 1XQ6A 5ILGA 4ZVSA 3U4QA 4MOWA 1P8JA 3MUFA 1Q16A 4R8SA 1Q3HA 2IW3A 3T1NA 5B12A 4MRMB 1Z15A 1ARZA 2IYRA 4IFTA 5HM6A 2ROQA 1I13A 1JZTA 2XWSA 5ITZA 2V74B 4Z86A 1C14A 1JMYA 1Q0TA 2H2GA 2GCGA 3MGCA 5IJZA 1ST2A 1R6TA 4FEYA 1BXRA 4PBTA 2QRQA 1U8XX 5A2QA 4E5SA 2X5OA 4IDEA 2NUTA 4PLZA 4GBGA 2ONKA 4NABA 3O2QB 2ZE5A 4AYXA 4PICA 2VHJA 3C8DA 3TRIA 3AGPA 4Y7DA 4M88A 4UMEA 5JAHA 4DRYA 3Q85A 3ZWPA 5U9CA 4RTOA 5EGNA 1N7IA 5CW1A 3DYVA 3AX6A 3THSA 2GAIA 4MB6A 2HBRA 1NU8A 5AKXA 1F9AA 3I2HA 3AKZA 3ANMA 2CN1A 4Q9LA 1IUPA 5FF9A 5EN4A 1GAJA 1FTYA 1PJLA 4PYQA 4H6WA 4BP8A 2V5AA 1ZM2A 5FPYA 2WMDA 3FA2A 1DKRA 1K7CA 3PKJA 5F9HA 4GYJA 1DEHA 4EMSA 1SKQA 4I8IA 4W82A 4DG8A 4YJ2A 4BJ1A 4EKNB 5EZYA 3T1OA 3CUVA 3QKRA 5ALWA 5T3UA 4C0LA 3L1JA 4J0GA 3ND5A 5T4EA 4DMMA 5K7SA 2VHVA 2FJ0A 2OTCA 3FCSB 3RFUA 4C0AC 2GN8A 3JQBA 3VC1A 2YMLA 3HWX1 1IM8A 3OIUA 3V34A 4TLAA 4CJXA 3ZI4A 4K9QA 3GLFA 3BM5A 1FRQA 3I0MA 2P9BA 3QE0A 1QWSA 2JGEA 3ZHTA 5K3BA 1U2ZA 4HTFA 1SU7A 3FSEA 4AIIA 1Z2DA 4H4DA 2BC9A 4HZIA 3VPSA 3EOBI 3ZI7A 3VV2A 1E3WA 3B3GA 3K53A 3RGGA 2E9SA 3V4PB 2XBMA 3DFZA 3NC1C 2X22A 1TCCA 1LJ8A 1KY4A 4FOSA 1D2NA 4WZAE 1OZHA 1YJCA 1K5HA 4ZFNA 2QR2A 3X1KA 4LY6A 4PLCA 2JARA 2WYUA 5IJ9A 4X45A 5AHKA 1ZGZA 1KIMA 5ALXA 5ECYA 1VSBA 3G0DA 4KGVA 3C3YA 2BF4A 1SBHA 1YCGA 4ROSA 1R0WA 1NG9A 4MAMA 1M6WA 1YMUA 4LXXA 3BMQA 2GPTA 4DIDA 4XWKA 4LF6B 2VR1A 2X41A 1A9TA 2HHAA 2XUHA 4BX8A 1E9VA 1EGQA 2QX7A 3O31A 2F48A 2XB6A 4DTIA 1QCYA 1BA3A 1C5KA 5EEHA 2PJDA 1UMDB 3UW1A 1XZPA 3RANA 2Y68A 3KZKA 4C4RA 3UXYA 2GZ3A 4DR5B 1H6CA 3ESCA 4MGHA 3JWJA 3LHIA 3W1VA 5CXXA 2D0DA 4QYSA 2OYSA 4GXQA 2ZT8A 3STVA 4FR5A 3TL6A 3E03A 3DM9B 5ALSA 3E7DA 3RQIA 3S2GA 5ITSA 3F5MA 1YZUA 3FCEA 3V42A 1Y8RA 3NOQA 3ODPA 4KGZA 1S2OA 2QG4A 3I76A 3WO1A 3QBTA 4ZK2A 3VOTA 5JNTA 4WOKA 5B53A 1D4FA 3IAEA 2BVNA 2OL4A 3OUTA 3HCWA 3S5JA 2Q46A 2ZUUA 4FLFA 2ZSHA 1JG1A 1U3WA 2VDJA 1SVOA 4TMZA 4O2AB 3N5KA 2XTAA 4OBBA 4H0NA 4ZAZA 4C4ZA 4YMUA 3H6GA 2KBFA 1JHXA 4R9SA 1SKMA 1Q74A 5ALQA 4BGEA 3UT6A 4N5MA 2XQFA 2XUJA 3TDMA 3QSYA 3JVUA 1DWOA 4CCAA 4UUNA 1QQBA 1SXIA 5JEEA 3G2HA 1E6LA 5EG5A 3N6RA 1O94A 4F4IA 5KNBH 5L7TA 1E96A 3OJWA 1C9NA 1GNSA 1PZGA 4IUCS 3TLCA 5J23A 4DIMA 5AOBA 4M1WA 4K03A 2I62A 1I4OA 4C7OA 2C20A 4KREA 3T3HA 4QFDA 5CM8B 3L7IA 1CETA 2XB9A 3A4MA 1NF2A 2OCAA 3PZRA 3RVLA 4C4AA 1KO8A 3NHAA 4EVSA 4ARVA 1YQEA 2YWBA 2H08A 4R8VA 3SM3A 5JH7F 5K0FA 4Z5XA 2CCJA 3BWEA 2O0KA 1J8DA 3ZQ6A 3FETA 3N2ZB 3ED1A 4X20A 1K1EA 2I7VA 5T41A 1NIJA 1Z12A 4P5DA 4RQBA 5FL7A 4UHDA 1PNTA 4AO8A 3O3OB 3WB9A 4Q1CA 2V45A 1ZH2A 1SCUB 3CR3C 3CUEF 1AQYA 1TZCA 2WG2A 1GTZA 2DBYA 1DKOA 3M4NA 1UBHS 1UMCA 4ZVMA 5C81A 3I39X 3LFUA 5L4SA 1T4DA 3UA3A 4ARSA 3EVZA 2VK8A 2ZSAA 4WZBA 5BSHA 5CBKA 3KVYA 2K2WA 3W6PA 1HEYA 3ID6C 1LS1A 1GV1A 5BURA 1GNLA 1OBVA 3LBYA 4QWWA 5HKKA 2VZ0A 4Q34A 4KQIA 2NZWA 5DK6A 3PUYA 1GPNA 1E9SA 1S02A 2EOAA 3VR3A 3AY7A 2FGJA 1OWPA 1SU4A 2WI8A 4TLEA 2WLSA 1A88A 1KI6A 4NF2A 1QFXA 1I3LA 1P1CA 1R5OA 1RWMA 2WHEA 3E7XA 3BZWA 3QX3A 3I6QA 2DUMA 1KJQA 1S2LA 1SCNE 2I34A 4KJXA 4YRFA 4DB2A 2IZ0A 1V9CA 1HE1C 3UC9A 2R1UA 2DOKA 3BIOA 4NCJA 1TU0A 3BREA 1QDUA 3IC5A 3LDFA 5C5CA 5JRZA 4LF5B 1FFAA 1VI5A 2CNLA 2PKQP 3ZWVA 3HVKA 4PNHA 3UHPA 5IVPA 5TPZA 2MDTA 2H9YA 2ZT5A 5J1SB 2BTEA 1NQVA 3TNYA 5JY1A 2WHXA 5IUKC 2IWRA 4A6PA 3TAUA 1GVNB 1B0ZA 5CX4A 2FSUA 2N3ZA 4Q3AA 1N2ZA 1T6YA 1TRKA 4PBRA 1IEVA 1MJGA 1OC4A 3YASA 1I8TA 2XTMA 3GLHA 2YWCA 3F67A 4A03A 2YIJA 3Q1LA 3QMPA 4Y1RA 4HO1X 1FLDA 3R3YA 3N9IA 3LIPA 2E4AA 2ZRPA 2R25B 4RENA 5ALUA 4EAAA 3PF8A 4Z49A 1NI5A 1I2DA 5KOYA 1MMFB 2YKGA 2X1HA 4KH1A 3U7EB 2GMWA 3FY4A 4NJMA 3ONDA 3FOAA 1EXNA 4PWZA 3X1YA 1G21A 3R9XB 3OF3A 1T9AA 4P31A 1XPJA 3LWNA 3UAZA 3MAGA 4FXPA 4OHRA 4RKQA 3EC2A 5L53A 3DO6A 3FHCB 3OFSA 2MSKA 2VUHB 1P5ZB 4UBOA 1T4BA 2QOEA 1L6IA 4EYKA 4RD6A 1EA7A 3E9DA 2LDBA 1TNDA 2EEPA 4LSGA 2CL0X 5MN4A 4OAPA 3JZAA 4MI6A 5EZQA 4E22A 4ENVA 4OFBA 4JKIA 4PGAA 4M21A 1IIBA 1PR5A 4C20A 5LP6A 4JBIA 3BCRA 3N2IA 3PUKA 3RROA 2IEZA 3QFCA 3OE1A 4RELA 4XD2A 2QZ9A 4MQMA 1YONA 1AXGA 1I2CA 1IEXA 3BE4A 3C6YA 2X9NA 2CXNA 3PLRA 2X8AA 5H80A 2R6JA 1E4EB 4LTNA 1CUIA 1WM1A 4GR9A 4BO9A 4DXHA 3H99A 3L0OA 4F3TA 4G26A 4L4SA 2PKYX 2QTTA 1XVLA 1IEWA 2XNSA 3QIVA 1WETA 1LBSA 1MIOA 2YWHA 1EDEA 4EB8A 2WJ3A 3QV2A 2YFYA 2X5JO 1RKQA 5DBIA 3F8SA 4PHGA 1YJXA 4J07A 1ZW6A 2BKUA 5ALFA 3TW8B 2IIVA 4MVJI 3SZMA 3GIWA 4L3OA 4EBFA 4NNJA 1W0CA 3CLUD 4RU1A 5KTTA 4EX7A 1V5IA 3T3EA 4RLHA 2JLWA 1ESZA 1QZZA 2W48A 1ZX1A 2VKTA 3WWDA 4ZCMA 1XKLA 1NW8A 1XE3A 3AI3A 4M9RA 1UK9A 4ZOQI 2M6KA 4LV5B 4YT2A 5BSEA 1PE0A 3CPJB 3I2FA 5EOVA 3NDIA 1TLTA 3RIHA 3ZWCA 5TGTA 4CEIA 3ETDA 4GI5A 3RTCA 1DS6A 4ISBA 4R2IA 3WDSA 3K9FC 1COZA 4FE7A 4HN4B 5KCZA 3PR1A 2UYYA 4O8ZA 1ILWA 2X0KA 3GA5A 1CULC 3KKLA 1OROA 5FNVB 2EWMA 2ZUEA 1DJNA 4GMGA 1YVRA 4DDWA 3BQNB 1TE2A 3V3KA 1NE2A 3TW6A 3OJFA 5ALNA 4BMCA 5IANA 1XAHA 1B0PA 1TO6A 1M74A 2FF7A 3PPIA 1DE0A 5BUZA 4XDYA 2KBEA 1O8BA 3F5SA 3FYUB 1N2XA 2A9QA 3VR5D 1OLXB 1U0TA 1A8SA 1NJ1A 1HYEA 2Y6UA 3KXIA 3U80A 3VO8A 1MA3A 1HRKA 4RPKA 2DC1A 1CLUA 4EBBA 3DOEA 4OHUA 5EIWA 4ZN6A 2F55A 3Q3VA 3S7TA 2C58A 2FF5A 2ZPTX 1PHRA 1Z83A 2BF7A 2OCIA 4LVCA 3DXFA 4GMKA 2O3QA 1CNMA 4RIHA 5A0FA 1USWA 5C1OA 1D8TA 4YCCA 4W99A 1EEXB 3NM5A 7ABPA 2Y99A 1UOEA 4BECA 4KIUA 1OA0A 5TARA 2ZSDA 3C97A 2OHJA 1MHTA 2H8KA 3IP8A 4IH9A 3O8RA 3G7SA 4KN8A 2PXHA 2V8BA 2J5XA 1PGPA 1TZKA 4O2BF 3ZS9A 2CXUA 2HRRA 2PX6A 4DLAA 2RH8A 5FCDA 1MOSA 5LOVA 4AUEA 3UH0A 2O5RA 2GK7A 2XW6A 5E8JA 3PGKA 1NQWA 2ZAIA 3RVKA 1WMSA 3A1WA 2Q3HA 3ONWA 4LSMA 4E11A 1T1RA 3R6DA 1LPBB 1XKQA 1JDVA 3IIIA 3NASA 3AHHA 3RSFA 5AIBA 4EO7A 1JA9A 3H1TA 1WDWB 3ZHZA 3PA8A 3LPAA 4NONA 2FA9A 4YS6A 1GAWA 1GDDA 5KTMA 3BXPA 4MYRA 3AKCA 4FNAA 3AEKB 3QF4A 2I1VB 3PJFA 3BKXA 3KZCA 1RAHA 1AZWA 3ZHSA 3HFGA 2BFMA 2X3YA 4C05A 3PE3A 1XQXA 3TPCA 1IQRA 2CYCA 3ICOA 3Q7PA 5DNVA 5JS2A 1SVWA 3ANTA 3ZE9A 4EJFA 1Y8ZA 3M4JA 4B81A 2TMDA 3H0EA 1T2VA 1M3SA 4MQ6A 4Y18A 2X40A 4MCJA 1VBFA 4EQ6A 1L8XA 3IAHA 3T99A 3I5UA 2LUOA 2YXBA 4RA9A 3UA4A 4EYGA 1WW3A 3RSHA 2K7FA 2VXCA 3LX6A 4J16C 4KXLA 3CX3A 3DULA 4BVHA 2V7WA 4UM7A 5LC1A 4BZQA 2QD4A 3KL2A 4L57A 4BLWA 5B4VA 3SGLA 3FPKA 3PXXA 3C74A 2VAPA 2XXAA 4MUBA 5DDIP 3UXEA 3OMXA 2PD6A 3Q7QA 2FMIA 3I0NA 5CDHA 1SXQA 5T7BA 2XDAA 1JYSA 1ZAKA 1OKKD 4RAQA 3VR4D 2C82A 3Q2OA 5KVQA 3WBJA 5DLEA 2PWAA 2PPVA 4LZPA 4O4LB 1TM2A 3P94A 4ER7A 2WAMA 4L8LA 2YJ3A 1CW2B 3H1PA 1L0BA 4MVJF 2DR0A 2GJ8A 2GCOA 3GJ6A 4P3NA 3WGKA 3TTUA 2WIAA 1UINA 3BH6A 2FDCA 4G01B 1L5WA 2Q41A 4GP6A 2DKOA 5FTMA 2JFVA 1UAAA 5L3SB 2HFJA 2O8DA 5FUWA 5FKJA 3W8EA 1R8XA 4DJ5X 3E58A 1YL7A 2Z2YA 4S04A 5BV2P 5FUQA 1SUDA 2ZR8A 5HF8A 3UFBA 3OKCA 2ZTMA 3PCXA 4IUYA 4PW0A 4RF4A 4CCYA 3E7WA 1SUFA 1MO5A 4ZIRB 1L1QA 3HH8A 4R01A 4DM3A 2VH1A 4WASA 4H18A 4IM7A 1XMQB 1OBHA 2ENWA 4PO8A 4PN7A 1C3OB 3QQPA 1B2LA 2BFBA 3FH0A 4MVJH 2P79A 5I45A 1AK9A 2WUGA 3GQBB 5ALDA 4A5SA 1G291 5BR8B 4UBJA 5LN1A 3EPLA 1TZJA 3AIOA 4ZARA 4IDCA 3WWPA 3RVDA 3I42A 1GAEO 4RULA 1N9KA 5B7PA 3QGMA 4JC4A 1M2KA 3TLGA 2W93A 1BE0A 2WM9B 4DPLA 1MH1A 1Z0AA 2C2WA 1OX4A 5PNTA 5CA1F 4LZOA 3VZSA 2P40A 5GY7A 2B4YA 9MHTA 2FR8C 4Q18A 3KKQA 1RYZA 1UWVA 3QEJA 3R5JA 1IBCA 1DOZA 2QR3A 4RJTA 3H1FA 3TOZA 1ULTA 4A82A 3JRWA 1EWRA 1ISPA 2ARKA 1M7HA 5I7FA 5IC6A 3HNRA 3UIEA 4WK4B 3WHIA 4EG8A 1KR5A 1P5JA 2ORED 3TK1A 1P5FA 1N6OA 2YX1A 4NEQA 1FRZA 4JI7B 5FHQA 4QJ5A 1ZHFA 1VJ1A 4UU1A 3BB3A 4GGPA 3UMCA 2WM8A 4K1LA 2DPYA 1YR2A 2RHOA 3T5GA 2PAAA 1I7SB 2W22A 4QGAA 2HU8A 4X3OA 1BEEA 2O5CA 2PQ6A 3JRNA 3R1IA 3BGWA 4P84A 2WNHA 1BD4A 2YV1A 2E3JA 5FR1A 5TGZA 1IOWA 4AUMA 4DCSA 4PC7A 2XA2A 3FWZA 1MFPA 3MGGA 4FI3F 2XE4A 4L0DA 4IMJB 1XRMA 2R4TA 3ZHYA 4WN9A 3SSMA 4ENQA 3MCTA 4I3FA 3VJLA 2AX3A 2WY2D 2XGMA 1IG3A 4QXQA 4FX2A 1Z9BA 4ZU1X 3SBXA 3ZLTA 2PFSA 1CDZA 2LKCA 1EGMB 1ACLA 1Y4DE 2CLLB 3EZLA 5DGIA 4NU0A 1KHHA 4RA6A 1JSLA 2FR1A 1GEEA 2TECE 4EPYA 2W98A 3QK7A 4FN5A 3SIRA 5IDWA 3ZY4A 2IY9A 3AK4A 3NH6A 2E89A 3IYLW 1LI7A 2R6FA 2X2FA 3KR2A 5D5HA 3M3DA 2V4UA 3DFMA 4B3SB 1U8TA 5TE9A 1AKRA 3LY5A 4PFJA 3V4ZA 4BWVA 1XG5A 2X9GA 2V96A 2UYOA 1Y81A 2VCYA 3EY9A 1VE1A 1YA8A 2GH1A 2DU8A 3HNPA 1CR1A 3OOWA 2QM3A 2XHZA 3QELB 3OOJA 1XTVA 4UE3S 5CK4A 1GCAA 4ZQFA 3TZEA 4DY6A 4Z7OB 1YS7A 2I2FA 2OAGA 5AM3A 5CG1A 4LE0A 5LQCA 1B93A 2EJTA 1NSYA 3QKIA 1X8JA 4MPRA 1Q0ZA 1C8BA 4BLRA 5LMZA 1GTRA 1A1VA 4HGZA 5EFZA 2RCNA 5AICA 1DKLA 4FC7A 3RVMA 3GY0A 3WKDA 2X0IA 1L3BA 1N1EA 3GAZA 1UPTA 1E7RA 5LCXA 4Z4HA 1PX2A 3H0CA 4DLYA 4L0CA 2EATA 1M5TA 5GM1A 1DAPA 2QE7D 3L05A 1THZA 3K0FA 4FE3A 1YRAA 1OR8A 1HDOA 3D8BA 1JE0A 2QK4A 3BFXA 1XRPA 4PS1A 3ZEIA 1M1NB 5BQPA 4Z4FA 3H04A 3U5ZB 2YVAA 1RI1A 4EQZA 2VUIB 5AXBA 5THQA 2QMYA 3CCFA 3LBAA 2V6BA 4JZKA 3JQPA 4CKBB 3LLCA 1FS5A 4OX9Y 1NOIA 1I9CA 3T35A 3UAXA 3GYBA 3NX4A 2C2HA 2J0UA 4Q05A 3FM9A 2WVHA 3WMXA 4A92A 2QZ4A 1TGYA 1CUDA 1XU7A 3FTQA 4G5QA 1Z2PX 2A5FA 7REQB 2F1OA 5KYTA 4NBNA 5DM0A 1CNFA 3D5TA 4X54A 3U7HB 4G5SA 1A5TA 3RU2A 3NHLA 3LLMA 3V2IA 1XZJA 4P6VF 2OGZA 3URKA 4C0QC 1J25A 3SYKA 1NVAA 1NN3A 2ZIZA 5C8XA 2R86A 3I30X 4Z4EA 1EGVB 5ALRA 3WNDA 1F38A 1SUEA 2DHEA 4MV0A 4U2KA 2YZMA 1TQ2A 3RYCB 4I2NA 2FW1A 3PWSA 3WQQA 4QATA 1JF8A 1Z5VA 1ZOLA 2IPNA 3HVUA 1LWOA 1YZQA 3FZGA 4HQKA 3IVRA 2FRDC 3G1TA 2FN9A 1U90A 3D1VA 1N9ZA 3EHDA 3H16A 3JR3A 4BUJA 1ANKA 1G1MA 4MYDA 2C2ZA 3H9BA 3OA0A 5KPDA 3B60A 3BAZA 3QTLA 1K5DA 1KJ9A 2PL9A 2H31A 5CGQB 3ASUA 1I1HA 3OZVA 2VHUA 4P0QB 1X1AA 1O5OA 3LYLA 4G4GA 2WTUA 1NV8A 3JTEA 3WMEA 4O08A 2VPXA 1JXAA 3HN2A 2OAEA 4RTRA 2O2HA 1KRXA 1QS0B 2FPXA 3C5WP 2CJXA 1CDDA 3FYCA 2JFYA 2J9YB 2J9XB 2W5UA 5F23A 3HKBB 3K3PA 2R6AA 2IH5A 1F8FA 4AI6A 2EQAA 5B4UA 2C4NA 2QXYA 5EXEA 4OA5A 2OBYA 4BO5A 4DBVO 3NYWA 4FINA 5B37A 4DIEA 1T1GA 5JR3A 5LPNA 1PVVA 2O50A 1NVTA 2WKSA 4AP6A 4C03A 4RJLA 4KWTA 4BP3A 4R1UA 3BD8A 4LNUB 2D8MA 3IQZA 3CCBA 4MDFA 3C6KA 1ZN9A 1VB5A 4FFMA 2R00A 3JSXA 3W2HA 4ZZ0A 3LXXA 5JMOA 1OI7A 2CFOA 3QI7A 5KYXB 1DJLA 3PC7A 4W5QA 4KQXA 2CV2A 2A7QA 3IIJA 1KGDA 4NOJA 4ZRMA 3WQSB 3ZWQA 3VNSA 5JSQA 2M6LA 1PR9A 2RHMA 4MJLA 4L7QA 1XJ5A 3DP7A 5E38A 5FWAA 3STXA 5CFPA 3U3OA 4CKZA 1I7LA 2A67A 1CYEA 4TT8A 1V16A 4TN1A 2VHYA 1VKOA 2KX7A 1J2UA 2WJHA 3U3ZA 4HDQB 3E3AA 4G4SO 1J20A 2PM8A 2A78A 3OC6A 4RMIA 3WE7A 1P1FA 3DZBA 4B2LA 5BVHA 1P2UA 4YBRA 1KFJB 3MVEA 5T6BA 5CBPA 4BNYA 1PFKA 4KQHA 3PEWA 3DOCA 4BNHA 1EQUA 3MD0A 1UEIA 3L7BA 4RIGA 3K15A 1Z0JA 3JTMA 1ZAYA 2HMVA 3L40A 4XI9A 4E1AA 2GPBA 5FTWA 2J6CA 2PXAA 3SWWA 3FOEC 1QV6A 1HZZC 2AL7A 3MPUA 3KYJB 4QAJA 5KOJB 4AJJA 4MQEA 5K8IA 1XNQB 3MJDA 1G8JA 2P1DA 3ELWA 3H8JA 2G76A 5D51S 2RGAA 4W5OA 1R0CA 4LZZA 4Z1MD 1XPUA 3EUEA 3C3CA 5HRCA 3ZE7A 1P1BA 3RGWS 3ZWKA 4MR8B 3WADA 3DE5X 1Z2NX 2UXCB 2HRQA 4EEXA 3PEFA 3GI1A 3LHDA 1RBQA 4GXTA 1R15A 5KYWA 4HNVA 5KO2A 3OIWA 3OQBA 4BNDB 1LVUA 4MJ7A 3ELBA 5PGMA 3IAFA 3IPRA 3CVUA 1EK6A 1MC4A 1NM5C 2BM9A 2FJUA 3A4NA 3OZTA 5L45A 1P1HA 1E1LA 4Q24A 1Q1AA 2RHLA 4N0MA 5JDIA 4CFSA 3IBGA 2W00A 3Q9LA 4PSAA 1H4VB 3HXPA 1JEQB 5E6UB 2ACVA 3FOZA 2YDXA 3CZ4A 4YT8A 4TYYA 2Q50A 3CWCA 5FOVA 3IUEA 4I6GA 3CX4A 4DQ0A 3CVOA 4L4UA 3W4IA 1K6JA 3MOSA 5THXA 3AUXA 3ETLA 5HQ3A 3LJKA 3THYA 2ZCJA 2WD8A 3OP1A 4HVTA 3DOIA 4HS4A 4IOKA 2C5LA 4LOAA 5F7JA 1DAEA 4R16A 3IP7A 1VJGA 1DXYA 4LJ7A 2BLNA 5FQOA 5TLSA 4UQOA 2EEZA 1X7YA 1PYOA 1J2TA 3WISA 1ABBA 1S3SA 4YRZA 2GJ9A 4ZZ1A 1IXKA 3MGKA 4BLOA 1DHRA 1DQNA 3JR7A 1QMGA 4O1IA 3I5XA 4PXYA 2ZIEA 3TNLA 2HMUA 1DARA 3KKOA 2RC5A 3PHBE 1OPRA 2BMFA 3KZXA 3QOXA 3VPHA 2BD0A 4BE7B 3UH1A 5LDHA 1XZMA 2P0AA 1U5BB 3QHPA 2GKSA 1NQAO 4Q9IA 1L7RA 2G63A 3L7AA 4LE1A 2VI5A 3S81A 3B7GA 1Y3AA 5DHFA 4Z9YA 3GLFB 2OHVA 4BO4A 2FJPA 4BTLA 5LSAA 3P96A 4PHFA 4B8WA 1G6HA 2XDQA 1NTOA 2J0VA 3CA8A 5AH0A 4UUBA 4R51A 4UCQA 4CMHA 3O90A 2JFXA 2O2ZA 4LAFA 4M8LA 4YP9A 2E0IA 5A5FA 5TMEA 5FH9A 4H77A 1R9MA 1JMKC 2XZDA 2ESRA 3B1JA 4FXOA 5L4NA 4DDHA 3WC4A 1C9DB 3AUYA 3CLKA 4OMUA 3M7IA 1AKQA 4Q1BA 1W34A 1PNVA 2GPNA 4O33A 4GFDA 5GV8A 3TLYA 1UJBA 4N39A 4DR7B 2I4MA 1B8UA 4E15A 3BS4A 3TSZA 1XNJA 2VIIA 2D1SA 4XRGA 2EP5A 3IUPA 3I72A 1QOQB 2VF5X 3DR3A 1BE1A 1KRHA 2EAUA 4MUMA 1KOGA 3W5IA 3W7BA 1U8AA 4BGUA 3C8HA 1MB2A 4U2FA 4BU0A 3MIZA 2REQA 3W9YA 5TVKA 1HV8A 3HA3A 1N2CE 3LUBA 1EI9A 2PANA 3UK0A 4I36A 4R6XA 1A96A 1ADBA 1WNFA 3KQHA 1RT9A 4IQ0A 3E22B 1NPDA 4GL4A 3QVJA 1D4OA 4D0LB 1QO0A 2IH2A 2C3PA 5HZHA 3KU4A 2HDOA 4KE6A 3V9AA 3RJTA 4AKGA 3LV8A 2J5QA 1SBNE 3F5FA 1I7NA 2NO9A 2ZRAA 3HVHA 3KZOA 4I1UA 3K9BA 4MMZB 2I87A 4J1SA 4WHMA 1A9RA 2JGIA 4RLSA 1X19A 4H7HA 2QJFA 2Y67A 3WI7A 4PPNA 2A57A 4EL5A 5JPDA 2V1UA 3ZCQA 3BH7A 1IOVA 1HETA 1M34A 1PK7A 2AUTA 2IUEA 2HDWA 2NTJA 3GN1A 2HTEA 4OGLA 3U09A 2OCYC 2QTRA 4YALA 4E4YA 1CUBA 4K9OA 3REQA 1S6YA 2CSUA 2ISCA 4J9UE 2VTKA 4UTNA 5LVAA 4D02A 3WICA 3MGAA 2VJOA 4K28A 2X5NA 4RZSA 1T4CB 4L5BA 1J49A 4MMYB 4YJ3A 3EZGA 4WK6A 4TTSA 4DABA 1KAMA 1VMKA 2NTYC 2IXTA 1TK2A 5HIIA 1M0SA 2G67A 3IXLA 4JLJA 4YV1A 3IBCA 1PP4A 5HK9A 3WYBA 1AURA 1HM5A 2HIAA 1A9QA 1HMPA 4ZI2A 1MEOA 4IOJA 5DWQA 2Q9CA 2KLHA 1H8EA 1Z13A 2IUYA 2R85A 3OUZA 1U9YA 3ITKA 1IZZA 4KE8A 4MIKA 3VH2A 1I33A 4JUCA 1CQWA 3L93A 4F11A 1E5XA 2GAAA 2CFRA 4QOJA 1Q7RA 3A2MA 4UTPA 5KTOA 3B70A 4KW7A 2LE0A 3TYXA 1YI8A 5DYYA 2QL7A 4K81B 3ZDCA 3R3SA 2VZLA 4ERNA 1QHGA 3SQNA 4ZT2A 3EVEA 4D0GA 1GZ6A 3INTA 4J0QA 3QFTA 1NQ5A 1QQ6A 1C9MA 1CY2A 2WP0A 3KAQA 2XWJI 4FYMA 5FL7D 2VQDA 4QUKA 1B6GA 4MJ3A 2R3SA 4J6FA 2Q5HA 2GZRA 3IUQA 4NDZA 3WYDA 3NTXA 4OGKA 2XE8A 1T0HB 3CH6A 4MAAA 4W6QA 4CLOB 2VP4A 3EUFA 3H7AA 1XMSA 3BGDA 3LDUA 1CDEA 2B7CA 2CXPA 3AFMA 2FPIA 2AKYA 3DFFA 4MGYR 5DPMA 3MTAA 1Q83A 2I2DA 4FD3A 2RBKA 5LA6B 3C15C 2X19A 4PZDA 4B76A 3OIFA 5CT9A 1U7PA 5KQMA 4GM0A 2MINB 4TWBA 4FMDB 1AB6A 4ZQHA 4Z9XA 2OWEA 3ES9A 1BKYA 3G49A 4AJLA 1WXHA 3AT1A 4KAFA 3EGWA 1WF6A 2PUHA 3C5VA 3QOYA 1FTWA 1YKFA 1U0SY 3TSAA 1GPYA 4MKIA 3I1IA 2P67A 2UVQA 3I6IA 4ESVA 3ZIUA 5CDGA 2XZPA 4JGBA 4XSGA 5A6VA 2VXOA 1VCNA 1FB5A 1YAHA 2J3IA 2IBMA 3EGVA 4MB0A 4D4GA 1QAOA 2I22A 3PDIB 4ZYVA 4H3KB 1AGRA 4FR2A 1ZUD1 5C7YA 1VC2A 5TPZD 2ZVJA 3SDZA 3USES 1YFZA 1TEXA 4IIYA 2IHVA 2VJBA 2D5LA 2V7UA 1DEOA 2H6EA 2HF2A 4R8KA 1KORA 2JW5A 1A2KC 1YRYE 1JIXA 1G8HA 5A0VA 5EJ5A 2BCGY 1K0UA 2OOKA 2G9UA 4QSHA 1FSFA 1FX1A 1P4AA 1HC7A 3CRVA 4KYIB 4CMIA 5CLJA 3V32A 2ALJA 4DAEA 1VHDA 1XMPA 3ZPXA 1HOXA 2X3UA 1BKSB 3K96A 1O0SA 3ZV3A 2EKZA 1GQFA 3MILA 5LU8A 3WL5A 4CF7A 1K7YA 1Y7TA 1QWOA 3A4IA 4IGKA 1KBZA 2WE8A 2BMEA 2E4XA 4NR0A 1GUDA 4LDJA 5BN4A 3NV7A 4ETIA 2VF7A 3TI9A 4YRTA 1EFRD 1SQGA 1FNNA 2IU3A 4KPYA 3HCRA 3IEVA 4L8FA 1ZGJA 4EA7A 1ECBA 5FWYB 4F6RA 2MHCA 2RSLA 4BNIA 5B6JA 5IYZA 4I2VA 2QE6A 3E23A 2WFLB 1TQDA 4S1OA 3T0IA 1HI9A 3S70A 1E5LA 2A0WA 4FFNA 5AW4A 4ZYXA 2XMBA 4YGXB 5IT9A 3VX4A 2RGWA 4KN5A 4JUDX 3T7DA 4H1WA 1SN7A 1SXJB 4PTYA 1GADO 3TG2A 3OZIA 2G40A 2NZJA 1BVRA 1EUCA 1SUPA 2IEIA 2YS7A 3GJRA 3OT4A 1E6MA 1M2VA 4NP6A 1QBGA 3OZBA 1N6HA 4JX9A 1V71A 2D6FA 4WA8A 2PKCA 4Z51A 1O2DA 2QSZA 1O03A 1Q11A 1DO8A 2CFCA 3FR7A 1F06A 1MB0A 1P61B 1P1IA 1TT5B 2W2QA 4TKZA 4MRAA 1K3UB 5EZ5A 3V1YA 2NAFA 4Z3OA 5FAXA 1GZDA 1S3FA 1VKZA 4KI0A 5GJVC 1GPDG 2C8JA 3V1MA 2MSNA 3OEEA 4TLCA 2VPZA 3A37A 4MIEA 3TKAA 1IULA 2J7PA 1O0BA 2A1TS 2ICAA 4EUNA 1O54A 1OFTA 2P9EA 2QF7A 4R2JA 4U2EA 4M87A 2IHYA 4JVOA 2AJBA 1YOBA 1XLVA 2JJ1D 3AVPA 5CJ2A 5EE9A 3C24A 5ULLA 3L8HA 4L15A 4OVKA 1VCMA 1NFQA 3FRIA 2FETA 3LGAA 3ELYA 5FP0A 1NVWQ 1CY6A 3VUFA 2ZTSA 3PQ8A 5C4MA 2CLOB 4MV6A 2NVUB 1EFHA 4OATA 1PDWA 4BRWA 1IWBB 2FZ5A 4K1XA 4LECA 2BMVA 4AUNA 3OJLA 4G5YA 3O93A 4LCEA 4UCXA 1PX0A 2DUUA 1J70A 5TVGA 2MR6A 2GBLA 4EGAA 2Q7XA 3RJZA 3JWGA 2IUFA 2VDWA 2VPTA 4ZVPA 3B89A 1CFJA 4AZ0A 4YASA 1R5BA 4JBGA 3QVMA 1PZXA 3RYFA 4IXNA 3HABA 1YGYA 1P5HA 1NZJA 2F3QA 3G8YA 3OM1A 4GQAA 4MW5A 4WA7A 1SAYA 3DE0X 5CX1A 5ALGA 1F7VA 4F9FA 1E8DA 2ZRBA 3AY0A 3DHYA 1EFKA 3HDJA 4R1MA 1HE5A 1P17A 4KO3S 1I3MA 4PX2A 1E1KA 3CQ9A 2DTXA 2VAVA 4FDVA 4A8JC 2XE7A 4E31A 1IY0A 2LIPA 3KDAA 1ND5A 3R7WB 3HBFA 3HWSA 3ETNA 5AUQA 3AZOA 3C39A 3MYYA 1LRJA 3DVQX 4R2KA 4C07A 4G5GA 3FDJA 3RT1A 1Y3BE 4CEJB 1YHNA 3KPUA 4P83A 4Z0TA 4YQFA 3ZZUA 3SOZA 2O14A 2UVDA 4GLLA 5FOSA 1W0KD 5BQ5A 1BTOA 2ZXUA 5ARDA 1BXGA 3IDZA 4HGQA 3VGJA 4XGRA 4XWWA 1SIWA 1ZMTA 2QZSA 1AQ6A 1GGJA 3UICA 1DRWA 1Y3IA 1UEJA 3E84A 3OP4A 4GM4A 4KLRA 1OXVA 1X0XA 2QMEA 3QUSA 1UADA 4D9GA 2QRHA 1O9GA 4J6EA 5JCJD 5JQGA 1KMMA 2G9VA 2O8FB 2ZI5A 4OSEA 4RTNA 4PC1A 2PX4A 4E07A 1W73A 4D56A 1YE8A 1GZUA 3F9IA 5CDYA 5K3AA 1PK8A 4C0XA 1GITA 1PTKA 1TU3A 3QYFA 5B3AA 4FD2A 2CZGA 1HF3A 3PENA 1NQUA 2JHAA 3H5RA 5L7WA 2R65A 1RRKA 3ZJUA 1BO6A 4M1QA 4OHFA 1XYGA 3L9WA 1AQUA 3PRYA 4UOQA 1TPZA 4A6DA 1FDVA 4FFWA 5BQXA 5JECA 4NJOA 4UQLA 4HGPA 4H4EA 4RE5A 5AMXA 4WACA 2HTFA 4HN9A 1P81A 1YJQA 4MGEA 1AKTA 3W0LB 1W85A 4XOIA 5D5QA 5JSHA 1QRRA 5C18A 1X2EA 4L3WA 4B74A 3INRA 1MQAA 1CZUA 1Y3DE 2VT6A 4RVOA 3S2SA 3ENQA 4EI2A 1F8GA 2JI7A 2XVMA 4NOLA 3KUKA 3Q7SA 1GPJA 1PL0A 2P68A 1H2AS 1FY2A 1Z4QA 3FKQA 2CT8A 5LQSA 2C59A 1W581 4ZT7A 2IYAA 3SR4A 2WF7A 1V9SA 3JD2A 2BEVB 2GYVA 2WPDD 2AYYA 1P7CA 3UMSA 2A2ZA 4AZ3B 1M6EX 2PIAA 1JSZA 1FMCA 4BO8A 4Q4JB 5SZKB 1TLLA 1ZZEA 2O2SA 3H87A 4YPVA 1DBWA 2Y1FA 5JC1A 2JBWA 4KTVE 1E2KA 2P0EA 1J2YA 1H3NA 3A1FA 2OYRA 2GEFA 1EP1B 4F21A 3IHKA 4B87A 2NQ8A 2B92A 3QLUC 2G0TA 2LGJA 1BAPA 1A8HA 4D4MA 2ZTHA 3W3AA 4GZMA 3KPJA 3U16A 4IDOA 1X1SA 4JQZA 4CM7A 5DU2A 2JDIA 3WGGA 4QTUB 4GKBA 3PSAA 3K0AA 4GX5A 5J2TF 2QTBA 3RM3A 2JGFA 1ODTC 2XUKA 4J0EA 1Q92A 1X7XB 3D4NA 4IMIB 3BRCA 4JODA 4B3DA 3LZCA 1QIGA 5L9AA 4FCVA 1CB7A 4HMOA 2D1QA 1C3XA 1HORA 1O5TA 1UFOA 2OFWA 1IQUA 1GTVA 1LUAA 2QJOA 3QVGA 4P93A 3KSUA 1ENZA 2AHOA 3EISA 2OFFA 3ENVA 1HQDA 2FOXA 1LA2A 2YRFA 4WK0B 3JVEA 3B8EA 3B6JA 3EVDA 2QPTA 3EGCA 1UMBA 4CE6A 1N75A 4UUPA 2JI8A 3NPMA 4OJQA 3H8WA 4KXWA 4UDNA 1OGJA 3TX6A 3ZGVA 4DR6B 2HUPA 2CJPA 1B73A 2GYYA 5CLGA 1QYIA 2ZBFA 2EIXA 4TQGA 3L7NA 2WP8J 5CFQA 1SU8A 5TF0A 3H2JA 4OA8A 2CMFA 4TLLB 5BWCA 2HB6A 4WY2A 2EF1A 2Q3JA 3WNQA 1GKKA 1YTUA 2WM3A 3DBRB 4LIPD 3RS9A 3VDQA 3RI3A 2XUZA 1ZJZA 1RYNA 3ECCA 2C03A 2YHUA 4Q47A 3SI7A 2HGSA 3LW7A 4WSOA 2H2DA 2G1UA 4QDTA 4DDKA 4DAOA 3QWIA 1L3IA 4IQ8A 2QP4A 3VX3A 1OD6A 4MIOA 5HJEA 2A3RA 1Y48E 1WQ3A 3MT9A 4OAOA 1W4CA 3WLFA 5K3OA 4KXXA 2HLNA 2V4MA 2WUFA 3COJA 4FHFA 1XVTA 4GKJB 3K5HA 2GLUA 3DKVA 1ODKA 3T9BA 3R5SA 4KO1S 4KGDA 4JLWA 4B9AA 3Q0EA 3DUFA 2XLCA 2FVYA 3PSHA 3K2BA 3TEFA 4E5DA 2GXAA 3K4PA 4FBGA 5KI6A 3PWTA 3FUTA 3I83A 3OCVA 3WLHA 5K0BA 2R9VA 4YWJA 3CWZA 5F1PA 4BP1A 4LOKA 1W93A 4K0KB 1T6BY 3OQNA 4K9LA 4PAMA 4RJJA 3SS7X 3QPCA 4M0DA 2X4LA 2QTGA 1WCXA 2DFTA 3PHLA 4Z4IA 4LMAA 1RAAA 5DM60 4G0MA 1KHTA 5DNEA 3LX5A 2VYCA 5FUMA 2KQUA 2ZGVA 4GVXA 2CJWB 3IOEA 5ISMA 4HH1A 1AT1A 3RUIA 4ZOLB 4P92A 2EZTA 1LB1B 2IYYA 3HGQA 4H60A 4EZEA 2O4CA 1MVNA 1QP7A 1NGSA 2VHZA 4ZHQB 3TF5A 4MYTA 5ESWA 1OTHA 5DBHX 5ERXA 3B1VA 1UQUA 3L7KA 3LGSA 4Q9KA 3T41A 2L0XA 2RB5A 3LUKA 2C99A 5EAIA 4IKPA 3ZKWA 2JAPA 2G4VA 1YH3A 4RFVA 2OT3B 1P77A 1FX0B 3U4HA 4WXRA 4F4FA 1XAGA 3MCUA 4H7FA 4HWTA 5TEWA 5JZOA 1KO1A 2DQKA 5CAEA 3MTGA 1OOEA 5ADUS 4UUAA 1DV2A 2WJWA 2JNWA 3B6IA 3GJTA 4F72A 3ZZTA 2W2LA 1G6Q1 4BJHB 2HXGA 3N75A 1WUKS 5DCUA 1QV9A 2I8AA 2W6JA 2PH5A 2PRIA 1MUUA 2OGUA 2BBTA 3MJTA 1LKZA 1VLQA 4N0DA 4AJHA 4DYVA 4LS3A 2OHFA 4YIHA 3BTUA 2DX7A 3P2KA 1G20A 4GI7A 2D2XA 3U4QB 3D3QA 1M2EA 2H2FA 3ROZA 2Y1GA 3PNSA 1DO2A 4HPXB 2YZ7A 5DGHA 4TLDA 1Z26A 3D3KA 4BVEA 5LQJA 4HJXA 2ZDHA 2WF8A 4OP3A 2REXB 4WBNA 5BN1A 5ITZB 3KQKA 2WTEA 1CXZA 1IHDA 2G77B 1PL6A 2AR9A 4GOJA 1X9GA 4ZEWA 3EFBA 1FF9A 4MIYA 1FL9A 1V45E 1YD7A 1JJFA 3OJEA 3PB3A 4JWTA 5KYYA 1FXSA 1BXRB 1H2XA 2D7JA 3BWXA 5AW2A 3ADCA 3ICEA 1RM3A 2NUTB 1DPGA 1C7ZA 3JPYA 5HTOA 1DB3A 4D9JA 1X87A 3PFNA 4PSDA 1QONA 5B6IA 2IVFA 3RC9A 1JDBC 3ZTWA 4AN1A 4YAGA 1QQTA 1T2NA 5ERYA 3EDCA 1WABA 4XXHA 4C88A 3EWAA 5KNBD 1OZFA 3M33A 4LGCA 1IG0A 1OU4A 1MO6A 2C9YA 3T3GA 1A71A 1X7ZA 3AFNA 2PS9A 4UXHA 3RO7A 4NCNA 3Q88A 1FJ2A 4QL3A 1AV7A 4WADA 3E70C 4JAVC 3Q72A 1JR4A 3CG0A 4AICA 4W9MC 1XEAA 5KYKA 1WV1A 3UZUA 1RBYA 2X7JA 4HNQA 3P0RA 5TS2A 5J9FA 4YJ2B 1ULAA 2QX8A 5EZYB 1QK3A 3RRNA 3QKRB 4FB5A 3G5TA 3JYNA 3GX1A 1FFXA 1U28C 4PE5B 2CNWD 5AQ1A 4P7FA 5FB3A 3WA6A 2PZGA 2F64A 3ETEA 4LE2A 2HU2A 3H19A 1RQXA 4A9AA 2G1JA 1LBTA 2GJAA 2PWBA 3P9ZA 4KTTE 1QMPA 4OMDA 1KQ3A 3TLXA 3ZJTA 1Y9AA 2V7VA 1NYRA 1GT6A 2NZ8A 4HTFB 1JMVA 4UEWA 5J2UF 2JHPA 1I14A 4YO7A 3SR0A 3KOXA 1E3WB 2F3TA 3FVTA 4ZO7A 1J5PA 2SHKA 4OP2A 5GOTA 4Y6QA 4OXXA 5TRTA 2YBEA 4C5BA 4OK3A 3FPSA 4W1SA 4IIXA 4ZJPA 5JATA 1JLMA 1SOUA 1QFYA 2NUPA 3JPWA 5HA5A 4M37A 5IJ9B 5HKBA 2ZSBA 5B58C 1JEOA 1AS3A 3TDNA 4E0BA 1WUHS 3KQYA 2AD1A 1XSEA 4UXJA 4B6GA 5BV7A 2ZAMA 4MV1A 2H52A 3TZKA 3HO8A 3W6ZA 2IOFA 2YW2A 3DTYA 5CVUA 5DTEA 5JS8A 4NNPA 1CEEA 3VVMA 2P9CA 2XXBA 2PL1A 3GPDG 3BMQB 3ZE2B 3VSBA 3PVZA 4DEYA 2XNJA 4EPWA 4ROTA 1H1TA 1NJ8A 1TJYA 4TYMA 1D9ZA 4BHTA 4PZAA 1YS9A 1M7GA 5IARA 4QARA 4NCKA 1ST3A 2IYQA 5CXSA 3NBXX 1NI3A 2E4ZA 5COQA 1AUXA 2PBFA 1G19A 3BUSA 5ENZA 3QA3E 4AJ1A 2NQTA 4C3OB 5CEJA 1LF5A 1JQ5A 5M7EA 4JLMA 1WE2A 3AOGA 1WCWA 5DT9A 2ZVDA 1CHDA 4EG7A 1MV8A 2VPQA 3B38A 4MP8A 4CF4A 4RTKA 4KVZA 2B1IA 4M49A 2D06A 3PC6A 3M1IA 1Y8RB 3KLMX 3H2BA 3S2EA 3PQFA 2X5XA 2P0YA 1Z7YA 4DMFA 5GPBA 5JHGB 2BTOA 4H59A 2HNBA 2MT9A 4GX0A 1ZRMA 3W5SA 5LIPA 1YRBA 1PJ8A 5FR2A 4N8SA 1T0BA 4CIYA 1VCIA 2TRSB 2VDKB 3AHIA 5AHWA 3ROPA 3DXXA 3JQ6A 3DT9A 4WLVA 1J4AA 2JFOA 2D5IA 4B4WA 5MN6A 2IEYA 2O6HA 5LKRA 1FVXA 2VP5A 4JJ6A 4P22A 4UMFA 5AK4A 1EBBA 5EP4A 5IWCA 3IEKA 1YBHA 1UZMA 4IXMA 2V0NA 1OFUX 3S40A 2VUTA 2OBLA 1QC5A 2HRBA 3UKDA 5K9ZA 1NF9A 3VYTB 1RHQA 1KDZA 3RYIA 5BR7A 3T9AA 3U7IA 2VSNA 2V5VA 1L7NA 1P0PA 3CY6A 3IAM1 4EH1A 3QX7A 5FUYA 3UXMA 3O03A 4FMCB 3HTXA 4OBWA 1IOLA 1C1DA 1MORA 4ML3A 3VU9A 3G6WA 1KOJA 2YN0A 2WYWA 4IV0A 4MARA 1RKBA 4R8LA 2FWMX 1RRPA 4L6CA 4D6YA 2AI2A 1P0MA 3OAAA 4P3OA 2EW2A 1DQYA 3JYPA 3KBOA 3Q5GA 3UTCA 2YYSA 3C3MA 4X20B 2Q1WA 4M98A 3HU5A 2QI9F 5EMKA 2R96A 4PC2A 1P9RA 3RH0A 2BCJQ 3WB1A 3AVVA 4HRYA 2UAGA 4XAQA 3HSSA 2O3TA 4R41A 5T67A 5HPYB 2PO7A 3GXOA 3B51X 1UMCB 3HCDA 3LVRE 3IQEA 3ZDXB 3QKWA 3N76A 2AVDA 2QU8A 3ZOZA 2A9PA 2VO1A 3HCFA 1CRLA 2HMAA 4ILEA 3PFKA 4IUBS 4K2AA 4R98A 4WZBB 2M6SA 3I6YA 3M5CA 3CNBA 4GMXA 3BL6A 4QBKA 4DKXA 1TK9A 1AHNA 4IIUA 1L2TA 1QYVA 1NVGA 3CPEA 4GWGA 4IDDA 1L7BA 1QGUA 4LC9A 4P36A 3RIMA 4AWBA 3LG2A 5K0NA 3BFVA 5KTPA 3U1VA 5KPJA 1KYYA 4QDKA 3AILA 3DDZX 3O3NB 5A4DA 2W0MA 4EGJA 2F3UA 3TTXA 1KI6B 3WGIA 2NT3A 4UBLA 4S35A 1FXWF 2EGGA 2FOIA 3R77A 3ISJA 4ER0A 4I3HA 4B83A 3PD0A 3R8XA 1DFGA 3VNQA 1CFZA 4RVSA 3HP7A 4KACA 1IK6A 1KERA 2V0GA 3HJAA 2HJHA 4LVUA 5ABPA 4ARCA 4KX5A 1O6ZA 3SBDA 3ND9A 2IRWA 3ITNA 4Z7QB 2VAMA 2YJ6A 2W0SA 3DEFA 3ADDA 4S1PA 4ZU6X 5E1DA 4BO3A 3BJZA 2O20A 4BNVA 1EUQA 4IFEA 4AP5A 2J31A 3F6EX 5AVZA 1OW3B 1GTL1 4DCPA 2WSBA 3GP5A 2BR5A 4ANFA 4BRUA 5SZJA 4NBKA 1IIRA 1ZQ9A 2O2YA 3GLHB 3H84A 2BMJA 3AJ8A 1WL8A 1EH5A 3TGPA 1L4HA 1VPTA 3GMDA 2ZJ5A 1NMYA 4Y1RB 1IYZA 1E6UA 2RGCA 3OKPA 4FZ3A 4HDAA 4UTZA 5L3RA 1C7JA 5CFZA 5J4VA 5M04A 1DI0A 4A0RA 3MT7A 3PE6A 1N34B 4NJMB 3W4JA 3W79A 1WY5A 3JRXA 3F7MA 1G21B 4TWJA 4YP0A 3DLAA 3G79A 1XXHE 4UNPA 3OWXA 4GIBA 1QG6A 2ZANA 4WOCA 4PAWA 1QKKA 4JYZA 3WL6A 4QXRA 3HU2A 3ZVNA 1Y5IA 1SVUA 4P3KA 5FULA 3ZVLA 1W6RA 3HNOA 4XQEA 3R0JA 4BFTA 3WAGA 1SOWA 1H1LA 1RMTA 1ZUHA 3M81A 2QSUA 3VBEA 1XZDA 1OB5A 4CV2A 5I9SA 2FLKA 4KWHA 3U9LA 5LP6B 1ULSA 4MULA 2O2EA 2FP4A 3ZY3A 3W8FA 3OIYA 1F2UA 3JSAA 3K9HA 3VDNB 2GVNA 1QO0D 2CE2X 3DNMA 1ZJYA 3IEIA 3D2LA 3INNA 5ECGC 4EF4A 5LOVB 1XMOB 2VLIA 1CJSA 3HXKA 1U02A 2ZXFA 4L9SA 4D79A 4IHJF 3C87A 4M4SA 4OHVA 2Q5EA 2WWGA 1RWKA 3G1UA 3MN1A 1B41A 1MIOB 3RUPA 2Z6UA 3AMVA 2G71A 1GKYA 3OA2A 2VHEA 3P45A 3TZBA 3D6NB 4KFCA 4NG5A 4R3WA 4JYCA 5ILOA 1XPRA 3D31A 2P3LA 4PAQA 4WKNA 3WNVA 1EBFA 3DTVA 1VRWA 1ZK1A 2NVWA 3E05A 2QIOA 4G5HA 1QJ4A 3F73A 1N9GA 1PDOA 1RPJA 1WDTA 3Q8XB 4EA8A 1XD2A 1DCTA 2OLJA 4RY0A 3KTDA 5HIMA 4GBMA 4BMDA 1IPHA 1WO8A 1ZL2A 1NXPA 3KQTA 4JXZA 1RXUA 5J4YA 2G7MC 3X1JA 1ZD9A 4RXMA 3AOEC 5A9SA 4ZVUA 3WL7A 5F5NA 3H11A 4CEIB 1ZD5A 4Q3KA 2QN2A 2QLJA 3MC1A 2H0AA 1PR6A 1KKUA 4U7FA 1UKVY 4WY5A 2P5UA 3VXKA 3BRWD 4V1CI 3WB2A 1BEZA 4FNOA 2YOFA 3CR7A 1CVRA 1QIJA 2P5YA 1P2TA 1X1QA 1RPNA 4ND1A 5ESXA 3I58A 2VHXA 4KLCA 1URPA 2DKFA 4AKTA 1TC2A 1RKXA 4DDUA 1CEQA 4I5FA 3ZBUA 3T4UA 1WA5A 4EF6A 3ZGLA 2JJ2D 2ZWAA 4UBIA 3A4LA 4DNFA 2D2EA 1Y1SA 4J4BA 3M6AA 1M8FA 1Z88A 3LAWA 4A0FA 2XMSA 2GXSA 1OWOA 2VTEA 4DIKA 3TNDA 3C4JA 5CR9A 4NIMA 1HDEA 3HJHA 5I9MA 2DFKB 1DAKA 2YZNA 2C2BA 2P4HX 1TL7C 3RS3A 5HF9A 2YY5A 1QZXA 2L17A 1HWYA 1B14A 1MTZA 1W1WA 3CNOA 3L0IB 2IU4A 3NAGA 4JI3B 4PR0A 1ISJA 2IX3A 2OQRA 4RANA 1WMAA 1CIVA 4MPTA 3T7CA 1Z2OX 5FV7A 1E94E 3AJRA 2A88A 1RRMA 2CB0A 2ECOA 1W88A 4FQ7A 1BHO1 4MVJD 1FMJA 5HQJA 3T4XA 1JR2A 3PFGA 5ARBA 5AVTA 5JD6A 1Y9EA 2QP3A 5BQOA 2H5LA 3FHOA 3K0CC 4N3BA 1DEXA 4ZC8A 1LJLA 1U0HC 3LCUA 1OWLA 1G5QA 3A31A 1GEGA 3GJZA 3ILSA 3SX4A 5EVJA 1BX3A 1YMQA 4XR4A 4Q1AA 4QD3A 3UWDA 1XKXA 4L51A 3AY6A 2QORA 2X0EA 4MW4A 3RD5A 7MHTA 4EUFA 2D7DA 4NAUA 2E49A 4LZJA 1TMOA 3X43A 3O4RA 3L18A 5I8ZA 3QF4B 3SXJA 3V55A 4DNPA 4G0WA 1SA0A 4ZCRA 2WT9A 5IXSA 5KX5A 3AF6A 1P0CA 1ZJ5A 3R4CA 3VDXA 2Z6QA 1K97A 4MP3A 5KUTA 2C83A 3NHWA 4TS1A 3KYBA 1E92A 1SULA 2MTBA 4PNPA 4TMTA 1RXYA 2JD2A 2ZU0C 4N0PA 4BN5A 3IQDB 1PEAA 3ZQKA 4PIVA 4A3SA 3PHIA 2XNKA 3ESBA 4EQ6B 3KQSA 1C50A 4YIKA 3C8MA 4RA9B 1VHJA 3B48A 3FLEA 3G0OA 2Q4EA 1UPFA 1RJFA 1OAAA 4K6CA 3AVOA 3WQRA 3V1TC 5DNYB 2Q29A 2RGEA 3U7FB 1RWNA 3UMBA 2RJ3A 3EQ7A 3H17A 3OZAA 1P80A 3PUJA 3SC2A 2XXAB 4L6IA 4NNOA 2OV2A 4LXGA 1BN7A 4X1OA 2PMWB 5BWNA 2AFVA 1XDWA 2DETA 1U1DA 3GRAA 2IDZA 2WNSA 1QYWA 1JW9B 4WKBA 3FZNA 2IX9A 3L6BA 4LSWA 4O2AF 5DHAA 5D7BA 4PCVA 3L82B 4HUQA 1U3DA 4GP7A 4L16A 1PDVA 1TYCA 3AHEA 4HH3C 4M7OA 1LPNA 4P0TA 2UU9B 2GCOB 2YWFA 3RVQA 5HRAA 1J24A 2C77A 1ZKMA 3GXBA 2XE6A 3LE8A 3MWFA 1R27A 4MGZR 1V1MA 4PC6A 1L4UA 2FUEA 4FS8A 4YX9A 3OZEA 3DOUA 4LXYA 3KJHA 1QIIA 5F2OA 3SF0A 3U3MA 2C61A 2OSVA 4P54A 2Q6LA 2O8DB 4OL0A 3LW8A 3NRJA 4L74A 5AUOB 1IHPA 1W1UA 2FW9A 1EDZA 4YDHB 3GARA 5ALYA 2M6RA 2VDUE 3D6MA 4B7UA 4F2HA 3OEED 3CLRC 1SD5A 4WXMA 2AXNA 4JBNA 4XEUA 4XVRA 5DTRA 1NU6A 2J7PD 2QVZX 4ZANA 4S3MA 2AR0A 5DGTA 2FW7A 4GOXA 2QY6A 5THKA 1QRSA 5CFOA 1C7QA 2O2XA 1XK6A 2PLFA 2BFBB 3ODGA 2IS2A 2J67A 2X5KO 4XD7A 3CRNA 4N3GA 2E48A 4A2QA 2X13A 3SYTA 1ZXBA 3IRVA 1Q1NA 3AVWA 1S2IA 3V3TA 3C6MA 4PNZA 4G4IA 1YR9A 3G2LA 4DSZA 4LX0A 2OXCA 3KCNA 3ZHCA 2FMHA 4JDUA 1BFUA 4CDMA 3TLGB 4CIWA 4JBHA 5DP2A 1T8SA 3WSTA 1OX4B 4ZVTA 3CNLA 4H17A 2B5VA 2BR4A 4L6AA 2JCBA 4MR9A 2NNWB 3LA6A 1S96A 1X3SA 3VR2A 2C88A 3K9LA 2VHTA 1A76A 2IYXA 4WXPA 3RQSA 2FPPA 2GSDA 3EMBA 4GS5A 3MGBA 3ZY2A 4YBZA 3CLHA 4X8MA 1Z2AA 1F48A 2PYZA 3TE6A 1HEIA 1SD2A 2G0AA 3B1ZA 1UT6A 4TWZA 4XOUA 1WMFA 3U4GA 2P2ZA 4HLUA 1KI3A 3EQ6A 4R4JA 4D3YA 4GW3A 3N6VA 3Q9NA 4DYDA 4N9WA 1YZLA 5K8LA 2B9VA 1G63A 2YNMD 2VP0A 4DUGA 5B5SA 1XNRB 3CKLA 3KR9A 3DLHA 4CLEA 2CLDX 3MAJA 1W2HA 3VO2A 1I7DA 4NWIA 1J56A 2G3YA 2GZMA 2NTNA 2QR5A 3CRZA 3H4TA 3V8NA 2RK4A 5EHZA 1QDEA 3HCOA 5LL6P 1CJKC 2OPBA 2QL6A 4NICA 1UXJA 2AVNA 2HU5A 1P1RA 1N0VC 4QVGA 4Y2VA 2OHGA 1VA5A 3ACDA 2PMDA 3ZKAA 4YMGA 2VQEB 2W6QA 2X3FA 4WN9B 1U2GA 3FPCA 5M5BA 3BZBA 1MX5A 2AFHE 1JQLB 2ASEA 2BFDA 3BC1A 4Z0PA 2Y1KA 4RY8A 1XA4A 4FFVA 2ZK7A 5DNCA 4IINA 4U8HA 2JJ8A 1EK5A 5BV0A 1P2BA 1ORWA 2DY1A 2ZYDA 4RA6B 3O84A 3KX2A 1NN1A 1SELA 2IIBA 2KJQA 3A3OA 4JLAA 3O4HA 4QUHA 4RGVA 5IVKA 1I80A 3T15A 1QFZA 1Y63A 2OZLA 3V33A 4U2DA 3TQOA 1C0EA 7YASA 1VCHA 3C3WA 1XQ1A 3GOHA 3LBFA 1ZN7A 4IAOA 1QFSA 2PRYA 1YO6A 2C5BA 3WLNA 3ZWMA 3FTFA 1KJNA 1OA1A 4I55B 4N01A 1SG9A 3WV5A 3KP1A 3DBLA 2FSVC 2GVZC 1WUJS 4GG1A 2VQ6A 3RFTA 4IVNA 3BMNA 3MRSA 3PEUA 2BM8A 4G2TA 4K6FA 2Q9BA 5A3JA 2Z2IA 3ZU5A 4FQ8A 4FFSA 5K4GA 3L01A 2AJ8A 5KNCH 4UHBA 2GZ1A 3OPYA 4X6YA 2BFCA 1B74A 3RPEA 3VTFA 4DMGA 2QTMA 1A8IA 1Z33A 5E1MA 2P7HA 2GR9A 2NN3C 2P9HA 3N2KA 4H7EA 3W05A 1RXWA 1NI4A 3H9QA 1M67A 1J5XA 4E5KA 2VNJA 1T3ZA 4AB1A 2G5PA 4HN2A 5FWDA 3QFRA 2AZTA 4GEGA 1ZY2A 2W2MA 3A0UA 3RG2A 3GN2A 3W8DA 1AX9A 5JNSA 1R0SA 3D4IA 2ZE8A 8ABPA 1M2JA 3K16A 3C3EA 4MPPA 1DFHA 2O7VA 1D2EA 1JDTA 3I3SR 2X1LA 3K0FB 4EHIA 3I28A 2H16A 4F1JA 1KXZA 4CODB 3M6IA 2YJGA 4ZQGA 3T3PB 1DBRA 4KUGA 4U9UA 1H2BA 2OD2A 1B6SA 3EXHC 1NAHA 1E1MA 1QFJA 1E6CA 4R54A 5DBGA 2GEVA 5DGXA 5L40A 1JBEA 3GT4A 3IO5A 4HDNA 5DWDA 4BQEA 1H2FA 2EZ9A 2WSSD 1KZ9A 4ALMA 4ZTBA 3LPDA 2PMCA 1T8WA 5FWXA 4ZYTA 1RIIA 1QE3A 1ZQ1A 2E37A 2ZRLA 2J0UB 4HEHA 2VTDA 4OHMA 4V02A 3U26A 4BU1A 4Z0HO 3GGDA 3DD5A 2ZQYA 4OQLA 5AI5A 4K9KA 2JGJA 4ZP1A 5I3CA 4XGIA 1DXQA 4WCFC 3DCIA 5A4JA 4FFOA 5FNVF 3URMA 2C5FA 3WWEA 3BHIA 1CRWG 3FVWA 2Z56A 4KYVA 4X93A 2H7CA 4CTMA 4JI4B 1A4UA 3B36A 3NIGB 2ONZA 3R5KA 1B26A 3U62A 2CDAA 4OPMA 3ONNA 4HAZA 2A4KA 1HBJA 1A4IA 2C2MA 3FFWA 1C7FA 2O3SA 2JJQA 3IUYA 4IGIA 4CQJA 4TSFD 4GPAA 1PWYE 1D1TA 3M6UA 4D6PA 1NT4A 1OLOA 1WTAA 3HKCA 4LQCA 5HFNA 1G7CA 1MFZA 4PQGA 1HR0B 1R4AA 1N0HA 4RH0A 4F4JA 2ODNA 3NCHA 1JLHA 5LXTA 1PT9A 2PBRA 3O8DA 4GXRA 4YJKA 1NUUA 4PQEA 3D4LA 1TTQB 2XB8A 1IDN1 2ZZMA 1DT5A 4C5AA 5IM4F 1X1TA 3R5XA 4CL8A 1IL0A 1VIMA 2AB0A 3K1AA 3B7PA 2CLSA 2W6PA 3KFLA 4JBXA 2Z4SA 3T5TA 1XP8A 4OXRA 4DR2B 3ER8A 4Y7CA 1PWEA 3UKOA 3S5UA 2EDCA 5AJTA 4GSYA 4U00A 3A6KA 4Q3LA 5JVDA 5H4HA 5KWJA 3CNQS 3DO8A 3TKLA 2IYFA 4D25A 1CX9B 3BD7A 2E82A 1LXCA 3C0KA 2ZVPX 1VJ0A 2AEJA 2WIFA 4JOQA 4NOKA 4BQPA 3WL8A 1JTVA 4JXJA 1KKLA 3L0BA 3DQZA 1GG9A 2G4LA 4QDOA 3QOWA 3RLFA 2DQZA 2P41A 4NE9A 1HRDA 4D4LA 5CFMA 4BWYA 2JA2A 1RJ9A 3VNRA 3GLRA 2VDLB 2REBA 1PZNA 1ATZA 2RGRA 3OUUA 4TKMA 4CQNA 3CLTD 1Z07A 3EIUA 2XT6A 3MW8A 2I99A 4LDNA 5D00A 4B2YA 3HA5A 1V16B 1XDBA 3STTA 2QEQA 3JYOA 5HRUA 4LFCB 3COVA 2CGEA 3C3BA 1KOFA 1H3FA 2OGWA 5BVHB 3RARA 1EFDN 1RRGA 5CBPB 4YUAA 1OLSA 4BMVA 2PV0A 4RKWA 5FJJA 1AY0A 4U1RA 4NRDA 1SG6A 2NYRA 4CMAA 2OZPA 5EIBD 3RV3A 1NBAA 1W9HA 4XGQA 2OXEA 1QH9A 1DP4A 1PBTA 4LKRA 4MEJA 3B3QA 1A4RA 2BN4A 2P4EA 4PZ9A 2D1YA 4BDTA 4G8CA 4G0OA 1QJCA 1JDNA 2FWPA 2OCDA 1U0JA 2X2EA 4IIEA 4V0SA 3TQRA 5ANRB 3TBHA 2AZDA 3JD3A 3WLSA 5CEEA 1E62A 2W2LD 4MQEB 3NYRA 1BVHA 1VHWA 4YRSA 1E5VA 3A36A 1YRQA 2W6JD 4O4LF 3CIOA 2NZYA 5FOUA 1ZOSA 5CVCA 3SCZA 1IM5A 3OCCA 4R8RA 4HWOA 1I3CA 5IMSA 4I55A 3P5SA 5F64A 3RJ5A 1L5YA 5TMDA 5KYWB 2NXJA 1EX9A 3QWBA 2HHJA 4DE5A 3OI7A 4KYTA 3JAWA 4HQ6A 1V8BA 3MJHA 3HXMA 4ZQEA 2BI4A 3OX2A 1X6VA 5EIOA 4BNZA 2PCLA 3WK5A 2PUWA 3EUAA 2OXIA 3NWEA 2H7YA 4Y2YA 5KB3A 1G60A 3RUFA 2BZ0A 3A0RB 3PYXA 4IX1A 3FX2A 4JELA 2O8VA 4JP8A 5H3LA 1G8AA 4DA9A 3GH1A 4OHCA 2FEKA 4QUBA 4MQLA 2VZ8A 4YCSA 4B3RB 3WYNA 1R6BX 1XF9A 3AM4A 3AWDA 3BQ9A 1DG1G 4MW6A 3EEYA 2DYKA 1W36C 1QHFA 4PG5A 3ZHOA 5IFLA 4R9NA 2O07A 3AU8A 5AVOA 4DW8A 2IW1A 1JDPA 5JMTA 3QUCA 4ZVNA 1WP4A 2WUWE 4K8OA 5HQ3B 3THYB 1IWOA 1Y1TA 1E5QA 1MPTA 1A9PA 3FVVA 4XIFA 1UBFA 2RAPA 3IAUA 5FX2A 5T4HA 1ZDMA 3KTAA 1NJ5A 2ECQA 3UCXA 1X7YB 4LMBA 3OX1A 2HQBA 3AM5A 4PSKA 2R84A 3UMRA 4S05A 3FRHA 5KHLB 1ECCA 2VSQA 1TMKA 4MO2A 2VJLA 3UUEA 4XCVA 5KWSA 2I3BA 2CEAA 1QUEA 1W49A 4RV5A 5EQJB 3BMCA 2W6CX 1U80A 2HGZA 2P8JA 5D3ZA 4CLRA 1QRTA 4Q16A 4EKGA