1VHQA

Crystal structure of enhancing lycopene biosynthesis protein 2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
216
Chain Sequence
b'MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enhancing lycopene biosynthesis protein 2
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 73
structure length 216
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhqA00
1VHQA 1C3OB 2ZUWA 4GUDA 1SOAA 4UOQA 5SY6A 2WJZB 2A9VA 2OR3A 3FIJA 1OX4A 3NOOA 4N0MA 3B3AA 4WXYB 3TTVA 2VDJA 4ZDJA 4L78A 3SF8B 1IPHA 1A9XB 3R76A 3R74A 4ENWA 4UCFA 3ZJ4A 3NOVA 3P9RA 3PQ6A 4OFWA 4OQ4A 2VRNA 1UCFA 3ZJ5A 2YWBA 4ZDIA 2ZUTA 1KWGA 3UK7A 5K4AA 4B31A 2XF2A 5JZOA 1O1YA 1P7ZA 4UNIA 1QVWA 1OX6A 3SOZA 4QYTA 3TTWA 2IUFA 1IZYA 2D7JA 3SF8A 4XLLA 4ADSG 3EWNA 4B5KA 1WL8A 1M6VB 3TTTA 4ENPA 1T3TA 3B36A 4P36A 4L8YA 3B38A 5SYAA 1S1MA 3RHTA 3UOWA 3FSEA 1QF7A 3GRAA 3NOQA 3ZR4B 1QVVA 1T36B 4MTCA 1VCMA 2RK6A 1VCNA 1KA9H 4LGYA 4WINA 3TTUA 4OGGA 4Y1GA 4UZSA 4I46A 3PQ4A 4ENUA 1P80A 1G2IA 2YWCA 1FY2A 3L4EA 4QYXA 3NORA 1CS0B 3PQ8A 1N57A 4L8WB 1T0BA 1GG9A 3TTSA 1FYEA 2R1TA 1P81A 1CE8B 4PXYA 4ENSA 4R7GA 2NV2B 4JQSA 2FEXA 3D54D 2W7TA 3WFZA 4OGFA 3EJ6A 4MNTA 4ZGGA 3UGJA 2GHRA 2H2WA 1GPWB 3EFEA 1PE0A 1CF9A 4UOZA 3PQ5A 3CZAA 3PQ3A 4LRUA 3L18A 4OIFA 1GGJA 4B40A 1ONSA 4B7AA 2NV0A 4E08A 2R1TB 4Y1EA 4ENRA 2AD5A 1K9VF 5SY9A 1BXRB 3PQ7A 4S0ZA 3KKLA 4ENQA 5IP5A 4GE0A 2ISSD 4AJ9A 1OI4A 5JZMA 3F5DA 4I4NA 3R75A 1VCOA 1GGEA 2R1UA 1GGFA 3MGKA 2RK4A 2VPIA 2ZUVA 1JVNA 3N7TA 3BHNA 1J42A 3NONA 1P7YA 4P34A 3CY6A 4AUMA 2GK3A 4BTEA 4ENTA 1PDWA 4MGHA 3UMMA 1KWKA 4RKYA 4AUEA 3L7NA 1L9XA 1QDLB 2AB0A 2V4UA 4L8FA 4L95C 2R1VA 4ZDKA 5LIRA 4BFLA 1KXJA 3OT1A 1C30B 1GGKA 3TQIA 2YWDA 3MIIA 4HCJA 1IZZA 2YWJA 4GE3A 3P9SA 1U9CA 3PQ2A 4L7QA 5E9AA 1KEEB 1JDBC 3TTYA 1OY1A 1I1QB 1Q2UA 3P9QA 4I2NA 1PV2A 2VXOA 3TTXA 1GGHA 1Q7RA 4B2YA 2R1VB 3OT1B 4Y0NA 4Y1RA 1GPMA 4AUNA 1I7SB 3P9PA 5SY4A 2ZUUA 3CNEA 3M3PA 4BIMA 2LXNA 1I7QB 4P5PA 3L3BA 1OX4B 1P5FA 3CZ9A 4P2GA 2ZUSA 3UJNA 3EZGA 4ENVA 1OX5A 4AULA 4RKWA 3ER6A 4N12A 3F71A 5BV2P 3BWEA 3NVAA 1SY7A 2ABWA 4E5VA 1R9GA 4P35A 5DFAA 4Y1FA 4D1YA 3CYFA 4Y1RB 1QWSA 4OJYA 2VKTA 1QVZA 4K2HA 3EN0A 1PDVA 3VU3A 2RK3A
chains in the Genus database with same CATH superfamily
5ELLA 3SOPA 2NU7B 3NTOA 5CLGA 1UUFA 2I7DA 3I09A 4HFNA 4KO4S 5AVWA 5JWRA 1UZNA 3ODGA 3K05A 1T13A 2E5FA 2RHBA 4HQRA 1EXDA 4OBWA 4Z2AA 3A1EA 1V6CA 1KYWA 5L53A 4EQZA 4GMFA 5ALKA 4LDQA 1E0AA 4IJKA 1UCFA 2YXDA 3MERA 2PD3A 3U4HA 2IX9A 2OT3B 5IT5A 3OPYA 4N8DA 2VPQA 4F5EA 9LDTA 1RBZA 2M9MA 1RJGA 3BCSA 2V6IA 2PZBA 2YXNA 1OKKA 1TUIA 3GOQA 5EE5B 1K7XB 1E4OA 1UXHA 4NESA 5AXDA 1KMHA 1WABA 1YQ9A 2HWKA 4JITA 2F43B 5ER9A 1Q3KA 2IHNA 2L69A 3CEMA 4CV0A 2PUDA 2AZXA 1XQ6A 1YGYA 3KTAA 5IM4F 1VQ1A 3VU9A 3EEIA 2F59A 3OE7D 2PVPA 3HUDA 2GK6A 1U1EA 1JMVA 3PCXA 3RGWS 2TMGA 2WB4A 3DE6X 4Q12A 3VR5D 4B7XA 2W98A 2X1MA 3TRDA 4C0QC 2GZ3A 4GGMX 3PC8C 4S35A 4BGEA 1ODJA 1D03A 1Q0ZA 3GFSA 1QXSA 3QTLA 3S8MA 4N6NA 2X5NA 1AGRA 4R6XA 1YO6A 1ANKA 3PUIA 4TRJA 4C87A 4F3TA 2N0SA 3N7AA 3L4BA 1U8FO 4RK5A 3AF3A 4CM8A 1DAIA 5GTDA 3EEYA 4U9IS 4JBHA 4YR9A 3OX2A 4OUDB 3O4GA 1DADA 1JSXA 2QVLA 4B4DA 1EUCA 4EOGA 3M6FA 3RWBA 2G1KA 3E9MA 4G97A 3FOCA 1LK5A 4G86A 3OZCA 1CFZA 2OOKA 4B3GA 3ESQA 2DAPA 3F96A 4L7VA 4MVJF 3AR4A 4UC0A 4UCWA 5B1HA 4FEAA 2WTUA 3ZZMA 1C3JA 1QZUA 2HU5A 3OLYA 1C81A 4U3JB 4NJMA 4Q02A 3RTEA 4B6EA 4BQQA 4C78A 2FWMX 1EQ2A 3PHBE 3ZEAA 1QIMA 1QG2A 4J0JA 3DBHB 4LOKA 3JARB 4A92A 1PEYA 2FCRA 5BW8A 2OQIA 2V4UA 1GQQA 3DP9A 4MUNA 3INYA 5JVDB 3W5CA 2FQYA 4FFMA 4JGGA 5IVKA 1JG6A 1JDPA 2UZ0A 3MPOA 2FRXA 3F6EX 1QVRA 1FUKA 4EFKA 4QWMA 3C6MA 1YE5A 1IHDA 2AJ8A 3WLFA 5JAIA 2P2YA 5JWHA 1VZ3A 3QY9A 3TKYA 2WYHA 1JUDA 2J6HA 3MYRA 2II6A 3YASA 1EVEA 3OA0A 3LCVB 5AKHA 4AS2A 3VKVA 5AVJA 3L6UA 4Y0NA 2XECA 3ELDA 1KSJA 4V0MA 2QMZA 1MO6A 4NV0A 4P5EA 4RQBA 5C5CA 3I04A 1I3LA 3RUDA 1Q1NA 3V8VA 3ZQKA 3OOEA 5JCJA 3AT1A 3ORYA 1QTQA 2X9LA 3RS5A 5LZ5A 3QMWA 2QUAA 3DSRA 3OZVA 1GUDA 1GGMA 5KYYB 2ZE7A 1PFWA 2BTQB 1NF3A 2ZXEA 3FUVA 3JQEA 2NNLD 4NV1A 4LSGA 3RYHB 4C2UA 1EJ0A 2RIPA 3ASZA 2Q45A 2R00C 3W6UA 1N9ZA 1UXKA 1SNYA 4BTLA 1F0KA 1EU1A 5J4VA 4XDZA 1BA3A 4OMCA 2HRRA 4HYQA 1NLZA 2Q9AA 4PO1A 5DMHA 3STWA 5J4HA 1QRTA 4GZ5A 3KPWA 5B58T 3TTVA 4CKCA 3U5ZB 5TC4A 3TMKA 3ST7A 2OMKA 5EFOA 2I9PA 3LBYA 1YRWA 3V7NA 3R44A 4B3XA 2MR6A 5HZHA 3UXYA 3L7OA 1DGQA 3MT0A 2G36A 3VTAA 3V00A 2VPXA 2IFTA 2E82A 4YQFA 1SBNE 1LWNA 3DS8A 3NNSA 1Z68A 2F3QA 1NXOA 2IEBA 4N8EA 2B99A 3PB3A 2O0KA 2ZKLA 1GPAA 3U6BA 1W59A 4OD0A 2BMEA 1MGOA 2KHZA 2OHJA 3SJUA 1RXVA 4P92A 5SYAA 1KC1A 1LW6E 3OTIA 3R0VA 4AMYA 5EZ5A 2HNKA 4Q18A 3MUNA 3OZEA 3RE1A 1ZA2A 9ATCA 1R8XA 1M2GA 4LGYA 4OJQA 1E3QA 4U2GA 5LNK1 3A6DA 1J8YF 1EVQA 4E1VA 4TQGA 2GEVA 3F9RA 4YVFA 4RHUA 1AB5A 2RGCA 1F9EA 1JBQA 2F1KA 1XVTA 3NXSA 4EKDA 1A77A 1R6AA 1G20A 2ZK7A 1MDFA 2ATVA 3CJTA 4IXNA 4LF7B 1NG9A 4YQEA 3D4LA 3QWBA 3LW8A 1JEEA 2ESRA 2AFVA 5A9SB 3L8FA 5KQGA 3FVRA 5K3AA 1G7SA 1W93A 4R7GA 1BNCA 2W6JA 2JFUA 3I39X 1VBMA 1PGNA 5IBQA 3VNUA 1XTQA 1OTYA 2C2HA 1MOQA 4PLFA 2BGUA 2GVZC 4X44A 2QUIA 1PKEA 2ONZA 2V0NA 1J5XA 4FFBB 5DOVA 4COKA 5JRZA 2ACWA 4YY3B 1GZ4A 2ZZMA 1DC3A 1KZ6A 2Q1YA 1PQUA 2XI4A 2SBTA 1TC2A 4IXTA 2VJAA 2JZOA 3Q3JB 3GLFB 3I23A 4PLWA 3R3ZA 5F3WB 4M1EA 1FFGA 4KKXB 4BU0A 5KMGA 4FKBA 3KPYA 4II7A 2ZSAA 5LC1A 5BR4A 2AMVA 2DRIA 1U6JA 3W2TA 1U3CA 1Z06A 3ZOKA 4AZVA 1S8FA 3AWIA 4HN2A 6ABPA 1GVNB 3DE3X 2GHTA 4IV5A 5FEMA 3O9ZA 2WM2A 1RADA 3RDPA 4OU4A 2OCPA 3GBSA 2A4MA 2JLRA 1CQZA 1V1JA 4KQFA 2YL2A 4QDUA 4FDAA 5J2UB 5TQJA 5F21A 3V1NA 2WFMA 1E6MA 3AESA 1SXJB 4RSMA 2BEUA 4DDMA 1PFVA 4DQDA 4E5NA 3QEMB 5EZYB 4K1LA 4ND1A 4J75A 1YBVA 3CPHA 1T9DA 5D85A 3T5MA 5IBCA 1PR2A 3UT6A 2ZBPA 3FDJA 2BRUA 1QLJA 4D0SA 4KXMA 3DWIA 4BKQA 1MNAA 1PFGA 1R4MA 1X15A 2IUTA 3OMWA 4GKBA 3TO5A 2GAOA 3INNA 4TTVA 4NDAA 5T4FA 4N48A 2NU9A 2RGYA 3AJAA 3CX6A 2AXQA 3KJQA 3L07A 4MDFA 4Y98A 1Q19A 4DR3B 1K7YA 4PO3X 3ICVA 1Z82A 3P9XA 5B6JA 5BQ3A 3VU3A 1H8ED 3V1LA 3OIFA 4RS4A 3CM0A 1Y6RA 3FUWA 3ZD9A 4P32A 4OA8A 1UOQA 2AFIB 2QF7A 2XDQA 3FHJA 2WNHA 3UK1A 4GM1A 3UHPA 3SF8B 4X24A 5HM8A 4EB6A 4CIBA 3TW8B 2HMWA 4YRZA 3I6IA 4BMZA 4DLXA 5NLLA 1IJEA 1OVMA 1BEUB 1I6KA 1Q0HA 2H11A 8ADHA 1KJIA 3ZJ5A 4L08A 3PI6A 2QDXA 4F46A 2A9QA 3G0IA 2H1OA 5JJKA 1HG0A 1NDUA 2PT9A 5BVHA 2PKXA 1Z4JA 3D02A 1FJHA 1KR2A 5KOHB 1YBAA 1VL8A 4D4IA 4D98A 4LZNA 1UK6A 5B4UA 1GR1A 2JJ1A 1FOEB 3FSEA 3N3AC 4IP0A 4Q7MB 2HCJB 3ZY6A 3EX7C 4RHCA 4ZQCB 1ODIA 2W93A 3QQPA 4QU5A 3VSBA 2AOUB 5IKOA 3HKEB 4H7IA 2X3FA 2QG9A 5F4ZA 3ABOB 2NUTA 3WZLA 5FTNA 4DV5B 4TTAA 3RYFA 3AR2A 2ZDHA 5DM70 3ICCA 1IQRA 4RSRA 2AT1A 2JI4A 1LKZA 3TTSA 2WWXA 3QNUA 3W6ZA 1E3WB 3HDYA 1JGTA 3FCYA 2GA9A 3COVA 5AIAA 3RS8A 4FHDA 3DCIA 3M33A 5CW2A 2VDWA 2BC9A 3RSGA 2C8VA 5A4FS 1AMNA 1ZRSA 2B4KA 2V8OA 4E0BA 5KNDH 5KTYA 5EWJA 4KO2S 2B0JA 3G0OA 1SXJE 5HEKA 4DEVA 3EISA 2LVBA 1GVHA 3PPVA 1DKOA 4K2AA 2VJQA 3LOQA 3RUAA 3RAPR 5FBQB 4D3SA 4Q3CA 3X1YA 4Q21A 2LDBA 2G6BA 1WVIA 1VZ2A 2AFRA 2ZTMA 3PHGA 2O23A 3S44A 3WMEA 5I7HA 1HDRA 1RXEA 3PNOA 4OY3A 3WL8A 1T4GA 2Z1MA 2XQVA 1CC1S 2EX1A 3UMSA 1E96A 1V5WA 1AKWA 4X0EA 4NPAA 1Y9AA 4W8HA 421PA 2GAIA 3EIQA 4IWYA 4KNWA 4HNAA 3C8HA 4X3CA 3C1AA 2HDNB 2RMKA 1SQ5A 1UK7A 1QIFA 5FWYA 1X7YB 4MVJI 2HIMA 4JI1B 3UJ6A 3UMVA 2VVTA 2WVHA 2RAPA 3LIIA 2XRZA 3PIRA 3MIIA 4MCIA 1PSDA 2FX5A 1AK9A 1RWQA 1X7ZA 2C88A 4ZP1A 1ZZEA 2AW5A 5B37A 3OWXA 1U9YA 1PS0A 4XQ0A 3VISA 4CKEB 1S1CA 1SIOA 3KR9A 1YE3A 3PU6A 3LUHA 2BJHA 1IHPA 2AFIE 4LZPA 3OQBA 1Z17A 3LH5A 5IXSA 4BNHA 2G9NA 3GEDA 5CDTA 1QQ6A 1VLHA 2OOSA 1XUOA 4CT0A 1I7SB 3GP3A 5AWFC 2JI6A 1CRWG 2OAP1 2OD9A 2W6CX 3NBFA 2V6MA 2HSGA 3B6JA 1PNOA 3B1FA 5G3ZA 2C2GA 1V8BA 4MRNA 4MW4A 3VPHA 1EEHA 3Q9SA 1R6UA 5E4TA 5TGDA 5JJIA 3VBEA 1CRZA 2C9DA 2G4CA 3JPWA 1QKJA 3QVMA 3BILA 4JLOA 2QVBA 3VNAA 5TIIA 2W42A 4JYAB 1PLJA 1Y1RA 1L7NA 2AK3A 4OI4A 5BWLA 1UBCA 5CA0B 2QLLA 2R8BA 4E3WA 5BUZA 2AKAB 5EJGA 2B0CA 2GTPA 1D4OA 3ENWA 3O8NA 1RYFA 2F6RA 2PEYA 2WWHA 2YV5A 3B3AA 1OKKD 3N0VA 1T3SA 4YRAA 4XPIB 3DBRA 4EPTA 4J1TC 2Q6TA 1DJMA 1U98A 3DWFA 1JR3E 5KWSA 3NH9A 4RDXA 4Y0VA 5TE9A 2HA2A 3E22B 4O59O 2H7VA 4X1OA 1IWOA 1P0IA 1A7JA 3DCYA 3HYSA 1P72A 1JKIA 1PUJA 2ZJZA 3A9SA 3NTXA 3FWHA 2QKYA 1W36B 4XI9A 5CHEA 3W2IA 2RARA 3W5UA 5CBKA 5FO0A 2OFFA 3L41A 3H5RA 3EY4A 2BGNA 3RJZA 3ZR4B 1FQOA 3OPNA 3MJHA 5FV7A 1WSBA 3HB9A 5IH3A 1Y4ZA 3HSSA 4B33A 3FSGD 8ATCA 2D2FA 1EDOA 2V0GA 3DUFA 3H1GA 2YIVX 3HMQA 5KNCH 3EAFA 4BO4A 2RGGA 5FP0A 4N54A 2HHCA 5I9SA 1ULAA 1US8B 4OLFA 2NYUA 5LB2A 2WAYA 3NIWA 1EK5A 1JBKA 1T0BA 3KXIA 5HYVA 1JMYA 4PAWA 4DLLA 3MZ0A 1DAPA 3TSCA 5K03A 4Q66C 4MW2A 1XYGA 4DUZB 3ICQB 1IATA 4IJQA 1GRNA 4NMHA 4P7JA 2IWRA 1XF9A 3H84A 4X61A 1SB9A 3R24A 1XEXB 3NEAA 3RUIA 3FCEA 4BVGA 3HM2A 3ZD7A 4G4SP 1HYEA 2IU4A 3IO3A 5J23A 1HRDA 1QIJA 4NYIR 5IP5A 4L28A 2Y8EA 5GMOA 3Q8KA 4Y2XA 1JDSA 1MTOA 4N65A 3FX2A 1GD1O 1ZBDA 3CRQA 1N77A 2YY5A 4M8SA 1YT5A 1QYCA 2TRSB 2PCLA 4E4TA 1IXYA 2GUGA 2O59A 5JPCA 2IYZA 1SUFA 2J67A 3BXZA 1DBSA 2Y0CA 3OX3A 4NOMA 1REQA 4OMFG 1G9TA 3IP7A 4HQKA 1TYEB 2O2DA 3A31A 3LSTA 3DTNA 1QAQA 1MC5A 1YJ8A 5K3FA 1DWUA 1RKQA 1D09A 2OHGA 5EXSA 3CHYA 3UCEA 1KFEB 2UKDA 3L7AA 1YCHA 3EIOA 5KWJA 5JCJD 4PG6A 3MWEB 4UQOA 1T3HA 1UP6A 1XYYA 3KLMX 3NGXA 1Y8AA 4QUEA 4EHJA 3D3NA 1NMQA 4MV9A 5CURA 2XT6A 3KQSA 1WVGA 4D25A 2C5HA 2QGNA 2D13A 2XMQA 2BHRA 4UZEA 3AKYA 1OH5A 1I2ZA 1OGYA 2PXHA 5F5NA 1TZMA 1NQAO 1S2MA 2FWAA 2R6DA 2WFZA 3E35A 1DOZA 4NEQA 4J8PA 4NBSA 4RL4A 4IWXA 3CH5A 2WJVA 3U9TA 4DXAA 3DL0A 1E98A 3HG7A 3SBXA 2Q4DA 3L4JA 1NXQA 1OBOA 3H9CA 3B2QA 3G2MA 5ICEA 1YV9A 3T94A 4G63A 1O08A 1DWQA 2HYDA 3H5LA 4K9PA 1WSWA 2NU8A 5KDLA 1RWOA 3B51X 4QM7A 2FW1A 1P0FA 3BDVA 3BSYA 4YT2A 1VL2A 1WB9A 1F8YA 1NQOA 3L77A 1C5KA 3MMNA 3S2GA 2XA2A 4P80A 4EBBA 2MDTA 2FQWA 3NHUA 3S2SA 2P4EA 3CVWA 3C7DB 2JIRA 5CK5A 4KXQA 4NCNA 5K2MA 3ROTA 1RPZA 4IDGA 1HZZA 2HWYA 1RS0A 3QOXA 4X1IB 1R4AA 3N2ZB 4AQDA 1B16A 2BKEA 3M9XA 5H3LA 4O4LF 2HMTA 3JSXA 1PJZA 3V3KA 2XYVA 3FNQA 4KW7A 4NNJA 4QBHA 2GBIA 2R6CA 5DWVA 1PJSA 4YXWA 5A5VA 1ZSYA 3Q15C 2CJXA 1M34B 2GQ0A 4FR0A 1OFVA 3NOQA 2EXXA 3QIAA 3I0NA 2O9JA 3N8HA 4FMCF 4MZDA 5JE8A 3U4DA 4DLNA 3AR6A 2DHRA 1Z26A 2W6JD 3PRKE 3E5MA 3R3YA 4D6XA 1H66A 1PR9A 2M32A 2ZRKA 1R9JA 4G1BA 1QGAA 4MEAA 4TRRA 5DLYA 1TIBA 4IO0A 1XVIA 4RD2A 3CUTA 2GYUA 2I4RA 5DE3A 4N7RA 2ZIXB 2X4GA 2NO1A 4DCUA 5IX8A 5CAEA 3U3MA 1U9ZA 1V5EA 3C85A 3MWDA 4C7KA 1Q84A 1YI8A 2PZLA 4EATA 4BWFB 4BWVA 2HSWA 2Z3ZA 5KX5F 2ZUBA 3OIWA 3E9RA 4L07A 3N0RA 4BBJA 3ZHXA 1AN0A 4G6ZA 3ZQUA 4LMRA 3AG5A 1V5FA 2C31A 4JC5A 4LDJA 3UB4A 2XB9A 2I3AA 3PLNA 2O7QA 1L7XA 4PWZA 4ZARA 1JSRA 4BB0A 2EBUA 5C8YF 821PA 4CL0A 5GINE 2DETA 3GCWA 3KHKA 4NCAA 1IDN1 2BEVB 4OIFA 4DIKA 1J23A 2BFEA 3GYBA 3W9BA 1TZBA 1HT1E 1WHSB 3FSRA 4H9GA 3C8ZA 3EVNA 5WRFA 5JNSA 1Q3TA 5LN1A 5ITSA 5LOVB 3M9LA 2NMVA 4IX1A 3ZDFA 3TEMA 5DHPA 2RHJA 4GGPA 1GZVA 1XI2A 4WFJA 4BFXA 3HYTA 3DHVA 1ZJYA 4Y2UA 4FSHA 5FFNA 2Q49A 2GTIA 1FS4A 1NR5A 1O95A 2NUAB 1CIVA 4K9DA 3CRRA 2H1CA 4LNAA 3WP1B 1R18A 2IP1A 4CMHA 5B7NA 2R1VA 3KZKA 1WZUA 3I1IA 4XTRA 3OZGA 1DP4A 4RVNA 3UWKA 2H8GA 3KD3A 2P9ZA 4RGQA 1F4PA 4Q4JA 3CXRA 2H2HA 3INTA 1JDBC 4B7CA 1ZEJA 4IDQA 3VHRA 1NLYA 4WEQA 5KSPA 5JPDA 2ZBDA 3IT1A 3O1JC 4HEA1 3DMTA 1GNTA 1VSQA 4XVRA 5CT6A 5AICA 3S7TA 2VSXA 1M6YA 4ZYTA 4PCVA 3NJ8A 1GILA 3E7PA 5FQNA 1GPLA 1J8MF 1SM4A 3HUFA 3P9PA 1Q17A 4IMJB 4QREA 1DXHA 2IYRA 5EYPB 1JMKC 5CITA 1JDNA 2QIPA 1AHNA 1Q21A 3M9WA 1F6WA 2XNDA 4JBYA 4QGFA 3G2JA 3OZSA 1Z35A 2OXIA 3HCNA 4DDVA 4IPTA 1CY6A 3FVTA 1LY1A 4CYMA 1QWOA 3Q10A 1WQ3A 3FUXA 4MJXA 4KDCA 1CQJB 1OW3B 1YL5A 2IHBA 2ZYHA 3RVNA 4AZ0A 1QDEA 2G07A 1YRBA 3U44A 1WG8A 2ZWIA 3RC7A 1MJ5A 4DDHA 5A0FA 4EVIA 221PA 2HHHB 1HMPA 2Q3CA 4GMDA 4F3NA 4GD3Q 3SEAA 3X1ZA 2H7XA 1Z34A 4MCHA 3PD1A 2PG3A 3R3UA 1ZN8A 2GEFA 3D5EA 4MUYA 5EPEA 4B6GA 3H04A 4YAIA 1LTHR 1S2GA 4CQMA 5C4IA 5C1DA 4BQSA 2JJ1D 2V3VA 2ISQA 1RI4A 1YS2X 1ZHFA 4M2LA 4CTJA 3TD6A 1EFVA 2CLSA 4L8LA 5A71A 1SVOA 3ZDEA 1K08A 5JZBA 1YR7A 4A8JB 2XF8A 3CLRD 3FBGA 4H7HA 2H2AA 1K9SA 1WSAA 3KLNA 3KX2A 1RHRA 4JT8A 1R8QA 4RDHA 3SJZA 4DGSA 1A8HA 2HJHA 4MS3B 4MWBA 4MVXA 3RAJA 3WK7A 4LJYA 1W2HA 2OV4A 4ZT5A 3BIXA 2VP2A 4RORA 1L4GA 3WKEA 5B3LA 2QM8A 1Z5GA 1V3QE 4J9UE 4RTMA 3I9OA 4HFMA 2ZBFA 5EXEA 2IU0A 2P4HX 1UT8A 4DV4B 1KP9A 2VH1A 5ITWA 4D9HA 4HNGA 4F9FA 3KZMA 1O6BA 1WHTA 4Z7OB 1E92A 2C95A 1B3BA 3ZDZB 3ANYB 3QKIA 2VF5X 3SQWA 2I76A 5TX7A 3PTZA 2BLNA 3IHKA 1NXWA 1GPJA 1NBWB 1HE3A 4OVKA 4OXRA 1KYTA 1SBHA 1W30A 1NULA 3JW8A 3U9LA 3N87A 4H08A 3GVIA 2BZGA 3MMZA 1AJEA 4CM3A 5LSAA 1NTRA 5HFJA 4H18A 1GCGA 1RHJA 3AUAA 2JD2A 2WWWA 4JUIA 4E09A 1J70A 3C41J 5I5EA 5ESDA 1YC5A 1RYBA 3HYLA 3JYHA 5K3BA 1FPMA 4C2TA 5GGYA 1S4MA 5LCXA 4EP1A 4HX9A 4DV0B 3A1WA 4TLAA 5F3RA 3WB1A 4L4XA 3QK7A 2E4ZA 1SQ0A 1HRKA 4OHOA 3MJVA 3IAHA 1RAHA 5DU2A 3PLAE 4GZLA 2IQIA 3R5FA 2YWJA 1VMEA 1FDUA 4JLVA 2KW5A 2O6LA 2R2AA 4N3AA 2C77A 4HQ0A 4LOAA 3NNDA 2VT7A 1U9JA 4OFXA 3GA7A 5CIQA 1EFAA 1Z6YA 3AEYA 1LDNA 2GJAA 2OZVA 1CJSA 5E9WA 5K1ZA 2QTVB 2P9TA 1GZDA 1KQFA 5F51A 5TQ0B 1OXBB 2PZAA 1Y5IA 2FPGA 2ZYAA 3HBLA 4IIVA 4B4WA 5I01A 1OWLA 3I0MA 1DTWA 1ADBA 2V5AA 3Q0TA 3WWZA 4I5IA 2BCGY 1CZRA 2HA6A 4B8ZA 5A5EA 1XQXA 1UXIA 2PX2A 3N8KA 5DYWA 5C1BA 3IERA 1D6NA 4H7EA 3JZAA 4C22A 2FSSA 2AK2A 2IZ1A 4JROA 2QRVA 2PVSA 3AR9A 3Q1LA 1M7GA 4UAVA 3EK2A 4Q3NA 2LCFA 4QXAA 3RROA 3TR5A 2BHSA 3UK6A 5BNTA 5K05A 1NU8A 3TD9A 1ZK0A 5AYVA 3EA5A 1BD3A 1EAMA 1GA4A 1V16A 2VPYA 3CKKA 2PJDA 2WKRA 1P3DA 2YVUA 3DF7A 1U6KA 1TM1E 2CZQA 3PWTA 4WUVA 4ZALA 4CLHA 1BCSA 1RAIA 1B0UA 2RJ3A 3DDNA 4D4LA 2AJBA 4F9EA 3WXBA 5EIAA 3H9JA 4K0RA 3H11B 2PL5A 3EEOA 1DZIA 1T5HX 3AOGA 1NZFA 5F64A 2AFHA 4E14A 5LBIA 5IHPA 4HDRB 2C4MA 5A7HA 1W4RA 3VYRB 1NMEA 3H1TA 4QDXA 1Z0IA 4ZDIA 2ZUTA 5JMTA 4KR3A 3ID6C 3O93A 4RZUA 3SX4A 1DCKA 2I4OA 3OTOB 1IPFA 1IXSB 1F8XA 1DFHA 1G8PA 2WT9A 4UARA 1XEFA 2WEKA 1OXMA 3DDOA 5C4GB 3IR6A 1SCKA 3A7DA 1R8SA 3W04A 1JDUA 3F97A 3L7LA 3AEQB 2OHHA 1JG2A 1I7NA 3OVMA 2JHCA 3L92A 4DJTA 3BE6A 5CB4A 1TO6A 2C82A 2AN4A 1XKQA 1GPKA 4JSYA 4ZYLA 1ADCA 1ZU5A 4UREA 2M6RA 1CUWA 2JEZA 3P52A 2DKOA 5JH7A 3A2MA 4B6OA 2CDAA 2VAWA 3GUZA 3NT5A 3D8BA 1YR2A 2XCIA 3UAOA 5IH7A 1DQPA 1L5HB 1DLJA 3D6UA 3B70A 3OFJA 3LP6A 1OYOA 2AW3A 1YZHA 4BAUA 1P7CA 1QH1B 1R4NB 2VHQA 4JELA 5KSWB 4HWRA 2YIMA 1W94A 3FROA 5E6RB 3TGWA 2A7QA 3TLGB 1N2CA 1L5FA 4BFCA 3VYUB 2FEXA 1IBMB 4GOOD 3KYDB 5AHXA 1RM4A 1G5HA 1GFSA 5LXTA 2GF9A 5IKMA 2QP9X 4HUJA 4RAQA 2B5OA 3WJ1A 1EP9A 3MYYA 5ITZA 4UU8A 4M98A 1JR2A 1Q22A 4OTZA 4N39A 4Y18A 1A8SA 4J03A 3U1BA 3V1KA 3WYAA 3KKLA 4G5FA 5FYDA 1E7QA 4INPA 4K46A 4MW6A 2I6UA 3OZRA 2I3GA 3F8TA 3ACDA 2X19A 4OFZA 3R75A 1EGHA 1U3GA 1VCOA 4EHDA 4TXLA 2MYTA 1AS3A 2VLBA 3E03A 1L5NA 1UIMA 3UMBA 2YN2A 4U8GA 3WO0A 2HA5A 2UZ4A 5AW4A 5C5DA 1U1DA 5HDQA 3BXGA 4ITUA 5FNZA 2OC9A 4ZDKA 4MCJA 3ZIAA 4CQLA 1NI4A 5BSTA 1WEKA 1IOWA 1ZD9A 5FL7A 1L5SA 1MC4A 3ZK7A 1XMOB 4Q0MA 1Y3BE 2IX3A 1VG0B 1BKDR 4ROTA 3W3AA 3OOWA 5F1OA 1PR0A 2GRAA 3CTMA 1PJQA 4BLQA 5K8LA 4LSWA 2P7HA 1HQKA 3CO5A 2B8TA 3LWDA 3SIPA 2GXQA 4ZYXA 2R85A 3LFTA 2Y9MB 3V7FA 2B5VA 1VLQA 1EFTA 1I3MA 2GBLC 2WWRA 1R74A 3KVVA 1TGVA 1CY8A 2ZI6A 1CYEA 2AI1A 3LI2A 1OZAA 5HS6A 3SIXA 4YYEA 5ES4B 1P9WA 2E2WA 3K35A 4FNOA 2LXNA 1VPTA 5C3MA 4JKYA 4RKWA 1W4AA 4JJFA 4PFKA 4AL4A 3N2KA 2WD7B 3RCBA 1JFTA 3ZU3A 4E5VA 3WLTA 1FX0B 1QANA 2Z5FA 1WUHS 2R3SA 2F1HA 2YJZA 3HRKA 4RPCA 5AI5A 5JY6A 2LTAA 2YZ2A 3NT4A 5TJHA 4ZHQA 3KETA 2WTEA 1D9XA 4BRUA 5FB3A 2P35A 1PJ4A 4RZSA 2COUA 4WECA 2A9VA 5ALEA 1MN6A 2OC4A 1N4AA 3UV6A 4BQNA 5KHOC 4KK3A 1UFVA 1AE1A 1I6LA 1RD4A 3CLTC 3GHHA 4XB6B 1PW5A 2FQ1A 4PNEA 4XM1A 3TX6A 3ZJ4A 2JIPA 5K7SA 1I1NA 4OYLA 1QQ5A 4NZYA 2X9QA 3C6ZA 1ZSVA 2H0RA 3VM6A 4BECA 2A2ZA 4XFKA 3WDLA 3I45A 5K4AA 3J7TA 5DP1A 2EWVA 4YJGB 3HP7A 1LPOA 4YA6A 1V7PC 4ZK2A 3C7TA 1XTRA 4UDYX 2PLNA 5DHUA 2XZDA 3NBUA 3UFXB 2J3IA 1GITA 2P7IA 1OIXA 3OY7A 2ZGVA 3GL9A 3FOEC 5I7SA 3A4LA 2BF4A 4PNPA 3SVTA 3KM0A 4RY0A 2MINA 1Y80A 5ALZA 5G1PA 3G5AA 4FW9A 4JP5A 4EA8A 1M8FA 1GKKA 1D2GA 1H1LB 2WVGA 4C89A 1HNXB 3D8NA 1K5PA 3RYCA 1B0ZA 1R0ZA 1TUBA 4BE4A 3SKXA 4JHXA 4FFLA 2PFGA 4TTQA 4DXDA 3L1HA 2WJYA 2IKSA 4TPKA 3VI3B 4XR9A 5KO2A 4L8WB 3TLBA 1A04A 2AG1A 4AZ3B 1OUMA 1LI7A 2HWXA 2JGMA 5KQMA 3DEAA 3C6BA 5EE0A 1LZLA 1YS6A 2VSFA 1J0CA 3U39A 3QLJA 1IUKA 1ZH2A 3UWPA 4KQHA 4CF7A 2FLKA 4IJUA 4D9EA 1WQ1R 1F2UB 4TRNA 1O96A 1JSCA 2OHXA 2QZPA 2VJOA 3DTVA 3KZVA 3PQ5A 4MAFA 4TZTA 5DGDA 1R12A 3PKZA 3IUNA 3A10A 3SZOA 3D6TB 4B7AA 1O95D 3P0JA 4QGSA 5UKDA 4PAQA 2D5CA 5IKEA 4EJFA 4I0WB 5BT9A 1BQEA 1X1QA 3QE0A 1VLMA 5FUQA 2R48A 2SHKA 5H5JA 3A6ZA 3NM5A 3OJLA 1P9LA 4C4ZA 3HY4A 2X0NA 1J99A 1KR5A 1QFJA 1ZIYA 2P8SA 1UKZA 2H1WA 1PGQA 5CFRA 2PUCA 1MC1A 1QHHA 4JX8A 3GP8A 3C16C 5DT9A 3R7WB 2C7GA 1QKKA 2QE7A 2FUKA 5SYNA 2GPYA 4CZ2A 5B1YA 2YJ6A 5FXMA 3F4LA 3D6HA 2ANBA 2JCYA 2HRQA 5KNBD 2A3RA 2PO5A 2WWFA 3A9UA 3H18A 2LKCA 4J3FA 1EIZA 1T2CA 4PZLA 5E9AA 4OSPA 2QMQA 2VRWA 2XNDD 3WLLA 4UM9D 4E4RA 1Q0UA 1H8HD 4KWTA 4MKIA 2WFLA 4RQAA 4GWLA 5E9JA 3TOVA 3TSZA 4N18A 1XL1A 2FRDA 4D41A 1IN6A 2VO1A 3LXUX 1C9MA 5AVVA 5KS2A 2ECPA 3NTQA 2XXAB 4Z3DA 2JFWA 1I13A 1W5FA 4Q93A 5HMMA 2CUKA 1R5OA 3UJNA 1SVWA 3JQBA 5FOQA 2IHYA 1RYDA 4M83A 3LY7A 1G21A 1PT5A 2VUSA 4W5WA 2LCIA 4E03A 4F7DA 3WKCA 4DR5B 3TKAA 3BWEA 3L5OA 3B20A 4CQMD 1YMUA 2OKCA 5IAGA 1P17A 1BDBA 3QLVA 4LF8B 4OL0A 3K5IA 1Z4NA 1XSEA 4R6WA 4ROSA 4L0MA 3ROQA 3KSMA 1C3OB 5DNWA 4XB1A 3T4XA 3V8EA 5D1HA 4DT1A 4WXYB 1I30A 3TOXA 3FBWA 1E2NA 4TMZA 5JR3A 4P2BA 5A7FA 4WD3A 2Q50A 1CY2A 4Y8VA 5L4SA 2W70A 5LZ2A 2VBCA 1TNDA 2X1VA 4WCFC 1PQPA 2C83A 2HLHA 1ZVQA 2HMSA 2PH5A 1Z33A 3ESYA 2PANA 1ISSA 1JFSA 4HMOA 4UXIA 2FN4A 3HUUA 2JGFA 5HTKA 1B8UA 2VSNA 1P3Y1 1IZYA 3M1IA 3ENQA 1Y9ZA 2EFYA 5AW3A 1U3UA 1TOAA 1XZIA 1CUXA 2P62A 3X1MA 2A6PA 3ER8A 4OLBA 5DX0A 4KI7A 1DX4A 4RPKA 1XLUA 4UVIA 3VOSA 3W5VA 5GVSA 3OF3A 4CMEC 4O4JF 3BE5A 1ZHOA 2C3YA 4QAQA 2C54A 1IB0A 1FFBA 1KMQA 3FMVA 4PX2A 4TYYA 1U7TA 4WOKA 3ZWPA 4Z9YA 1CK4A 5G4LA 1V8FA 5B2ZA 4QNMA 3T5TA 3EXHA 4BGVA 2B1IA 1YNSA 2MCFA 5LA6A 2XUOA 3MC1A 2Y67A 5ALJA 3R5HA 3AL2A 5HBGA 2AXNA 3S68A 2P1DA 1H2BA 2AMYA 3F5MA 3NFRA 2GWRA 2OZLA 3WMXA 3L0CA 2I65A 2OO5C 2YQ5A 5DX1A 1NVUQ 2P65A 3NUQA 5JAQA 2VSYA 3C8UA 4QTZA 3FFAA 4FYKA 1WEHA 4M1YA 4XAQA 5EJ9A 5KHAA 1D1TA 5DISB 1L3BA 3VSDA 1BMFA 4A2QA 4OHYA 5HSGA 4YUXA 5HG0A 1OI3A 5FPYA 3OJWA 2F67A 4PGAA 4RS3A 4ILEA 3S1LA 1DELA 3TMAA 1FDWA 5FFMA 1KSFX 2XNKA 4O02B 2Q6OA 1KE2A 4A15A 5ELXA 4F72A 5AJVB 1O2DA 5BSFA 1SWWA 2GAFA 1KHTA 3AFNA 4RY9A 1MOZA 4YUVA 1WU8A 4HH4A 4TWRA 3VKUA 3CNBA 4FYIA 3JQ7B 2E55A 1ZM7A 4I4TF 3NEYA 5ADVA 3V6MA 5EIXA 2IS4A 1A98A 4U0JA 1G8KA 4IDNA 4KMSA 3GCGA 2O3SA 1JHYA 1SU4A 2ZT8A 4L22A 3SG0A 1NPYA 2XB4A 3KWJA 2HXGA 3ZWYA 4ADSG 5IFKA 1TM3E 3AP3A 1YOVB 2RH8A 3IGFA 4UEKA 5IMBA 3S29A 1CDDA 1C30A 3DEIA 3D0OA 3VH4A 1UQRA 4CCAA 5IDXA 3FTQA 2HHAA 5DYIA 4DMUB 5K3SA 3NNNA 4JT9A 1KAEA 2AI2A 2CXOA 4M55A 4E46A 2QX4A 1TKAA 2G8NA 4KQ6A 4A8PA 4U7DA 2YYYA 4XX0A 3LECA 1S01A 4AJIA 1O8BA 2QBYB 3K0CC 4LZOA 1HT3A 1EM6A 2FPMA 4MUFA 4TLCA 4N9QA 1YGPA 2M6SA 4Z9BA 3LP5A 1B14A 3EQ6A 3ZD8A 4R2LA 1ICEA 2ODBA 4R2JA 3ZY3A 1AV7A 2ZRGA 3OO1A 2DPXA 2YZNA 1WWKA 2Y0DA 5LLSA 4H35A 5HRUA 3GPDG 5ALNA 3EAGA 4DA4A 3I30X 2PUBA 4CEJA 4ZI7F 2N3ZA 3G2OA 5CVUA 5IASA 4QVIA 3IP8A 1CNMA 2B98A 4EPXA 4F8EA 1XK7A 2HKIA 3ONWA 3MAJA 3WGZA 3KK0A 3N9IA 1MOSA 2Z1NA 4Q7EA 4QOIA 2IY7A 5CU7A 1ZK3A 3AWDA 3QLTA 4XQ9A 1JHXA 2C99A 5SICE 4CMJA 2I9KA 1W35A 1CXZA 2BGIA 3I83A 1JG3A 4R54A 3R2JA 5HE8A 4LV8B 2UUAB 2CFCA 2CFRA 4B3FX 1GYRA 4JGBA 3UMFA 3T7TA 4OFBA 2ORWA 2PKEA 3DDHA 1QC5A 1RSZA 1HTTA 1YCGA 1Y5NA 2ZDQA 2DZDA 3ABZA 1RWMA 3GN2A 2QEQA 1V11B 4B3SB 4B71A 1SUBA 3ZY5A 3VDMA 5EERA 3AH8A 2NZVG 3KAPA 3LWNA 1A9RA 2I55A 2X42A 4AROA 4BLSA 2JATA 1FDSA 2RB5A 3SY8A 3ZS9A 4F9TA 1QHSA 4M49A 2YUIA 1QFSA 3V2UA 1BJTA 1LCIA 1Q7GA 5I47A 4BBAA 1RPNA 1NW5A 3C0KA 3KQOA 4BNTA 1V5IA 1M8KA 1ZINA 4FDUA 2IOYA 1FRFS 1SXHA 3O38A 4R4JA 3KNZA 5C35A 3P2MA 4DJ5X 3QP9A 1B43A 2DPMA 1ZKDA 1UBKS 2NPOA 2H0AA 3ZIAD 3UAXA 4HKTA 1T1SA 1MIOA 4JGIA 3KAKA 2YHUA 5A02A 1YTUA 3U56A 5IXYA 2XOKA 2H5JA 3OM8A 4IUYA 2CLOB 4RF2A 3L8GA 4UMDA 5FL7D 1XROA 3WHLA 2B1RA 1DU4A 2JI7A 1N0HA 1X7XA 3KLOA 3F49S 3W3AD 4BFSA 4F0JA 4HNHA 4YCDA 4CBVA 4QYIA 1G6HA 1EGVB 5EA2A 3A28A 3UYKA 3K3PA 4AUEA 3PFCA 5BUQA 1GTRA 4P5DA 1QFYA 3SVZA 2CHEA 1RMYA 2NV6A 2HQ1A 2UDPA 2J9FB 3K9WA 1RI2A 1SOUA 3W9SA 3QJGA 4Z3OA 2FWPA 1II8A 1NBOA 5G02A 3ISJA 3MHPA 3Q3EA 1QNFA 2NZWA 1C7RA 2QYSA 3GLIA 4F6LA 3PUWA 1NZDA 4TKUA 1XWFA 4B3RB 3WOHA 3C6YA 2VHUA 4I55B 3HKCB 5GJWC 1YB1A 4UULA 2QL6A 4B9EA 5IDVA 5H68A 1EB8A 3O8CA 5JSHA 4WVLA 4L3OA 1PJ8A 4R3UC 3DE1X 4OHBA 2R7NA 5EIFA 1PJLA 4REMA 3VHXA 4CR8A 4G26A 2VXCA 2HAEA 4C7BA 1KETA 1WXWA 3AR3A 1L7BA 3BIWA 1Q5PA 2G9QA 3BL8A 1WP4A 2C5SA 2MU1A 2RH5A 4GRDA 1KK2A 3SZLA 4EA9A 1TO2E 1KQNA 1GG2A 2A5YB 3BGSA 3DW1X 1HFKA 4I6EA 3GNSA 4DKXA 3O1LA 1FNBA 2GKGA 3OURA 4P4LA 5EJ7A 5IWCA 5BNIA 2IW1A 1YB5A 2JI9A 5TV2A 5F7XA 1J25A 3AUUA 4O4IF 4DZZA 4X95A 3O21A 2GNPA 1XXLA 1UAGA 3ETLA 3EVGA 2IUFA 3VZSA 1U0HC 5KCZA 3S8YA 2NO4A 1Q14A 4RUKA 4WKNA 3V8MA 3CSSA 2CFTA 4JP3A 4N01A 4TWJA 4V38A 5BYJA 5I9IA 2OWEA 4RHYA 3REGA 4LRYA 3RHTA 2DQYA 4MRRA 4IGEA 1WB6A 4R2KA 1RM3A 1XLTA 2I4IA 1ZOIA 2WZCA 4XIJA 5C5EA 3ZYZA 2HMUA 1FDOA 3QEJA 1DB3A 3H5WA 3I6BA 4PYJA 2AVNA 1POWA 2CNOA 4X94A 4D74A 3KQWA 3DBLB 5C18A 3DTVD 1WKVA 3KHSA 1OROA 4UAUA 2Z95A 3GR6A 3KSZO 3DHEA 4QYXA 5EQTA 3VOTA 4IMPA 1DHRA 3WRYC 5BSMA 5EIOA 3ZLUA 2A1TR 1T1GA 3NWOA 5J40A 5HIJA 2PX5A 3OLCX 4MV8A 1CUVA 1N5IA 4OQXA 1RP1A 3Q12A 5SZIA 4BATA 2VT6A 2R6JA 2ZG6A 1ZOLA 3HGQA 1UL1X 4PANA 4AC9A 1RWNA 1TQ2A 3SEZA 5LYJA 5KYXA 3ZIUA 4U39A 2JLWA 4Q6BA 1OFUX 3KHTA 4LBVA 3W5BA 3RC1A 2JGAA 3UXHA 2GEJA 2IUSA 5IAKA 3HCBA 2QE7D 2HT1A 4BZWA 4J0IA 3UJ8A 3KBBA 4IFEA 2Y68A 4K9QA 4D44A 1NP7A 1NBME 5T3YA 2A78A 4KIWA 1ES9A 1MABA 4RD6A 1JPNA 721PA 2RI6A 1ESNA 1ICIA 1PZHA 2X6TA 5D6NA 2ZJ1A 3GRZA 1SUDA 4AYTA 2XUZA 1L5LA 2GBPA 2Q3EA 5CD1A 1LFAA 5T8KA 2ZRDA 4MRVA 4C4YA 1E2EA 4QE3A 1XQ9A 4XIYA 5TQ2A 4JUAA 3PSHA 1C9JA 3ZXXA 2AMLA 1RI5A 2H48A 4L4SA 1QK5A 1YS4A 2OZKA 3R5KA 3ZV5A 4C6HA 2RHRA 2PBRA 3D7NA 1U5BB 1P39A 1U2EA 3QVXA 4RPJA 1BW9B 2KYRA 1L3IA 1S2OA 2OEPA 2ZUCA 4U2CA 2IYFA 3IHLA 1EFCA 4LRTB 1Y8QB 4PAOA 4I2NA 2NXNA 4OKIA 3K8ZA 4I50B 2VYCA 3AC0A 3OIYA 5THKA 1EE9A 3WB0A 1L1EA 1V3UA 4IFTA 1DKNA 2PD6A 5AO9A 1P4HA 3FTFA 2AUMA 1LLFA 1UDRA 2XZLA 1WCIB 2QN2A 3JRXA 4EG0A 1Y6FA 4UCQA 4P5PA 3NALA 5IUKC 1N33B 4I4IA 1JQLB 2ZUSA 4F5DA 2ENUA 3MW8A 3C5CA 4JLBA 3MOIA 4QYWA 2EKQA 4Y6SA 1IY2A 1JIJA 2AN1A 3UF0A 1OXUA 3WQBA 4FJ0A 2FXIA 1HLDA 3L1VA 3N6RA 3KVRA 4TS4A 3SZGA 1GPYA 3NHRA 4ER7A 1LV8A 2JD1A 3QXJA 5KJEA 2GN6A 5CM8B 3UJPA 3V6LA 2VZLA 5CXUA 5AW1A 4YP9A 1P0PA 1NVBA 2XDYA 2ZIUB 3GA0A 3IODA 3QU5A 4QUDA 3VNBA 1QBKC 2DXIA 4RV5A 3FCXA 4UHCA 3BL5A 3U7HB 2I6XA 3ITDA 3O1IC 3RRXA 5D3ZA 4HDKB 4JWTA 1FFAA 5GONF 4IW3B 3F9IA 3KVNA 4XVQA 1GYQA 4F38A 4BUJA 4PC3A 2JLSA 1PBTA 4FXPA 4R84A 1D2HA 3AEZA 1JT9A 1TD9A 2LE0A 1CQWA 3N76A 5EXDA 3W05A 3TG2A 4BAGA 1YZQA 2JNWA 3J81A 2GVDC 4IUBS 4LMAA 1BDHA 4PHGA 4NG4A 5BO5A 4WNAB 2VJLA 4FILA 5H83A 1CHDA 4WESB 3CA8A 1QPBA 1W85B 3MRSA 4HRXA 1CX9B 2PRYA 4ZT2A 3G6WA 1MW8X 3TIXB 3ZLJA 4R68A 2MYUA 2CNNA 3HBAA 4URHA 5DIFA 4DQ0A 1NMXA 4LRQA 5F78A 3BGOS 1PVVA 1ZO8A 1GDDA 5F3DA 1XDSA 3KJZA 3LXXA 5KYWA 4BNDB 1JTVA 1ZITA 1ENZA 2FPPA 4JS0A 2J0QA 2A1UA 2QAGC 1JN0A 2ZIVB 3GT3A 4PYRA 3FYUC 1ECBA 1AXEA 2O48X 5IJ9A 2AWNA 1BMFD 1AURA 1RBYA 3C3BA 4AECA 3VPBA 3EE6A 2HM7A 4YP5A 4ESEA 5B64A 2MHCA 2EFHB 2DFPA 4E88A 3BRWD 2GM5A 3O84A 2NVBA 1X39A 4M9UA 1IZ9A 2UYQA 5CGQB 3ZDQA 1J90A 4HUQB 4BXOA 3L04A 1YHNA 3OLXA 4R9VA 1NF8A 4R40A 1EG2A 4BLOA 3IEIA 2R8PA 3IT3A 1XQYA 1EX1A 1TJNA 3NCHA 3N7TA 3HR4A 1T25A 3FWYA 5DZSA 5BMVF 4RWZA 4OO3A 1NUAA 3P26A 4EFNA 4RFLA 3W2GA 3VH2A 2WYVA 3CH7A 2HLPA 1TQDA 3DWGA 3R9WA 1HBJA 2QT1A 2FWBA 2VK2A 4W9NA 1IBLB 2G67A 3NTUA 1H2XA 3PUXA 3GI1A 4FZ5A 4HDNB 4JB3A 2FGKA 1PKXA 4LVNA 1U3TA 3K0FA 4LZAA 3WBJA 4NJOA 2OBXA 2AA3A 5CTJA 5CB6A 1RXYA 2C84A 1T2VA 3GJTA 4LAFA 4TL6A 3TOSA 3WNQA 4CTNA 2WHEA 2B30A 2PLRA 2GAJA 1K06A 4Y7CA 3BMXA 5L4LA 4CL2A 3LPLA 3ZCRA 3MXTA 1O97D 3IQXA 4J16C 1KI6A 5JD6A 4KACA 3M3PA 4TL9A 4WNIA 4WZBA 4CEHA 3LHKA 4C2BA 2ALJA 3FKJA 3HRIA 4HXFB 5B3JC 2YVKA 3SEQA 1U4NA 4P35A 4EW1A 3TQCA 2KSQA 1OGIA 2VQ3A 1IL0A 3R0JA 2QIOA 4HQLA 4RPHA 3GJXC 2FP4A 4YRPA 1TKRA 1EWVA 1PR4A 2OM6A 2C29D 2BMJA 4FE4A 5HGJA 5TMDA 1RJFA 5F7ZA 3UKDA 5AHOA 3WNBA 4RTLA 3ZVMA 1RZRA 3UNXA 1VYVA 3QELA 2HCBA 4E07A 2QLFA 1F8UA 1JHVA 2D74A 3DTTA 4K6OA 3EGDB 1TO1E 4RSGA 4YQZA 4PPGA 1EH5A 4BKMA 1E7SA 3URMA 4X7RA 2FPLA 3Q8MA 3IEVA 1YH3A 5J63A 3Q3HA 5BR1A 1A9TA 4I36A 4MVJP 3DZBA 3W3AH 4LYFA 5ISMA 3CX4A 5FNVF 2WIGA 3VO9A 1Z6QA 4NFLA 1FXSA 1UMBA 3TL2A 2Z8XA 4OQFA 3E7FA 1LV7A 1U2TA 4DCOA 1QIIA 2YY6A 4DCCA 3F0TA 2YQZA 3BDAA 4AKGA 4LJ4A 1FS5A 4PIPA 4EIWA 1PX2A 5ALHA 1KEPA 1TT5B 2FZVA 1JEJA 2G4LA 3MJSA 4FUTA 4ODIA 5C81A 2XY4A 1P2UA 2NO5A 1BS2A 2V7XA 3AMVA 1DAGA 1DO8A 3CE6A 3FNFA 3G13A 1W9MA 3P19A 4NBTA 1ULSA 3TB4A 1U9IC 2YWCA 3TLEA 4AKSA 4EGAA 1XTZA 4J2HA 2YJTD 4LNUB 1M1YA 2P75A 1TFRA 2W0MA 5CFZA 1CS0B 4IINA 3O3CA 1NW3A 3M4YA 3DVLA 2QP3A 3BFPA 3PDIB 2W2NA 4ML3A 2K2QB 3SM9A 2Q6VA 4ENSA 4JJ7A 3GNTA 1BDIA 4PPNA 4U7GA 2W7TA 3S2IA 4CIXA 4YX9A 3JATA 4QBIA 3BQ9A 5F98A 4F12A 2I8CA 4CKZA 4R05A 2JH3A 1H6DA 1HSZA 1V4NA 1VC2A 2ZRAA 3RKUA 3RAEC 1P2GA 3EVCA 4YJ3F 1GZUA 3PUJA 5IKXA 3U4QA 2HJRA 3GAAA 4YP7A 4AX8A 1W0CA 3DKPA 1ZIDA 1Z6PA 1B6RA 2BGMA 2JFOA 2NT3A 3LFUA 4QL3A 4Q4AB 5EWLB 1FIUA 1Q0QA 2E9SA 2IEGA 4CCWA 3NS7A 1FP4A 1WZ2A 4I5GA 2OQ2A 2P9YA 2VBGA 3B7WA 3JASA 4LHXA 1VIDA 3BJRA 3D8SA 1Y81A 3IE0A 1GUBA 2Q1SA 5AH0A 5GM2A 3FA2A 1J0BA 1N8KA 2JBAB 5EUQB 4DYVA 4LCEA 3SJ7A 3TF5A 2WDPA 2RGBA 5KJCA 3CLUD 5JNVA 2CVHA 1S8OA 3P9IA 5F73A 3BEOA 4JOCA 5HJ7A 2OBYA 3W1VA 1G4UR 5KOJA 1HNWB 2OZEA 1AUQA 3JXEA 4EAQA 3P0HA 4UEWA 5DNUA 3QEOA 1T3GA 5AW7A 5FI0B 4YRJA 2VP9A 2Z6VA 4KRGA 2BI8A 1O77A 1MZPA 4EUKA 3WV5A 4JVSB 1Z73A 3GVCA 3UH1A 1NR7A 4DG5A 2V98A 2HL6A 2C78A 2BTOA 3ETCA 4Q37A 4JQZA 3SICE 4EVSA 2IDZA 1VKJA 4QJ5A 3MTJA 1GN9A 1RKVA 3Q3VA 3AO0B 3C1UA 2OY0A 3F7OA 1RAAA 4V0OA 4WK6A 5DYTA 1VYTA 2OLEA 1DXQA 1W19A 3N74A 4GM4A 3TIFA 4QGHA 3ZW9A 2C2KA 2Q5CA 1HE8B 4RY8A 3GLUA 2QMHA 3FW1A 3B6MA 2J7PD 3DZIA 4FM9A 1KJ9A 4OJYA 1QVZA 3P32A 1TADA 4QJIA 4U9UA 3HJFA 4PZZA 4HQOA 4AMVA 2YW2A 1WNFA 3A36A 1UP7A 4JLMA 3UN1A 2A9FA 3LSYA 4NMMA 3OQPA 1E9BA 3S0JA 2OO3A 3KB2A 5H81A 4A5SA 3T3PB 3IJEB 3PNBA 4B32A 1KMHB 1B8VA 1XCPA 1M2VA 1WUIS 1K6MA 3FLAA 1L1RA 3IA7A 3LL4A 3ZNPA 5LVAA 3VH3A 5T4HA 4US2R 2AGVA 3RFTA 4DPLA 4ZD6A 4CN8A 4AX4A 2HK9A 3V80A 4MAMA 2OXCA 2ZJ7A 3H7IA 4YMIA 1N6RA 3K92A 3VU9B 1ZJWA 3K4QA 3QYAA 1YMVA 3SR3A 4KE8A 5JSUA 1Z6GA 3B9QA 1Z5VA 4UTOA 1MJHA 1PDOA 1XJ0A 2YWEA 2JDIA 1HDCA 1G8MA 4A3SA 1M76A 1JQ3A 1I14A 1WDWB 4ALMA 3NTVA 3A1VA 4NXNB 4F2DA 2CBXA 3R5SA 3MD0A 4L16A 4YRFA 3HVHA 3A1UA 5EP4A 3O2QB 3WL6A 2CYAA 2ZUFA 2REQA 1CG6A 2BR4A 1XA4A 2GHQA 3D59A 3IC5A 2WJIA 3TK1A 4CM8B 4D8UA 2ZE5A 4EG4A 2YJ4A 2MMGA 4FBGA 4II2A 4P8RA 4KXLA 1ZN7A 3A4MA 5JAMA 3U5TA 2HLDA 3D7KA 2DFLA 4NFHA 4QFBA 4CMKA 1P9NA 1EUCB 3CF4A 1J2YA 3AHIA 4DCTA 3DOEA 2R87A 4NULA 4GBED 3SFTA 2X0FA 4E51A 1Z0UA 3SYLA 1I4EB 4ER0A 4KRXA 2VNKA 5JQGF 3CZPA 1M5TA 3EJ6A 3EOAI 3UGJA 5HJ5A 3W9UA 5FLYA 3DO6A 4G01B 4JB0A 4P58A 4WBNF 4A5OA 5BVGB 1Z4PX 2OE2A 2H4ZA 3VPCA 1RQLA 3VJRA 3AY6A 1NN3A 3KQTA 3OEWA 4P4SA 2XT0A 3DB2A 4AJJA 2A30A 4P3NA 4QNNA 3GFRA 3T7DA 4PSVA 4MHOA 4RJJA 2QJOA 3KOXA 1ZMBA 3QENA 5B55A 5LFAA 4FPXA 1SG0A 4NZMA 3OUZA 1DAHA 3ORSA 3UT5A 1O94A 2VNSA 1PR1A 1G3QA 2YFKA 3LK6A 4O2AA 3LCCA 1SHJA 2CUTA 4KAFA 2V7GA 5EJ8A 5JS7A 1QQAA 4IZOA 4V1CA 3QLUA 2EYQA 1THTA 1W4BA 4G09A 4LMPA 4MI6A 4DNQA 2DBQA 5T6BA 3U3JA 1WW3A 3WLKX 4B9AA 5DWDA 3MTIA 3OEED 1CZUA 2PY6A 3OU2A 1F2TB 1KXJA 2ZS7A 1XU4A 3NVMB 3ZJUA 4FX5A 4LS3A 4RA9B 4AJOA 4BPBA 5LD2C 1K4MA 3EXFA 1NXSA 3ZHBA 1I1QB 2OAEA 4URYR 4KYVA 2AQHA 3OSZA 2FE1A 1K0FA 3MOSA 1GKIA 1DV2A 1IZ0A 4TM7A 1F1JA 1GZ7A 1Z2EA 2ZR8A 4IIBA 1KKUA 4WNYA 4N82A 3VR2A 2DWUA 5BN3B 1CQIB 3IIIA 2ZAYA 4FOPA 3I52A 1NC3A 1THGA 2NU7A 3CB2A 3CIFA 3EQ9A 4OOFA 3RANA 3GLGA 1ZVMA 1PJBA 3I3OA 1RXCA 3RUHA 4R83A 4CMAA 4FT4A 1O0BA 3O91A 3A2NA 5LPNA 3JZDA 3KB1A 1SY7A 4JAVC 3BJMA 2EERA 3GMIA 3H16A 4I3HA 5AM3A 3HZRA 5EIEA 1XHEA 4TTJA 3HN6A 1JJFA 4TLDA 4MP3A 4QYSA 2O8BA 3BIOA 3KKOA 3SGLA 4XD7D 4R81A 1YHYA 4ALJA 5FBRB 1Z2DA 3VNRA 3Q8LA 3EIUA 1SD5A 4GQBA 2EEZA 2VJKA 1ACJA 1RWPA 1CDOA 4WBSA 3RADC 3NHYA 3V9PA 5EPUA 4M1SA 3DUWA 4PHCA 3CNHA 1CT9A 3GK3A 1TKBA 3RIMA 4ZMRA 1IHOA 4CETA 3I64A 4MKFA 3WWYA 4EARA 4LPKA 2MOKA 3A3YA 3O4HA 2NUBA 1L4BA 2YWGA 1TYZA 3CLSD 1NYQA 4NYIQ 1G20B 2VPZA 1IVYA 4R1SA 2V9CA 3W6PA 1E99A 2B1QA 4DW8A 1T9AA 1YAJA 4O3MA 1MRZA 5A3RA 2D00A 1WMEA 5CIWA 1Q57A 4DIDA 1H42A 2NVUA 3LA8A 3EA0A 3K1AB 4UVEA 3T1NA 4B4KA 2B21A 2HDWA 4R1MA 4Y9TA 1W5AA 2VF4X 3OQ1A 3A27A 4OAPA 1C7JA 4DYDA 3NVKI 3ZTTA 2OV6A 4UNSA 5AK3A 1F2VA 3HV0A 3PC7A 1SRQA 1CY7A 4S24A 4BMSA 2O2ZA 3BXHA 2O2EA 4C6TA 4CIYA 5BWNA 5HKOA 1WUJS 4ARVA 3SJAA 4POAA 3ON5A 4LYGA 1U0RA 3R77A 5CPBA 5JIBA 4B3DA 5THQA 1H2RS 1BZYA 4BS9A 1UXJA 4U5XA 4V0ME 3A2KA 1JEOA 2AUNA 3ROKA 4EYEA 1FLAA 1GZ3A 5HTOA 3I4LA 4B2IA 2Q9UA 1EVLA 1VB3A 4LYDA 3RTBA 3NRCA 5C1PA 2QUZA 3K0AA 4EHHA 2ZEJA 1KJZA 5JFTA 3CUUA 5KINB 4D8TA 4C0JA 3FTEA 3DBHA 2G0AA 3AYZB 2R7AA 4MDEA 1WSDA 2X8WA 5JI2E 3EVFA 3AB3A 4ZOLF 3FWZA 1CUAA 1YZGA 2VWHA 2HMVA 5P21A 3CJRA 1S9HA 3AESB 3E9ZA 4CWAA 1YJQA 5FR2A 2BEUB 2R8YA 4JMPA 3PITA 4AWAA 2R1ZA 2FF5A 3HCOA 3BHNA 4BO3A 4ZAFA 5LKAA 2JAWA 1R6DA 3T3GA 3B2NA 4L9RA 1PLLA 4XZ3A 1UBNA 9ABPA 3DVAB 1N4DA 3PJGA 1KDOA 2G70A 3IR7A 4PYOA 3UUEA 3B6KA 4L95C 4ERXA 4WCVA 4B45A 4ZYUA 3M6UA 2WSIA 4B79A 4V3BA 4Q7JB 5CJJA 4KXYA 1NY5A 3TSAA 1GKUB 4HAUA 2OCXA 1R4MB 3FTCA 4PLPA 3TBHA 1A71A 1TMKA 1Z0SA 4LW8A 2NU9B 2AXPA 5BXYA 3C74A 2FXVA 3RBVA 3V4VB 5JZVA 1YVPA 1NW9B 3R0QA 2BTQA 3MTEA 4LYAA 1XMPA 2CMDA 3RYHA 2XA9A 5B2EA 3JVIA 4D8YA 4UTZA 1LBSA 1TKCA 2TS1A 2IS1A 3MJDA 3E0QA 1RZRD 1IULA 3OAAA 4RKFA 2V97A 1Y0BA 1I4OA 1ISHA 4D3DA 3S2EA 2XDQB 2JKVA 4L0DA 4ZOCA 5B57C 5LQRA 1PK7A 3RSOA 5ECYA 4YCJA 3HR8A 5AM4A 4UCXA 4F04A 2D3WA 1NMSA 3CX8A 4NSNA 4YI3A 1KJJA 3V48A 3VMFA 2QZ9A 3DHWC 3WYCA 5K0ZA 2RK3A 4MQ5A 2D2XA 1CEYA 4M86A 5BVHB 2ZYSA 1A4XA 3FKQA 3DV9A 1HFWA 4Q47A 4ICIA 3ANLA 4LMBA 1NW4A 4F91B 4CR7A 3T3OA 2FEMA 3K15A 3PQ6A 5CXXA 1TW3A 1W0JA 5AVRA 3I9LA 5IDYA 4W5JA 1YACA 2G80A 2C9MA 5C37A 2J5KA 1Z6ZA 2DSNA 3ONNA 1K2WA 1ZJZA 2ZTSA 5D2CA 1SC9A 5ARBA 2OYSA 1FNMA 3HV2A 3JALB 4PRLA 2NUTB 3T35A 1T8WA 1AGNA 1MX9A 2VZEA 3RYFB 3IOBA 13PKA 3PL5A 3FNGA 4GX0A 3QOYA 5ALPA 5I7OA 1R00A 4WI1A 3JY6A 4D9FA 2A7XA 2QT9A 4JLKA 2IHZA 2BFMA 5AKEA 1UT6A 4TT3A 4ZOAA 2VHTA 2XTAA 1X9HA 1WXQA 2VDWB 2X5XA 1I7PA 2EIHA 3QX7A 4I9FA 1D8AA 2W83A 1SCUB 2PZMA 3JQPA 4L0QA 1DARA 2GVNA 4WCDA 5DN6A 4CV1A 2BM1A 1GCAA 1GIAA 4MYHA 4ESHA 3GZ4A 4H2DA 3GARA 2Z3WA 3NPAA 3ZNNA 3FJYA 5JDIA 2W5UA 1FB5A 1FRVA 4M9QA 4PXYA 4XTCS 4PLTA 1XKTA 2XLCA 1FUIA 3GLFA 5DTEA 1B73A 2QYOA 3NWEA 4M1TA 2ACKA 2OAQ1 3T06B 4I1OA 3IQFA 5TNXA 1VHWA 4EWLA 5IJWA 3EVZA 2L18A 2AXEA 1CPYA 1RQNA 3WLIA 1VXOA 2V55B 3P2EA 4Q3KA 2GN1A 2FA9A 2CEAA 1SXIA 5FWYB 1DWOA 5KCMA 1C8BA 1HWYA 2X22A 2BISA 2R6R1 1BS1A 3MUEA 3O6VA 5FCDA 5C46F 5J2UA 1M9NA 4KUEA 1DKRA 2WJHA 4RZXA 3ND5A 2A0KA 2I62A 5DOZA 5H4HA 4IGKA 2H52A 5AM0A 4ZVPA 3CBGA 3B85A 4GICA 1LC0A 4IZIA 2PS0A 5DM0A 4LXTA 4EKEA 1KDPA 1TA0A 5LLTA 4X84A 3B5IA 1W8DA 4BLWA 4C3VA 2NSDA 4D97A 2XQFA 3LA6A 3O8DA 1KI3A 4X7BA 3G23A 4ER5A 3CRZA 1KRXA 1RVV1 2WMDA 3B3FA 3ZN2A 3PRYA 1XMQB 3G5MA 4P3YA 5HF9A 4Z51A 4V2UA 3TMYA 1X77A 1OV6A 4BLTA 2FEWB 2JCBA 1Q2UA 5DGIA 1CVLA 3UKJA 3OWHA 4C21A 3MGAA 1Y3DE 4CMBA 1Z36A 3M34A 4KAJA 2IOFK 1NZJA 3ZGZA 4EGCB 3CN9A 1RXUA 4OMDA 5D7NA 2Y0PA 3GJ0A 4E1BA 2QPLA 4MCAA 1P60A 4MDYA 4O0MA 4WN9A 1J49A 1B4DA 1XZAA 4A2CA 2BFFA 1FBTA 1ZH8A 1QB8A 2FOXA 3JV7A 1Y1TA 3VVBA 4ENVA 5EJ6A 1SQGA 5LMCA 1UBTS 2WMYA 3DHNA 2IU6A 3S81A 3HY3A 4YRRA 4BV8A 4HFJA 4NP6A 3TW8A 1EUYA 1GFZA 1NBHA 3E3OA 4FN5A 4D8VA 2D0OB 3ONVA 5DP2A 1PP4A 1ISPA 3AUXA 4RIIA 3U7JA 4QXMA 3SSMA 1YAHA 4YCNA 1C3VA 2AMFA 1A8QA 3M6VA 5LJLA 4V24A 3SCZA 4LQLA 1OB2A 1XAHA 5KKCA 1A95A 2YFQA 3C7KA 3FUTA 1ACLA 4NL4H 2DWOA 1R7RA 1XG5A 1JPJA 2QD4A 4IHJA 4QNRA 3WLEA 1MEOA 2QK4A 4FE3A 1WW8A 2JDID 5KOHA 3A9RA 3T0GA 3U81A 1KZ7B 1NQWA 2Z1DA 4R51A 3IOMA 2JLBA 2CMFA 5AVOA 2P68A 3KDPA 4LN1A 1NE7A 3WE7A 4AJ2A 1S7CA 4NONA 4XGIA 3Q4GA 1VE7A 5FF9A 5FLXA 1ELOA 1XALA 2P9FA 4B3MB 2B9EA 1MENA 4JVMA 1GWNA 3KUDA 1LRKA 1P62B 2XUGA 1IVSA 5DDIP 1XGKA 1ZLXA 5EJEA 2YHSA 2L0XA 3AP2A 5IFLA 3EVEA 2HLDD 4RWEA 4U4AA 5LP6B 3VHQA 5DGHA 2C5BA 1V9LA 5KTPA 5JLAA 3KUKA 1F06A 2BBOA 2ZAGA 3KR2A 3HRHA 3UZUA 4M60A 4POOA 1VKNA 5AJXA 3GT4A 4QKQA 2CDRA 5F9MA 3CJQA 1HZZC 5TDHA 1BVHA 4IEIA 3CWCA 4NQRA 1YZTA 2QYHA 2XCLA 1OASA 5D84A 1XNGA 4LVUA 1ZD1A 3UAVA 1TFUA 2I5PO 2YN4A 3ZLTA 1XV5A 1R0KA 3EBLA 4B43A 4BKUA 5HGXA 1E2BA 3C2QA 1O94D 4EJ6A 3U09A 3O82A 3I3SR 1W73A 3W8DA 5H70A 1SU8A 1N6IA 2OUIA 1TVCA 1AD2A 2PJZA 3ABIA 4M1ZA 1X1DA 5D00A 1O6ZA 1O57A 5AJYA 4A0HA 2OTCA 1QUEA 2RGUA 4QUIA 3H6HA 3KOYA 5CA1A 3DBOB 3QEAZ 1KDTA 1A8UA 4ENRA 1T43A 3MCVA 2CZCA 3OWOA 4UUPA 3IVRA 3R7AA 2RHGB 3ROGA 3R7BA 1M2OB 1X7YA 4BO6A 2VDRB 3IXMA 4EHFA 3K5PA 1LXCA 4J1QA 1ZPDA 3EXG2 1I1OA 3VSEA 3BD9A 2NXJA 1Q0RA 4F6RA 2QRMA 4GEGA 1BX3A 4DWVA 1PJ2A 1QGUB 1ZIOA 4RADA 3MT7A 3CEHA 2P2LA 4OJNA 5EE1A 3MILA 2AMJA 3K53A 1BXRA 3ZPXA 3EIWA 4FYJA 4LE2A 4PZ9A 1BO6A 3JR3A 4PRKA 1H5QA 4GF5A 2GHIA 2Q5JA 5CK4A 3I1FA 3ET4A 3BRCA 3FE2A 2WU4A 3G2PA 3OM1A 2AG0A 3VDNB 4MKGA 1NVMB 3CRNA 3L93A 3S40A 3K70B 4OB8A 2C2XA 5ED4A 5K0NA 1P2SA 2Q1WA 1RFGE 1BS9A 3ZXSA 1C4OA 3V4SA 3VC3A 3W6OA 4H7DA 5HOQA 1O95C 3MCZA 4ZICA 4FYXA 5A05A 4RMHA 2NU8B 1A1VA 4S05A 1HH4A 4UE6A 3IDAA 3MS2A 1L8LA 1USKA 2Q5HA 4DPKA 1KTVA 2CCJA 2G28A 2ZVDA 5JCOA 1K98A 1VCHA 4NX2A 1NQUA 1EUQA 1CVIA 4XPIA 5GJVC 5CFQA 2QMEA 3DT9A 3GLTA 3LCRA 1K7FB 4JEHA 1JHMA 1RZVA 5EIBD 4OB7A 3LVQE 5E0KB 2OBBA 3MJ4A 4ZEWA 4OHPA 2W8ZA 5FI1B 3PXCX 5DPMA 1G291 3NOOA 5KQRA 2WJAA 4K9RA 5LQNA 4GS5A 4JJKA 5KWEA 4F9GA 4H0FA 1UMDA 3LTEA 1L7VC 3O9VA 2I54A 1Z47A 2Q2WA 1MA3A 2PR2A 3OY2A 5FWDA 4E5UA 3MQ4A 4Y2YA 5EOVA 4Y2SA 3EGIA 2QROA 1AC5A 3M6IA 1GOTA 1NNSA 2V45A 5DCYA 4FWBA 4M9XA 3S99A 1HX7A 1GXSB 2GWHA 2ZULA 3C97A 4TS3A 2VQ6A 2D0PB 1DEKA 4KR7A 2XMGA 5CNIA 1HEUA 2DBVO 3KLBA 1BGWA 5LIPA 4OXQA 5E1OA 3A3KA 5DIZA 4RV9A 4UUMA 1JA9A 1XD2B 1IN5A 1P5HA 2C0QA 2HXSA 4JBWA 5CAEB 5CRIA 1K66A 3ETEA 1T0HB 2RCYA 3MWDB 1LA2A 4TSFA 4ZVMA 3TRIA 4JP8A 1T36B 1OYWA 4G9EA 4H0NA 5F7OA 1HE1C 1DMSA 1RQGA 2IYTA 1XN4A 1ULZA 2J3MA 4JA0A 4QD3A 3WNVA 3HR7A 1U31A 4W5NA 2CT8A 1JPUA 4B34A 4ND7A 2DUJA 4ZI5A 1XEXA 2I3ZA 3ECAA 3KAJA 2BHLA 3ES9A 4I9NA 4Q15A 3ZGLA 2BFEB 3QFFA 1KAMA 1PQWA 3M6XA 3ZK8A 3L0SA 2PYIA 4TTRA 1QV9A 1A97A 5DSTA 1C0PA 2ACVA 4ONEA 3RM3A 4GYWA 1FYVA 1W4CA 1KDYA 3SE7A 3BFKA 1V8ZA 1JTEA 1T24A 1OAOA 3GFOA 4YFYA 5CXSA 2QWXA 5LQKA 3HWSA 1FJXA 1EFLA 1B6SA 2UYOA 2Y1DA 1NBEA 3GA5A 1TAQA 1JJAA 1FTYA 3LX5A 2P9QA 4RMNA 1F5SA 1JKFA 1QJ4A 4INZA 3UANA 4DA8A 3R8FA 4BEJA 2GPWA 1GQ2A 4G5SA 4BO5A 4EHNA 2XCTB 3PEFA 1Q0PA 1RYHA 1HMYA 1VMAA 2DUWA 4LCBA 4DIFA 4BX9A 2UXCB 1NNLA 2GZ1A 2PM8A 2Y76A 4Q4JB 1XXHB 4PRZA 3WYNA 2A8YA 1GNVA 3HA7A 2JCXA 4P4TA 2PBLA 2WF9A 2DERA 4RACA 3R3SA 5CFLA 1A5AB 2J9GA 2ZI3A 3IULA 1G5FA 3I9KA 1V43A 4FTWA 4IDCA 5ENDA 3R0XA 1PQ4A 4YAOA 1N2XA 3RG8A 1M0TA 3OAAD 4LNHA 2WKQA 1QRRA 1KYIA 1KQPA 1LK0A 2IPLA 1XPUA 1HT0A 2O54A 1EFPA 3ZBQA 4Y6QA 4BFUA 3K09C 1PO7A 1EFUA 1GO2A 1QGOA 3DOIA 1ENYA 4YRLA 5EC8A 4F4JA 4HNVA 4RXTA 1NAHA 1VL1A 3U44B 4XWAA 1QH0A 2DC1A 1JKXA 1H2FA 1ZRMA 4V0KA 1KFCB 4W4TA 2DPGA 4Q01A 3DE5X 3KQKA 3ZWCA 1DO2A 2NUPA 1QYWA 3QX9A 3PYXA 3U4AA 2JARA 4LX8A 4AF8A 2X4LA 2YINC 2CV2A 2EX4A 4C7OA 1O4VA 2MTBA 1LX7A 4LQ4A 3JQ9A 4MYUA 1F17A 4F3RA 4AO8A 1W0JD 3ODPA 2BF7A 3KZXA 4RD3A 5ALSA 1EFVB 1LC3A 5BSRA 2EAUA 3JYQA 4A8HA 2VHVA 4CLRA 1MAVA 2DH5A 1CVRA 2VYNA 2XUIA 2YV2A 4X1IA 5JNWA 2WU0A 3PE6A 3PVZA 1RACA 1VCIA 1XRQA 4P53A 1XN1A 4RH1A 4RQUA 3TUZC 1KXZA 4FWIB 3O95A 5HHTA 2A86A 1LJ8A 4G24A 5KVAA 2IPMA 4L15A 1M34A 1Z2CA 3N0TA 4M6WA 5COAA 4RENA 4TT3D 2GPNA 4BO8A 1IK4A 4JD5A 2P91A 3KT0A 1H69A 1K7CA 1LZKA 3O0DA 3A4TA 2A84A 3EH2A 2H5IA 5IANA 4U1RA 1U7UA 1DHTA 5E3IA 4YPFA 2JIMA 4KNYA 1NATA 4XYBA 3UQYS 3FGOA 3OJOA 5CCDA 4KWCA 1L5OA 4L8YA 3JD0A 3ULKA 3WGGA 1WHTB 1I10A 3AK4A 3UJCA 1JLHA 5FPSA 5AFSA 5MN5A 2I22A 4OM8A 3F8WA 2CY0A 2X8AA 1QIEA 3ADDA 1FVXA 4D9BA 3QV2A 4OH1A 2VP3A 3MJEA 4Z0HO 3TQHA 1KPHA 5FPPA 5KSZA 4FHCA 1EXWA 3ANMA 2W2LA 5JCXA 3B13B 3D6JA 1IHXA 4D5EA 4UBLA 1MXHA 1R27A 5JARA 3UFBA 1ZMOA 4RLFA 4EZBA 2HO5A 4ZRNA 1EAYA 3JYPA 4Y30A 4B7ZA 5AVZA 3OFVA 4RZIA 4DWWA 3GPLA 2ZIAA 5B6IA 1YUNA 3RSZA 5EG5A 5DW3A 1ZJ5A 4LHYA 2QSZA 1DPFA 2BGRA 1OXSC 2R1TB 4DIBA 2FHSA 3RBAA 2QE6A 1MH1A 2NUAA 1AUXA 3F90A 3OQ6A 1CFJA 5CBPA 5EINA 1JX6A 1NHGA 2O0JA 5AKIA 1WCXA 2BKAA 3F4BA 3SWWA 4CDRA 1TJPB 4ZI2A 1ZVKA 2CUZA 3FCSB 4PZYA 1RYZA 4IH9A 4GFDA 4B46A 3B48A 3UA4A 2HQOA 3G8AA 4MWCA 1QO7A 2BR5A 4QUJA 1IK6A 1PG0A 1L4FA 3CXUA 4M0EA 1PTJC 3GQBA 5FUXA 4WPGA 1C7ZA 1UQUA 2EJBA 3M5CA 1ESMA 2FPGB 2IYUA 5JALA 3HDGA 4HYYA 2VEOA 4X71A 1DTWB 1JJIA 2BKUA 5EYPA 4OBBA 1QG4A 3M4XA 1GQFA 4P9NA 4GDMA 1V5GA 1WKCA 1FUYB 3IAM6 4MIYA 3MWLA 4DQLA 1EFRA 4IJWA 5DGXA 2FWIA 2YJNA 5LZ4A 1CQJA 3GRPA 3IUPA 1BKYA 3DMRA 3L1JA 4Q1VA 3WY9A 5HUJA 1I36A 1Q0LA 5FTJA 3B6ZA 1OFGA 5AOAA 2P0YA 1LI4A 1YDEA 1K3UB 3IDFA 5AVSA 5B1SA 2MSKA 4K6HA 4G1MB 4LJRA 4TMFA 5HRCA 1GTMA 4CMGA 3E61A 1IYZA 2VAPA 2W58A 3U48A 1BCSB 2PUEA 1FBNA 2EKBA 3LBNA 2R62A 4LJ9A 1G0OA 2ZQYA 2CJFA 4ZVLA 1QMGA 3QVJA 2AC4A 1RR6A 3E53A 2QOEA 4Y1RB 1G38A 1G8GA 5LDGA 2GGSA 1JJBA 3OEHA 2YNMD 2AN9A 1PU2A 2KLHA 1NDQA 4Y9UA 2G40A 3PA6A 4UOQA 3TQIA 3ZG6A 5BR7A 2HR1A 3LY9A 5G0WA 1Y6ZA 2ZW9A 2V7UA 2BJWA 2RGEA 1JWLA 1KF0A 1V9SA 8AT1A 1XZQA 1T9BA 5K6TA 3GAMA 2XCOA 1VJGA 3EWAA 5CB4B 5DXFA 1J09A 1I7DA 3L0ZA 3N5KA 1DBPA 2OBFA 4K6MA 4QWWA 3R9IA 2VJYA 5IAOA 5FOXA 5LWHA 2IH4A 4DAEA 5JH7B 5DBGA 3UHJA 5LQAA 3IIEA 4M0FA 3SDSA 2L19A 3R3HA 3TH5A 1FA9A 3KQYA 4EMTA 4M0UA 3D7SA 1D5CA 2CXSA 4LV6A 3VR3A 2ZITA 4X91A 5JOQA 5LQCA 1T3TA 1JU4A 1X3SA 4FE7A 5EUBA 2PKQO 4CG1A 1YIDA 1F7VA 4EG7A 5JSZB 5BNZA 1VIYA 1W87A 2JIZA 3G9QA 4J6EA 3IS3A 1CD5A 1NRIA 1Z5UA 3HMKA 4MUHA 1DAFA 4B6SA 4KPEC 3W4KA 1JLMA 3S1AA 1T6ZA 5LXTB 4EI8A 5DM1A 3Q85A 1E2UA 3ZH9B 1Z83A 2BGLA 5ITZB 3RRMA 1M6VA 2H51A 4WZAB 4PU0A 5BV1A 1T4CB 3PQEA 5I7VA 3QA3E 1F8FA 3TBFA 4TKVB 2RKWA 3FH0A 4IKEA 3MUFA 2IYPA 3QV1A 4JKOA 1LI5A 1QOPB 3EUAA 1LSOA 3GZJA 3AQIA 4HPJB 4UVHA 3N2LA 3R5XA 2XE6A 3REOA 1YBFA 1TA9A 4XWKA 5K0CA 3GUHA 3WIUA 1E2MA 1AMOA 4IOLA 4R8MA 2KBEA 1Z4KA 4S1WA 2HCTA 1AXGA 4B40A 3OEYA 2ZAIA 3CE9A 5TF0A 1LSUA 1N7HA 3EASA 2DJ5A 1T5LA 2WTNA 4X90A 3MB8A 5A5GA 4XSGA 2QRZA 1LPAB 1KI9A 4DHEA 3VR0A 1NI4B 2VSOA 1M75A 4KJZA 3CZ5A 4LCJA 1P45A 4GVLA 4UVDA 3VPFA 5IPFA 3ZE6A 1U1FA 6CHYA 4PTZA 2PJRA 5HCIA 5MN4A 3UJHA 3WX0A 4GXTA 2DMRA 3VFDA 2G09A 2F3UA 4BMVA 1U2QA 2AFHE 2DG2A 2QTVA 3A6JA 3SIWA 4EJSA 1PGPA 5JXIA 2QT0A 3H2KA 1V4VA 5TQ0A 4PQFA 4YCBA 3MF4A 4KPUB 3D0RA 5ADUS 3NHWA 1GSAA 4U7FA 4RGVA 2MJLA 2GLUA 3KJHA 4QT0A 1OZFA 4C29A 2FPIB 1USWA 4TOIA 3VV3A 1JKJA 3EMKA 4P22A 3TQQA 1XZHA 3ZC3A 5LB4A 4PN3A 5LMNB 3BMNA 5IK2A 4GOLD 4NE9A 3EC2A 5HBRA 2O8EB 4HVTA 4TMWA 2ZT5A 2PBFA 3DD5A 4ZHQB 5C8VA 2FWJA 1UPBA 5A6SA 2DF8A 1NSYA 3CF4G 2PGNA 3BHJA 5A3JA 3VNVA 1ABEA 2ASEA 3EG9A 3FCUB 1W36D 3ZHRA 5GIPE 4RTJA 2CD7A 3LYHA 2BSAA 2WAMA 2XWSA 3MSCA 4WOCA 5EZ6B 2YOGA 4JI5B 1E1RA 5DK4A 3T7KA 1QHFA 1U28A 3FETA 1TECE 3H11A 4E6PA 4NH0A 1FFCA 2OPHA 4ZZ0A 2FRDC 4HDRA 2I2XB 2QQ0A 4BO9A 3ZHTA 1YBMA 1CLUA 2F17A 5DHSA 1ONNA 1USIA 2LV8A 3R8CA 3ZQ4A 1N2CE 1XU9A 3BN3A 5A2GA 3TXYA 4KV7A 4N0MA 2VWPA 1IOVA 4W82A 3GEIA 1OXTA 4JV5B 2DR3A 1VI6A 3BYZA 4XQEA 2YXEA 4K6FA 2GO1A 2WYIA 3IQHX 4KX5A 5BP7A 1SHTX 2ZETA 5DBEX 4RE6A 4TSFD 5AP9A 5GPBA 2D1RA 2ZE6A 3X1JA 1DIGA 3DOOA 4WLVA 5LMUB 4LTDA 3QLVC 4PFQA 3SS8A 4YRCA 4C04A 5CCBA 2ZSBA 5EVJA 4CKWB 1OGJA 2A9JA 1A9YA 1S89A 1H93A 1R0LA 2QTHA 1TUBB 1IEQA 1TEXA 4GPBA 4M0DA 3RYCB 3L7YA 5ALWA 3T1QA 5KBYA 4TL7A 4U6SA 1L5HA 2H4JA 3FHOA 1ST3A 1EHCA 3DKRA 3WG9A 4MRMA 3ZI7A 4AY6A 2XIQA 1S1MA 3AEKA 4DR7B 1ABBA 1QLHA 4GO1A 1G16A 1QH1A 1R4NA 5HXAA 3RRBA 3WK5A 1IUPA 3NHMA 2NVOA 1N2SA 5E6RA 1YFJA 3TLGA 1OSNA 1BFKA 3RG2A 4U2FA 5T5QA 3KSAC 2DY0A 1BH6A 4XE5A 5TVGA 9GPBA 1E3IA 3KYDA 3AVUA 3T3IA 3W9YA 1XJQA 2P9GA 4KRYA 1O5OA 4HI0E 4ZA2A 3SLKA 4AIIA 4DXHA 1Y9EA 3MA0A 1BE0A 1XEWX 2HV8A 3BFXA 3I2JA 4YC7A 2W2PA 1E8NA 5B2FA 3K72B 5KJ1A 1N1MA 5IYZB 5JADA 2C42A 1CLEA 3WQQA 2CHGA 3W4IA 3ZGVA 3U16A 2C5GA 3TVYA 4V2IA 3MBIA 3P9NA 2XMRA 2ZXUA 1DL5A 2L17A 3TZHA 3PXXA