1VHQA

Crystal structure of enhancing lycopene biosynthesis protein 2
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
216
Chain Sequence
MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAPDKQQVDVINHLTGEAMTETRNVLIEAARITRGEIRPLAQADAAELDALIVPGGFGAAKNLSNFASLGSECTVDRELKALAQAMHQAGKPLGFMIAPAMLPKIFDFPLRLTIGTDIDTAEVLEEMGAEHVPCPVDDIVVDEDNKIVTTPAYMLAQNIAEAASGIDKLVSRVLVLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Enhancing lycopene biosynthesis protein 2
total genus 73
structure length 216
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhqA00
1VCOA 5SY4A 2LXNA 1GGHA 4Y1RB 4AULA 3NOQA 4MGHA 2WJZB 5LIRA 4L8YA 3CY6A 4L95C 1QDLB 4P2GA 3TTTA 2YWJA 3UOWA 4Y1EA 4I46A 3F71A 4Y1RA 1QVVA 4AUNA 3ER6A 4D1YA 3BHNA 1GGEA 1A9XB 1O1YA 2GHRA 4UOZA 1CE8B 3TTXA 4AUMA 1IPHA 4ZGGA 3CYFA 1QVWA 1QVZA 1PDVA 1T36B 4P35A 1JVNA 3EJ6A 3CNEA 4UCFA 3N7TA 1GGFA 3PQ8A 4P5PA 4RKYA 3PQ6A 4PXYA 4OFWA 1VHQA 3PQ5A 4UNIA 3EFEA 3RHTA 1T0BA 3FSEA 2GK3A 2YWCA 4LGYA 4ENSA 2RK3A 4Y1FA 1KEEB 3NVAA 4ENVA 4GE0A 3B36A 1R9GA 3EN0A 3ZJ4A 3TTSA 1KWKA 3FIJA 3L3BA 1C30B 4Y1GA 2R1TA 1M6VB 4OIFA 1GPMA 4ADSG 4B40A 4QYXA 4ZDKA 1ONSA 2YWBA 1JDBC 3MGKA 3L18A 1J42A 5E9AA 1CS0B 2VPIA 4ZDIA 1UCFA 5JZOA 4OGGA 2D7JA 4GUDA 2ZUWA 3NORA 4S0ZA 1PDWA 4XLLA 5JZMA 1P7ZA 2VKTA 3TTVA 3R74A 1IZYA 4AJ9A 1VCMA 4ENUA 2AD5A 1OX5A 3UGJA 3SF8B 3SF8A 1Q7RA 1P80A 1FY2A 3ZJ5A 5K4AA 4BFLA 1GPWB 3R76A 2VXOA 2ZUTA 4AUEA 4B5KA 4E08A 1OX4B 2ISSD 3L7NA 1G2IA 4P34A 1K9VF 4UOQA 4B2YA 1PV2A 1QF7A 1OX6A 1S1MA 3P9PA 2OR3A 4WXYB 4L7QA 3F5DA 4N12A 3TTUA 3UMMA 4L78A 1OX4A 3TQIA 1WL8A 5SY9A 4L8FA 1I1QB 3ZR4B 1KWGA 3MIIA 3CZ9A 5BV2P 1OI4A 4WINA 1VCNA 5SY6A 1SY7A 2H2WA 3CZAA 2YWDA 4N0MA 2R1UA 3B3AA 4GE3A 1KA9H 2AB0A 1CF9A 2NV2B 4L8WB 2R1VB 1C3OB 1P81A 1QWSA 3OT1B 4JQSA 4ENTA 3D54D 1Q2UA 1PE0A 4ENRA 3NOOA 1IZZA 4MNTA 1FYEA 5SYAA 3B38A 4BIMA 4ZDJA 2V4UA 3R75A 4I2NA 3WFZA 2W7TA 4B31A 5IP5A 1T3TA 4ENQA 4ENPA 1I7QB 1I7SB 2FEXA 2ZUVA 3PQ3A 2IUFA 3P9SA 3TTYA 2ZUSA 3PQ4A 2R1VA 3OT1A 4OGFA 1OY1A 1GGKA 1GG9A 1L9XA 1N57A 2RK6A 2RK4A 2ZUUA 4K2HA 3PQ7A 4OQ4A 4QYTA 1U9CA 3EWNA 3BWEA 4UZSA 3SOZA 2ABWA 3M3PA 4P36A 3TTWA 4MTCA 4E5VA 4ENWA 2VDJA 3KKLA 4BTEA 1P7YA 3P9RA 3EZGA 3NONA 3PQ2A 3UJNA 1P5FA 4Y0NA 2R1TB 2VRNA 3GRAA 3VU3A 4R7GA 4I4NA 4HCJA 2NV0A 4LRUA 4B7AA 3P9QA 1GGJA 3L4EA 2XF2A 4OJYA 4RKWA 5DFAA 2A9VA 3UK7A 1BXRB 1KXJA 3NOVA 1SOAA
chains in the Genus database with same CATH superfamily
1X8LA 1Q1GA 1QFMA 4G5OA 3KCNA 3ORHA 4C6HA 4J94A 3RWMB 2VTKA 1KSFX 2G6TA 4WK2B 2DBRA 2NUBA 3C70A 2Y1FA 3HI6A 3JYOA 5E6SB 1XK6A 3EFHA 5LP6C 3UKOA 4JYBA 5A04A 1DX6A 3ZDCA 2HHJA 4RD6A 3DH0A 3RIEA 1TYAE 4A4DA 1Y48E 2IDMA 1QG4A 3ZZ0A 1XFAA 1JIIA 5LU9A 3L7KA 1QAQA 2VDWA 3M6AA 1MA3A 3PYMA 4CT0A 1ABEA 1EI9A 1XDSA 3GRRA 3R3UA 1HDZA 5G53C 4E5KA 3F8SA 1WDKA 2BONA 2WYIA 1Y5IA 1QH9A 1Z16A 1CUIA 2IXAA 3R6TA 4YYEA 3U3MA 4BGEA 1J8YF 3A26A 1LNSA 1SU8A 3PQ5A 3SHTA 1KYZA 3LX5A 3V4ZA 2EGGA 4IX9A 3P2YA 1QSGA 5E7JA 2XNCA 4FEAA 2LCIA 4ZWNA 3K5IA 5EEHA 4FNGA 5DN6D 2P35A 4WNCA 3TSCA 4XGNA 2QMOA 4IIEA 4KQHA 2Q0XA 1BGVA 2PUEA 3B3QA 3PGJA 3BVPA 4LYYA 2CSUA 4RIGA 3CGGA 4GH5A 3K2EA 1C0KA 5ALWA 4EH1A 2ZB3A 1ULUA 3K9GA 1F0YA 4JLAA 4A27A 2ZZMA 2IUEA 4KK4A 5G0VA 1FRQA 3JAKA 4N39A 2FCAA 2EKBA 1AUOA 2A7QA 2W6IA 2FB9A 2AWOA 2QPOA 2VZ0A 3O91A 4RCYA 3PRKE 4TSFA 5DBGA 2FLKA 3BSWA 1N5OX 3RRBA 2GQ0A 4U8GA 4Z7QB 5LQMA 3QVLA 1SKYE 2M98A 3SLRA 3H2HA 2CNWA 4DV7B 1U6KA 2QTMA 1II8B 1G5QA 4PCAA 1FY2A 3L8FA 1K7SN 3STTA 1IOVA 4DADA 3O9ZA 4HLCA 4DSTA 5GZ1A 2WFZA 3Q7QA 5A4FS 5TEVA 1QRAA 4QECA 2C58A 4E07A 3DTVA 3WB9A 2WVAA 4V3BA 2OFPA 6Q21A 4WNAA 5CG1A 2OM6A 2HK7A 3D0KA 1E63A 2AOWA 3I2JA 4YAOA 3RVMA 3Q0TA 3SEAA 3IQXA 3W90A 1RWBA 4CETA 2QENA 1H1LB 4DVGA 2Z9BA 1DMSA 4GRAA 3KYDB 3PIDA 2ZU0C 4EG8A 4HMPA 3TZCA 3PFNA 5IDQA 1JDSA 2ZRGA 2O1EA 3GUHA 5IM5A 3I6MA 3ZY3A 3TE7A 3K15A 2ECQA 4OSOA 3QPCA 4BE4A 4YACA 3IQHX 4FE4A 4KUEA 3ZHYA 2VAVA 1GL3A 5JQGF 4R0VA 3HTXA 4JSTA 4JAVC 4HQLA 3QITA 3OX3A 4JHXA 4RJIA 5DWDA 4EY6A 5DM60 4IDPA 1CZKA 2QSYA 3QPVA 1D2RA 1QE5A 2IXTA 3OE4A 4MTLA 2I2CA 3WRYC 2ZRQA 3ZYCA 2AW5A 5T3UA 3ZPXA 4UHEA 4RIEA 3RK1A 2FK8A 4U7WA 5DOVA 4ZCLA 5JVDF 2D2XA 3F3SA 3R3ZA 4TTAA 2WHQA 3QX9A 5JTTA 2HK6A 2J5KA 1F17A 1NVKA 1U11A 3VAYA 3GZNA 4YLYA 3CEMA 2UUCB 2ILVA 4GOKA 3NALA 3PHBE 3TXAA 4G5YA 4PC2A 2YWXA 4BRWA 1LEHA 1PEKE 4LHVA 5IDYA 1Z4QA 1T2DA 4AG3A 2J3KA 3E9ZA 2WJ4A 3RJ5A 2JGEA 3ZHTA 1JWBB 1USGA 2DPGA 4XWOA 4NMXB 5B7QA 1TF5A 4YRTA 3PXCX 4DPKA 2ENUA 4QU5A 4M9ZA 2A8YA 4KPEC 1SQ5A 1XZFA 1DZIA 3IDAA 1X1EA 4ER0A 2H31A 1MHTA 1AZWA 1JECA 2J5XA 2FWBA 5HHTA 1KRWA 1GPJA 1V43A 2Z3WA 4FOOA 4HRXA 1W47A 4ZVQA 4DV5B 1A96A 2P79A 3DE3X 4F60A 2QVCA 4O1IA 5BY2A 3JQAB 3ZHVA 3FJYA 4FIDA 1S0UA 3AKYA 4HDAA 1CQWA 3L0PA 2IUTA 4KPUA 2Y4OA 5JADA 4KQGA 2GTHA 3HBNA 2FUEA 3SZUA 1KBQA 3WWOA 4H1WA 2PUBA 5JVDA 3C97A 4LZPA 1L5NA 2DR0A 3H9JA 4KQ2A 3VM6A 1Z56C 2RG1A 2Y4NA 3MCUA 4H4EA 3AOGA 1N6OA 2CHUA 2Q3DA 3EXEA 5LXTF 2BFFA 1J7JA 2XW6A 3TMKA 1VBFA 3L6EA 2XE4A 1G8JA 1MJGA 4NS1A 4DREA 4YRGA 1HDCA 4JXJA 2VZEA 1G4UR 3K72B 1SIWA 3L3BA 4NZZA 4Q3OA 5K1ZA 3VR3A 3ZHQA 4CLRB 4LWQA 5ESWA 1JG3A 2RHOA 1I4WA 3CMCO 3LPDA 3DFKA 3EGDB 1RMQA 3H3XA 1MABB 2Y93A 3I4CA 2HQRA 2F67A 4RACA 2UZ1A 5BSMA 3ZUGA 1D2AA 1C1XB 1ZL2A 2IPLA 3BSFA 4GR4A 4MW4A 3ZBTA 1YR2A 2A6PA 2AKYA 2E7ZA 4AMUA 4BUZA 4PN3A 4R1TA 1D9ZA 2O0MA 3I5YA 4B09A 1ZI9A 2OHOA 2YH2A 3ESDA 1KVTA 1DC7A 3P2OA 3VPDA 1Z5NA 2H11A 3F8WA 2FMUA 4D8XA 2ZWAA 3OD1A 2G8NA 3A7EA 1J0EA 4QBHA 4XCXA 3S2YA 3G0BA 1JGTA 4CN8A 4JJAA 4WZAA 1L5HB 4HYEA 4YT8A 1EDBA 2R65A 3MNFA 3PEUA 3Q6IA 2AH5A 2QMHA 4IHAA 1K3UB 2WU3A 3U1BA 3JALB 3AEXA 2A14A 4MR8A 2I8CA 1B8NA 4J3FA 3KP1A 2EFGA 2VCHA 2PT5A 3RTBA 1G5IA 1M7HA 1KE2A 4AJ1A 4OB6A 4BV2A 3JVEA 4EFNA 2HIHA 3L1IA 3S7TA 4JOCA 4FINA 4TRNA 3HKCB 1FP2A 4GOJA 5EVJA 4AT1A 3WRXA 3BTSA 1I2BA 3IR5A 4F6LA 1P2BA 2YS6A 4ZO9A 5F9HA 2R1UA 5KO2A 4JT2A 1SEPA 3P7MA 1AKTA 4ND3A 4KTTE 4ONEA 5D1HA 1DUSA 2Y0PA 3ZXXA 4EUSA 3U37A 5D6OA 4CL2A 4ROSA 1TT5B 3P0IA 2O5CA 4UJ5A 2W6JA 2O2XA 1W85A 3ELUA 4LJSA 3OEEA 5JS2A 1D4OA 5CFLA 3DOHA 1PFWA 1TO1E 1HNNA 4KXWA 3T61A 4FI3C 6CHYA 4G0NA 3IAFA 3MPUA 3LFHA 4IIJF 4KE8A 3KZNA 4XUGB 1B8VA 1JU3A 1KZ7B 1QM5A 1HLGA 1U7PA 1NTOA 1X74A 2V3WA 2XMCA 4O2BA 1JS1X 2HMYB 2HW8A 4I50A 1GRVA 3DMHA 2OZLB 5TB5A 2Y1WA 1E9FA 1JEQA 2PZMA 2Z4SA 3PX2A 4L9SA 1XEXB 3GRAA 4TTSA 2C9ZA 1GPAA 2ERCA 3G0HA 4ZVRA 4RKWA 5GGYA 4S04A 3COZA 4G23A 3HKEB 2Z2JA 5BR1A 2EWVA 3T34A 1X7WA 4TV9B 4UU8A 5IARA 4HTFA 1DUIA 3IAAA 3ZVKA 3IPLA 1Z0JA 1SJ9A 3DSRA 1VE6A 2QT0A 4X1KA 3MBKA 4XOIA 2A2ZA 3NHZA 3SFVA 3AEUB 5J2UF 3OX2A 4JBLA 4W5HA 1ZM3A 5IUJC 2XKKA 4WCDA 2JLSA 2VLBA 3IJ5A 3OEWA 2C0PA 4UVDA 1E94E 2BMVA 2O0KA 5FX2A 2D2IA 5J23A 2NZUG 3R6WA 5B5SA 2O8EB 2IEYA 2XUKA 3G7NA 3H18A 2WNIA 3QXJA 4M3NA 9LDTA 5EJ2A 5H4GA 2O8CA 3HXTA 1BJRE 1T0UA 1JJBA 1V37A 3HR8A 1UDBA 4IIVA 3OU2A 2H2AA 4JQZA 4RZUA 1Q6ZA 3E1GA 2XJ9A 4LYEA 1SZCA 3PQ6A 3VR4A 3CB4A 3OSZA 1SXQA 4DJJA 4Z54A 5I4IA 1KU6A 2Y6VA 4K7JA 1KYTA 2WWFA 4Q7QA 1OUMA 4Q3AA 1BW9A 1VHTA 3CEAA 1L3BA 3WO1A 1PLKA 5HE9A 3EXHA 4FMBB 4CF6A 4J0CA 4E3ZA 2FHSA 4N65A 4ZIRA 2VP9A 2BCGY 3DDWA 3LFUA 1AJEA 3ZNPA 1MUUA 2PL5A 3U49A 2ETXA 2BDEA 1NG9A 3OFND 3PL5A 4HAVA 4MV0A 5JXJA 5ERYA 1UIRA 2P6OA 3F9RA 3ENNA 4KXNA 4LWOA 4AS2A 4CCYA 4F72A 3C5CA 2XQIA 5DPMA 3DGEC 4KFCA 4HTAA 4MWSA 4QGGA 1THGA 3GFFA 3C3KA 1GQ2A 1E60A 1RLMA 1H2HA 2DWCA 2OB1A 3FM9A 5FF9A 1ODSA 2IPAB 3Q1KA 2QIPA 2OAEA 3NHBA 1CT9A 1JQBA 1CPYA 4LCBA 1NUSA 3CLSD 4MIYA 4Q82A 2JLZA 1W9HA 4BJ5A 1UKCA 1VMDA 3BSSA 3FCSB 1SCBA 1WUIS 3H4TA 3QU5A 2ZM5A 4DLAA 4UE2A 1K86A 5KNBD 1ANKA 1UEXC 1SKMA 1KPIA 3GOHA 3OESA 1Z7YA 1T3ZA 5C52B 2DSNA 1L8LA 2FXVA 2LVBA 4M7RA 3SKYA 4I9GA 2JFYA 2GYWA 4FU0A 3VYSB 3ZHOA 4BNXA 2AMYA 3GEDA 4XWKA 3EEFA 2J0SA 2VRWA 2I22A 2QE6A 1UXOA 4II3A 3W3AD 4YDRA 1GUYA 3SS8A 1UBMS 2D00A 2YNMA 3GJ3A 1GZVA 3IEPA 4KQEA 1XQYA 3LP6A 4QQKA 4TTTS 2OOSA 4GICA 4CM7A 5A3QA 3BJIC 1GUZA 1Q0RA 1SC3A 5AI5A 4K5QA 4GZ3A 4DA9A 1EJ2A 3NTOA 2Z58A 1HL3A 1Y8RB 4BO2A 1TW3A 4H08A 4HDQB 1EFPB 4ENQA 2JS7A 4QRIA 2QMUA 2DKFA 1PG2A 3RS5A 1SVKA 4C4YA 2QRQA 5HOEA 3G5AA 3H2KA 2CGEA 1QBGA 1T43A 1HE3A 2O7SA 4IS2A 4PGFA 3PJFA 2C04A 4I4IA 4XYEA 3QU7A 3ESYA 2H51A 1G8FA 5D87A 5BPHA 1T9GS 3RFVA 1H94A 3S0JA 4EW1A 5B64A 1FXSA 1V9CA 1BO6A 2Q49A 2QU8A 4WEQA 4LZAA 3G7SA 5KJEA 3WKEA 1ZWKA 2BZGA 4KAFA 1OAKA 3ONWA 4ZZ0A 2M2IA 3WTBA 2C2GA 3U9SA 3LHIA 1NVMB 3ZK8A 4CKBB 2XVZA 2QX9A 4YEDA 3GZNB 3DKPA 4EKYA 1IG3A 4ICIA 2ZIXB 4G9BA 2X3UA 4F97A 2QSJA 4IRXA 221PA 1FTYA 4PEVA 4QUAA 5ARDA 3TJZA 1ZEJA 3BC1A 4ODIA 2G4LA 4YTEA 3D6FA 3H97A 2BWJA 2Q4EA 1VL8A 4Q93A 3Q15C 4M1OA 1QH1B 2YN2A 2ERXA 1RJ9A 1CY6A 1PHPA 1KOLA 1T8YA 3EPRA 4KE7A 3AT1A 3WK4A 4KYUA 2R5FA 3P32A 4IQ0A 1FU7A 1W96A 5AJXA 3K6RA 4C0LA 3ZZ1A 4ZGWA 3FPAA 1IPHA 3K1AB 3TG2A 3KKKA 3FFWA 4PLZA 3N1UA 1DKNA 4BX0A 3CVOA 3MG9A 3EJ6A 1PK7A 1OW3B 5CYPA 5KNCA 1RHQA 4HWSA 1Z5UA 3SOPA 2IXFA 4XTCS 1QB8A 4FEGA 1VA4A 3IBSA 1BX3A 4RCVA 4BBJA 2GM3A 5BUCA 2IYTA 3BJRA 4L28A 1PT5A 2JI9A 3AVOA 1E9BA 4R05A 4RBNA 2QYOA 2XWQA 3DZ8A 3L1VA 1VC2A 4J7CA 3VMFA 3L18A 5H3CA 3TUZC 1J8FA 4Z4GA 3AP2A 4DMFA 2R9VA 1K5PA 4X6YA 3V1UA 4BNHA 3ZX4A 2FX3A 4AJ2A 3BXXA 1ZXBA 1NR7A 3WGHA 1MFPA 2CL5A 3EULA 2XT9A 3M4NA 3TRIA 3UHJA 3VU1A 4W5QA 1JG2A 1NW4A 1RJFA 3ZCQA 3FRIA 4F9TA 2A9FA 1VKOA 1MX1A 2VA9A 4QOJA 5KOYA 1I7NA 1N8TA 1SOWA 3NKFA 2P9ZA 2XDYA 4FEEA 4NH4A 4OCZA 4XD7D 1IQRA 3RTAA 1ZY2A 4UMFA 2ZJBA 4EY7A 2Q5IA 1W5FA 1HEUA 5J5AA 4EW3A 2TMDA 4GIBA 4P8RA 3A11A 5BWNA 8LDHA 5AVWA 1Y8RA 3OZTA 4EZIA 2WNHA 1E99A 4MW0A 1ULAA 2GBFA 1BHO1 1WTAA 2RHLA 2VXBA 3OOSA 4JI6B 3FGNA 1G7CA 1OC2A 1T9AA 1RFLA 2ZKLA 2ZJ1A 4FN4A 5FLYA 3SM9A 3O83A 3EXFB 2NO9A 2YMMA 4JLMA 3TBFA 7ADHA 4Q15A 3I9LA 1DJLA 4MW5A 1GLNA 3ADPA 4IBOA 4I4CA 3LY5A 3GZJA 4GWKA 4HYTA 4W7HA 5NULA 3WFZA 2PH7A 4KGVA 7YASA 2I4MA 2GRJA 4LC1A 5B1SA 3PGLA 3NTXA 4R81A 2WYWA 4QT4A 1TAUA 4B8ZA 1VP3A 1QKKA 2I3GA 2L69A 3U4DA 5L4SA 1LX6A 4C4TA 2JCSA 5JHHB 3M4XA 1GYPA 3OPXA 4M87A 3SPXA 2KB0A 1E2KA 4ECEA 1HNWB 2Z1DA 1AE1A 4M8KA 2R48A 5HKOA 3NHYA 2JBAB 1L7AA 2BEWB 5TSDA 4M49A 4BTEA 1C0EA 4OI0A 4DSUA 4F84A 3D4PA 3L0IB 4J7UA 1BXRA 4ZAXA 4RO0A 1H4VB 3BMXA 5M04A 4ZT5A 4DSZA 1G42A 2PKCA 2RHHA 1T4GA 3GFPA 3Q6MA 1EM6A 3O73A 2YXBA 4MJXA 1D1PA 2ZB2A 2XDWA 3LXMA 4EARA 1OFIA 3K0KA 3KBBA 4MW2A 5G40A 1E5TA 2AKEA 2QRHA 1F4LA 3KKOA 3LY8A 4G1FA 1D2GA 1W44A 5SZIA 3X43A 1NDQA 2HMVA 1DHTA 2FWPA 1LK7A 1JHVA 4TV9F 3OTOB 2QJTA 1VI2A 3IIEA 2JZOA 1P5JA 4Y1RA 4DR7B 1OPXA 1X2EA 2JCGA 1UWVA 1I9GA 2FMXA 3MGGA 1YRLA 2IEDA 2X19A 4DMKA 2C9BA 3RQIA 4EPTA 4Z49A 4JBGA 1H6BA 3W3AH 1YB4A 3A1WA 2OBMA 1QP7A 4RD4A 1JA9A 1YI8A 1X14A 2GJAA 3KLNA 4TOIA 5JYEA 3LZDA 4CIVA 3DMTC 4RQUA 2QRVB 1ZFNA 1T6XA 3H0CA 3NETA 4BDTA 5TT0A 2QVYX 4XR9A 2Q50A 2XUGA 2XCSB 5ELLA 2VOEA 3A0UA 4JEMA 1X87A 3WLRA 4RPLA 3BX1A 4KLZA 1GQQA 3S40A 4QDOA 5LZ7A 3GVPA 3N7AA 1GXSB 5KSOA 3QWHA 4RE6A 2C3OA 3I9KA 3IYLW 3VPSA 3DEKA 4BLSA 3G8DA 1E32A 4TMZA 2ZW9A 3BAZA 1NL3A 1J8QA 1THZA 3U4QA 4EJSC 3G9ZA 2HNKA 3DG9A 3O9VA 5T64A 4KKVA 1CEEA 4YRZA 2QTFA 4HLQB 4IDEA 4OQDA 1WBBA 2H85A 4BZZA 1KKLA 4J49A 4NPAA 1CQJB 2VH2A 2FEOA 5F7ZA 2Q5FA 3I2GA 1RHKA 1P7ZA 3R23A 1AGXA 4CV3A 3A06A 1QZUA 4BXOA 1JEQB 3P9NA 2C31A 3WSWA 2X5JO 3SICE 1T2UA 1A7UA 4D3DA 5F23A 3FPGA 4OXQA 2P27A 1JA0A 3T9DA 4NCXA 1D5CA 1YB2A 2NZVG 3KJQA 4KE9A 2Q5CA 3GFRA 2GNOA 1D9XA 2GN2A 3JZAA 5DLYA 4BC0A 3LHDA 5C1OA 3BB3A 4FFVA 3DBRA 1B2LA 2QY6A 5KAMA 3CH5A 1OX4A 5FB3A 1YIAA 4ZU1X 4CM6A 2PBZA 3KQNA 1HEIA 2VJPA 2QTGA 5CD9A 1N75A 4MP6A 1HO3A 1W6RA 2YV1A 2E4YA 4MZXA 2VWQA 3S29A 1DKUA 4M0FA 4N3CA 3NXSA 1JU4A 2GERA 2QDKA 2YWHA 4OO3A 2VK4A 1EZ4A 1YQXA 2YV5A 1MJNA 3LAWA 1F0PA 1CDDA 3CVXA 1SVWA 2GESA 5CA1A 3LDUA 3G1UA 1XA4A 2MWMA 5JWHA 3GI1A 4ENWA 3AUUA 1SWVA 3GLHB 1ADBA 2Q27A 4KXXA 2DTDA 1OZHA 1IJEA 2H54A 2FN8A 2WLTA 3DL4A 3RYFB 5KU7A 3NCTA 2EZUA 1DIGA 4EUHA 4CL8A 3B70A 3PE4A 1S96A 1EHCA 1NASA 5AXBA 2PX5A 3ZLVA 4LY9A 5HK8A 3M9LA 3ZHXA 4RFSB 3DV0A 4GKBA 1NVXQ 3BUSA 1TZ2A 2ZBFA 4CM9D 2ZJFA 2ZYDA 5C5IA 5D3KA 1RYNA 2DR3A 4K3VA 3AU8A 4HZUA 3U7GA 3FG9A 1BNCA 3OOHA 1B41A 1CETA 2J9ZB 3CR8A 4QGFA 1P4GA 3KDAA 4MVYA 3QFSA 4ETMA 3NIDB 1YQUA 2WJYA 5FUQA 4A2WA 2GI4A 2QNBA 3VDXA 4PCVA 4EYSA 2C95A 4DG5A 5ES4B 4KJXA 2BTEA 1Z0ZA 4NR0A 1Z0FA 3O3NB 5KVAA 1OHHA 4MV5A 3N8NA 4WY5A 3EXHC 1WEKA 2YKGA 4KN8A 1DIOB 1PZEA 3R0ZA 1Z35A 2AMVA 2CFSA 3QPDA 5T4BA 4A1OA 1DTEA 2CVOA 5BN5A 1AB5A 4J0IA 1Q84A 3A4IA 3ISJA 1Y63A 2O23A 3S1AA 3BCSA 5CA0A 4B3JA 2UXDB 4DR6B 4KRGA 1KBZA 3MSXA 3TSAA 4E7OA 1JYSA 4ZQHA 4CTMA 2QUAA 3K96A 4QXRA 1Y8ZA 3MQFA 5F33A 1XPRA 1WMSA 2EATA 2XJ4A 4YBRA 1OBCA 1HNZB 2FY8A 5B12A 3EGXB 1FFXA 3SK0A 1Y3IA 1LBSA 3HN6A 1I3MA 5KU1A 2H0RA 2FN4A 1XTZA 3PUZA 3TO5A 1C9DB 4B3SB 2J4CA 2CK3A 1JIQA 2QL5A 1IH8A 4KOAA 3TOSA 4DIEA 3MGKA 3LUDA 4D9MA 4A92A 3EVZA 3O75A 1R4MB 1ZYUA 3OKCA 4TXLA 1GDDA 1H23A 4C7XA 1C4XA 2Z4TA 2O1XA 3UPUA 3N8DA 2G5PA 1KYWA 3D59A 2OBNA 1V4VA 1WCXA 4B6GA 1NN5A 1P60A 1P2UA 2IC5A 3DJYA 3NO4A 1K7XB 4QU9A 5GONA 2XT6A 5KYTA 1DS6A 4EVSA 3PC4A 3OOJA 4C08A 4H3VA 2DBZA 1OC4A 5MHTA 1GUAA 1LDGA 4IVNA 3ZU3A 1AGYA 3G68A 3HBJA 2QM0A 3AINA 3JQFA 4PYKA 4K6OA 1U65A 5AKHA 3ZDXB 1U7HA 4MQEA 1F14A 5TMBA 3KS9A 3UA3A 5K03A 1XMXA 5AJZA 2GO1A 2IP2A 1CJUC 2Y68A 1SQFA 4EKGA 4J0GA 4NC9A 1W4AA 1KMNA 3DEJA 4CIWA 1YULA 1IE3A 3FCCA 2D7CA 3RRYA 4Q34A 4UTOA 4JJ4A 4R1QA 2VBGA 3TQSA 1Q1BA 5EUQB 1DQYA 4BQPA 3DULA 2FF5A 1SXPA 3KB6A 4XWGA 1I3NA 3RT9A 2BUCA 4LRTB 1YS4A 2VEDA 4DIUA 4L0MA 5K0EA 1KQGA 3W6UA 3TLGB 4KPGA 3NOOA 3W05A 4HVAA 1ONNA 2H59A 4FJ1A 4C5CA 3D64A 4MW6A 4NK4A 3FCOA 3OZCA 1E2MA 5AO9A 5I51A 2H7XA 3ZHBA 4YMUA 5I8WA 4QD3A 1AN0A 3LYUA 1SU6A 4KDEA 1YJ5A 2QM7A 4O8CA 3PFIA 5JIBA 4DBVO 2VRCA 4F4DA 1L4MA 1QIGA 3VNQA 2PGLA 4E14A 2XVAA 4TVBA 3THOA 1G9SA 3OECA 5FOTA 3G5LA 3DDNA 4B0OA 5AOBA 2R11A 2GUWA 2W6ID 3O94A 3T3GA 3LD9A 4B45A 4WOCA 3P96A 4DDUA 1VIYA 4IDDA 2P91A 1P8AA 1LUAA 1C0LA 1ZAKA 1KJNA 2CNWD 2DWQA 1T2CA 2P9TA 3EXG2 4KVZA 4DXAA 4ZJPA 3RADC 3KPWA 3QF7A 2GRAA 2QM8A 1LU9A 3U9LA 3CRZA 2FKAA 4L0CA 5KQMA 1F8GA 1YE5A 3I0MA 3UTCA 1XRMA 4FCVA 2AN1A 3L7JA 4GP7A 5DN6A 3USZA 1FE8A 3ABRB 2TYSB 3AVPA 4C87A 1UIMA 4ZZ1A 4R1NA 4HKTA 2AMLA 1BEUB 4C76A 4M2LA 2KLHA 3KJXA 1M2VB 2Q62A 3E03A 4KP7A 2MR5A 2ZJYA 2FF7A 4BTLA 5CDYA 1KEVA 4BUJA 1WZUA 2C4KA 2CWDA 2WUEA 5GM1A 4MB0A 2K6GA 4ZVNA 1PQYA 2OCXA 1CIVA 2B35A 4DB4A 3IP5A 4NYJR 4ZO7A 4NZMA 2LBPA 5HCNA 2WE8A 1YR7A 4M1YA 2I8AA 4Y6GB 2QHXA 2GD2A 1E3DA 1JHUA 2O14A 5ENVA 4WLNA 1K5HA 2XYHA 3E2MA 2KQUA 3HDHA 4X45A 1E2HA 4X8HA 3V8EA 3CLRC 2AJLI 1G1MA 2DQZA 2JH9A 2QN3A 2WF8A 1TKCA 2V7WA 4WRRA 2XUJA 4JLKA 4PHTA 4Z8XA 2VL7A 5ALLA 1W4CA 2VI5A 3L4BA 5H7XA 4DT1B 2NVWA 1OB5A 1KMHB 1WD5A 2CK3D 2J9XB 1LB1B 3DCNA 1OZ0A 3OP4A 4I9HA 2QS9A 3QXSA 1FFGA 4GKVA 4NCBA 1ONPA 1LLDA 1RRVA 2GHIA 3Q8XB 5EXXA 3E6AA 3S6JA 1A9RA 1I7LA 4FWTA 2CJPA 2JFZA 2WABA 1IB0A 3FMGA 2YXPX 2HMAA 4UASA 1TPYA 1J56A 4JS0A 4N76A 4ZICA 4EFMA 2YTZA 1YVDA 1XCBA 3DJFA 2DC1A 2GEJA 4L50A 4P3XA 5FAKA 1EP1B 1Y3CE 2CBZA 4O25A 2VZ8A 5HG0A 4XRGA 5BV0A 2FSVA 3IT0A 1US8A 3WYGA 5TQ0A 1U8FO 4XASA 3BA1A 1XRSB 2PWBA 2VQ6A 3N8GA 4JWTA 1H4SA 1OVGA 1J06A 1WLSA 4I4LA 4F93B 4PWZA 2Y8EA 2EAUA 3KKEA 4ZIRB 5IT5A 4BWGA 4RJKA 4BPBA 4G09A 3AEKA 3P9PA 1OH7A 3F8TA 1LVUA 1YMQA 2C4NA 2OSBA 3EVNA 3RAPR 2BYTA 2ECFA 4UEKA 1L6RA 3DA8A 1KWGA 1JEYB 3ZWVA 4MWEA 1ADCA 4DR4B 2X5XA 1XIVA 1KJIA 1UDWA 3SZLA 4G0MA 2DSTA 5JR3A 5FEMA 3WK8A 2UUBB 4G8JA 4BC1A 3ESXA 4YAKA 1EK2A 3JD4A 2GNPA 4K8RB 4LJAA 4JA2A 4V0RA 3KSZO 3EXIB 4F71A 4I9FA 2P0EA 2Y0BA 5TMDA 1A2BA 2BI7A 1QVRA 1QLWA 3S44A 4BL5A 5BV1A 4CIYA 5K8VA 3JPWA 4LDZA 1T9DA 4NL4H 3SQOA 4B31A 3U7EB 3GJ0A 3MN1A 2GBPA 4QJ5A 3ADDA 1JF8A 4GR5A 3KZVA 4V0KA 4ZQBA 5F9MA 3AFMA 3SEZA 4XAQA 3W5JA 1IBLB 4Y9UA 1QF6A 4UHCA 3SQWA 4TYYA 2QTHA 2TECE 2VDQB 2YFHA 1NJ1A 3G59A 3HUUA 1Y1LA 4RGYA 5EWLB 1DAIA 1CRZA 1IHPA 1SC9A 1DHRA 3E9MA 4NG5A 4R8MA 4L57A 3TUJC 4CF4A 4KNYA 1NC1A 4TKMA 4R3NA 1PR2A 1HDEA 2H4JA 2V0NA 3WXBA 3VHRA 3ZLUA 4DIKA 4DY4A 1R4AA 2OZVA 3BRCA 6PFKA 1YSCA 5F9FA 1DGQA 2QUBA 4TTQA 5CLFA 4RKRA 3CPHA 4WGGA 1AC5A 1USVA 1RE0A 4GI1A 1TAHA 3ILYA 5CX4A 2BMJA 2LNDA 3P2MA 1YL5A 3GRZA 3T4XA 1SCDA 1W1WA 3I4FA 3NJ8A 1C3XA 3B5IA 2JAHA 3D8HA 3N2GA 3U5TA 2A9OA 3JD1A 3TB4A 4Y2YA 2OO3A 1ZONA 2VHQA 4HRAA 4MGKR 4YCSA 1UBHS 1RBMA 3QLTA 4B7CA 4BO6A 4ARVA 3N0VA 4AUNA 1ZU5A 4S0XA 3AUJB 1O95A 2BPOA 2COKA 4G4GA 1ZM7A 4C3VA 1KAGA 3RU3A 1AT1A 1Z2AA 2VHCA 2N75A 4MUNA 1K0UA 2QRUA 5E8RA 3DVLA 3S55A 3F9IA 1FC0A 1I6MA 1OXMA 1ZIOA 3B8EA 1E7SA 4QTXA 4E33A 3E48A 2BUBA 3HHPA 3IA7A 5EUMA 3Q5GA 3BIOA 4CLXA 1CBUA 4PVCA 1QHHA 3PL1A 3T7KA 3D5TA 1N0HA 4B35A 2P9BA 2V5VA 4JL6A 3Q3EA 4LDAA 3QPWA 5K5EA 3GVHA 1L9KA 5ALQA 3FZGA 1Q0HA 1LPAB 5B4UA 1ZVVA 4WNAB 2D0DA 2A1UB 1U3WA 4RPKA 2I4TA 3HYCA 4JB8A 1SCNE 4QYSA 5IAOA 1WU8A 4QPPA 5AI6A 1GGMA 3EZNA 2XMPA 4BQOA 5CFZA 1J2EA 3QXHA 1NA5A 1HRKA 1Y7PA 1LDBA 1VG9B 2R44A 2YHUA 3KZ1E 3R6LA 2F1HA 4ZRNA 4DQLA 2ZUDA 2JIQA 5J2TB 1H0SA 2O48X 1XZQA 4TXNA 1V7PC 4JN6B 4C7VA 1HR0B 3L7MA 4BNWA 2F55A 5A62A 1C4KA 5CB8A 2DLDA 1WXHA 2V96A 2Z5VA 3GBPA 1XZCA 3KVRA 4GI5A 1NN1A 1XF9A 2ASVA 3CR7A 4UTZA 4FMDB 1ZD5A 4MQFB 1AQ6A 2RGNA 4G85A 4ATNA 4EG1A 1V2HE 1IAQA 5EMNA 5BRAA 3N2LA 3HY4A 5DASA 1QTIA 2NXJA 4FFRA 4DWOA 3U6KA 3NIBA 1KI2A 3PYLA 1MVNA 3M3HA 3QU4A 5EWJA 2QP4A 3UAYA 2D6FA 2D4AA 3MBOA 3E9EA 4RD2A 2NV2B 4AK9A 4JJEA 1NXPA 3T7CA 1D0VA 1KK0A 2BLLA 4ABYA 1IC6A 2PG3A 3LCJA 3RSCA 4Y8VA 1TTHA 3D2CA 1YHNA 4X7PA 1FSZA 3H9QA 4A7PA 4BNUA 5KJFA 2H63A 2P67A 1U8TA 5DGIA 4ARAA 5C37A 2QRPA 2AFHA 1TYBE 1ZRNA 4Q48A 3OZIA 3DUFB 5HEKA 3TWOA 4CKXA 2HA7A 1Y6ZA 3R0XA 1NW7A 4LE1A 1W19A 3KHUA 4L5BA 4UZSA 4CMKA 4P36A 2PA3A 4MKIA 1R0KA 5DBIA 2VNSA 1T6YA 2QB5A 4PFQA 4XUDA 2IIBA 3MHTA 1WCV1 2ALJA 3F74A 1OSNA 1PFYA 3EZGA 1J8VA 5FWYB 3BXFA 2ADOA 4IVPA 4Y0NA 3GAAA 3CZ5A 1ODJA 2ZCVA 4I4NA 3LW7A 3V9AA 1TE2A 4OP1A 3B60A 3ZI0A 5DNYB 4BCBA 4D6PA 4L3VA 1TCAA 1XK7A 3IVGA 4CBVA 1ICIA 5LOVA 3UBMA 2PUDA 2JFQA 2GEKA 1RAHA 3EW7A 3D3EA 1SBZA 3ZE9A 1YRYE 1RXCA 1I80A 3D5QA 4PSCA 5EIAA 5FJIA 5A5FA 4FZVA 4LOJA 1W8DA 4CL0A 3DCYA 1F5NA 3VRHA 3ESZA 3L82B 3FTNA 4HC4A 3CH6A 4KH0A 4ZAVA 5ICEA 2J7PA 1SOUA 4D3FA 2MT9A 4EGQA 1IXKA 2GF9A 3VPAA 4XB1A 4OLAA 1L1RA 2DFDA 4MP3A 2C7RA 1RPNA 2D3TA 4C07A 1KZ4A 3OZUA 3WWYA 3F6RA 3K8OE 3LOUA 5HQ3B 4CHGA 1UAAA 2O4CA 3JVUA 5CB6A 2QOEA 5CXSA 4YRIA 5CNMA 5THXA 1I1HA 1NI4A 1P1CA 1SBHA 1Q0PA 3QX8A 5HKAA 5LQCA 5DHPA 2AHRA 2CJYA 4QU0A 2HQ1A 1DFGA 1RKQA 1I3LA 4PXYA 2XEXA 1EU1A 3ZGNA 4YXFA 5LCXA 5K3EA 4IV8A 4PZUA 3FSEA 2WILA 2HPVA 3ZWXA 1PRYA 4UDYX 2BR3A 2L82A 1SCUA 3QNWA 4DPMA 2IH5A 3QHAA 4TLLB 5AUOB 3K0BA 1T8RA 4UARA 2FZ5A 4ZMBA 4HGRA 3TRJA 2QZ9A 1R74A 4OQZA 4W82A 4WXHA 3WMFA 2B4AA 2P3QA 3CZRA 4PZYA 4D9HA 2XKBA 5JPDA 1G16A 1JLLB 3C7KA 1CUYA 2VP5A 3HN2A 2ZTMA 1VE9A 4M1TA 4OJMX 3V42A 1WMAA 4A10A 4A6EA 4BBZA 4BLTA 1M67A 3QK7A 4RYLA 3SX4A 4ENUA 1WCWA 4YPOA 1KK3A 1PEAA 3T94A 1PSWA 1G18A 4TQAA 1E18A 1J1ZA 2JASA 3GX1A 4QUIA 2KBEA 2OA0A 4B5KA 2F1OA 1ZM9A 3A70A 3PHHA 4UBNA 1AO3A 4YJ2B 2OL4A 3QPBA 3KL2A 4TX1A 1RXEA 3UENA 4YJ2A 3KAKA 2GO7A 2D1QA 5HJEA 1UJ4A 1K4YA 3G2LA 4YAFA 1XMSA 3GT4A 3HZZA 4GLOA 1KC1A 5BYKA 1D0SA 1JDZA 1S01A 3A6DA 4U2DA 5EKTA 1OJ7A 5BN4A 2BGIA 4PG7A 3LHKA 1U1FA 4HDMB 5BWMA 3FOEC 2LCFA 4WD3A 2F3SA 4WKGA 1IYZA 2HPZA 3KTAB 3OJ0A 1HLDA 1T15A 5CFOA 1WOMA 1J2YA 5TPZD 5B2FA 1E2DA 3B6KA 5IJAA 2W58A 1S7CA 3HACA 2E3JA 3C3DA 3IOMA 3WJ2A 3ES9A 2CB9A 1T91A 1C4OA 3W6OA 3FVQA 1MOPA 3P9SA 1CNFA 2WDPA 1A9SA 5K3FA 4RZ2A 4EHBA 1FMLA 2OBLA 3VAZA 2WV7A 2P2LA 5JCPA 4DQ0A 4UHKA 5C35A 1RLOA 4YAWA 4AO8A 1P9WA 2NADA 3M34A 4Z9YA 1E3MA 3WI7A 4FMDF 9GPBA 1WDLA 4X63A 4CM8B 2ZWIA 3ZDRA 2PZBA 4LX8A 4G1CA 5KMGA 4EYQA 3W5SA 2C5BA 1TRHA 5JRDS 3HXOA 2VHWA 2P75A 1GN9A 1OE0A 1ZK0A 3L6RA 4ER5A 4JASB 3WSTA 2JJQA 4QSMA 3OLVA 4R8LA 4BJHB 1KXJA 1EIZA 4KQXA 4LV8B 4P3YA 5FNVF 3VU8A 2GKOA 4DLKA 1NBOA 3SKXA 3AM4A 5AXCA 1O94A 4CTNA 5EJ7A 1EK1A 1S6YA 4ARUA 3MTQA 2WF9A 1EXWA 4KH1A 2GBLA 5I3ZA 3R3XA 3PIIA 4P84A 4B3TB 4D4MA 4FKBA 3GJQA 2PKRA 2E6KA 1RRPA 2YWJA 3K9NA 1V8PA 3E0QA 4ZPJA 2BEVA 4H3SA 4IOJA 3F71A 1RYFA 4CVNA 3KBOA 4OHVA 5JY6A 2OB2A 1QVVA 1CSEE 2WU0A 3B7PA 1F12A 5FV7A 5EIFA 1OIWA 1JKIA 1OT5A 1WUJS 4A8JC 5JV5A 4GXRA 3DCIA 1VP9A 2C7VA 3I01M 5EXEA 5KNBA 3BF7A 1KO8A 3K20A 1O8BA 1S8FA 3HKDB 3K8YA 4V0SA 1NLFA 1OI2A 1SMKA 2FWRA 1ESMA 3A2MA 3ACCA 4G97A 4MMZB 5T8KC 4A6XA 4D9FA 4AYWA 4B48A 3RVPA 5IM4A 5IWAB 2WYOA 3ITEA 2FEWB 1KO7A 3CT4A 1PGOA 2DT5A 3MHPA 4TWRA 3VR2A 2VJNA 3H75A 1ENPA 1MV5A 5BNFA 1EXDA 4C89A 5HIKA 4DA0A 3GFOA 4RD3A 3GA5A 1QX4A 4YBZA 5GIPE 3IC5A 3M9WA 5JAUA 1YIDA 1GARA 4MVXA 4EBFA 4I4TF 4QA9A 1IUKA 5I9TA 3VBEA 3B7GA 2YZGA 1XTSA 4XVUA 1U7WA 1C8BA 3LRPA 1RAAA 3HU1A 5BSKA 3RR2A 3H9UA 1X1DA 3HBMA 3SNHA 4LZZA 2G9NA 1YK1A 3FPBA 1GDTA 1Y4SA 1N0UA 3IULA 2Q8PA 3STYA 3L6UA 3UJ9A 3V8QA 1Z4KA 2JEOA 1SWWA 4KK3A 4Y2TA 1FSFA 2JGNA 2AD5A 3O6VA 2ZIEA 3HO6A 1A5BB 3EISA 5HMLA 4BMVA 4YRBA 1NFFA 2X86A 1FVFA 4MJ7A 2PZEA 3W9YA 1TKBA 2LDBA 2HA3A 1QGUA 4KXQA 4LK3A 1FUEA 2CFRA 2RKOA 3O7MA 3PUHA 5EE9A 2AOTA 1ISRA 1SVLA 3FWZA 4Q7KA 4ZOEA 2ZJ5A 4M9QA 3OC0A 3U3DA 121PA 4Q1EA 3LQRA 4QREA 1XJQA 2B2XA 4WZBB 2I2DA 2B30A 4YV7A 4PQYA 4ZYLA 1XTRA 3KWJA 1LSJA 2AF3C 1M2EA 3FETA 4DJ5X 1AZLA 2AG6A 3W06A 4DR2B 4MDEA 1JNXX 1TUBB 4DEYA 3ZJTA 3ZHCA 3C8DA 2Q8NA 3AEKB 1LPNA 3GEHA 4Q39A 5BVGB 1LZKA 1JBKA 2BFOA 2R25B 1KQOA 3AOEC 3LLCA 4QYMA 4ENTA 5KC8A 5LQNA 3ZU4A 5JQGB 4QODA 1MG0A 5CT9A 4BFUA 5DXJA 4BRUA 4Z1MA 2VYFA 2X77A 5IUNC 4JXXA 2XD9A 4K6KA 1FYDA 4M8LA 5FOWA 2WWRA 2IT1A 1I3OA 2FEMA 3AQIA 3PQ3A 4EFLA 4EHAA 1TRKA 3ETLA 2VJCA 5B30A 3IRUA 4U0JA 1SVSA 1GZ4A 1YDWA 2VXYA 5KIAA 2Q4TA 4YJ3B 1XLTA 4YA6A 1EXVA 3PNQA 4GZ6A 4QQNA 3ECCA 4YC7A 1ECGA 2J67A 3IILA 4IIHA 3QW4B 1NW5A 3BTVA 3DVRX 4KODA 1YQ9A 2DPHA 4HEA1 1RJ9B 3TIXB 1M66A 2C7BA 2MINB 4RVOA 5P21A 1RPTA 1ZH8A 1H2XA 2C3YA 3FNBA 1P0MA 5HPYB 4X60A 4C4ZA 2Q2OA 5C7LO 5F2NA 2A9QA 4QRDA 5JDCC 3RIHA 5KYUA 3COVA 3K1AA 4ALMA 1PCXA 2G40A 5J4HA 1MENA 3E8MA 3MTEA 1BXRB 3NTLA 1NJSA 1QIEA 3L05A 4BMZA 5CT4A 4FWIB 3OZ7A 2J9YB 3AR2A 2F64A 4P3NA 5DBFA 4LF9B 2A0XA 1EK0A 1VZ2A 2J48A 1D8AA 3DTNA 1KMHA 2GSDA 5CDUA 2BZ1A 4AQ7A 1X9HA 1U3TA 2C5FA 2DCMA 3HGTA 3UOWA 2XUOA 1BHJA 3JZFA 3RJMA 1I5EA 3II6X 4LZJA 5H0IA 4AJNA 4JYZA 1P4AA 5T6BA 2VJBA 1LQUA 3I28A 2JHAA 1J2JA 2G7ZA 3SXJA 5AUNB 2G6BA 1J9ZA 2MYTA 4YCJA 3DFUA 3IIJA 3RS7A 3K1YA 2C1XA 1S2OA 1UP6A 3WGGA 1U7ZA 3HP7A 4ISCA 3ZD9A 3ZBPA 1K2WA 1M8FA 1PD0A 3DC2A 3HJBA 1CU1A 4BE7B 2JFGA 3K0FB 3H19A 4HDNB 1YJBA 2G9RA 1KI3A 1U90A 2PJZA 4JDUA 2OQVA 3S2ZA 3EOBI 3CH7A 4JGGA 1YXMA 1HYBA 3CKKA 3MD9A 3Q11A 4M1WA 1U0BB 4ENSA 1M0SA 1E6KA 2HH9A 4AZVA 1UFRA 1HFEL 3DP9A 3IT2A 2Z2ZA 5ALMA 4MCIA 4EI7A 4M4SA 2J6IA 2R8RA 3M33A 4AU1A 1ZM2A 2FW0A 1DCKA 1H2YA 1CFJA 5EIWA 4Z0TA 3SQDA 2HUPA 4OHKA 1OA1A 1C8KA 2P65A 1R9NA 1CYEA 3LUAA 3VDNB 4C6TB 1JKXA 5CYOA 3IH5A 4JC4A 5ER9A 1OYVA 4MIOA 3WS7A 1EP9A 1NN3A 2Z3ZA 3N8IA 1FFAA 1LWOA 4G86A 1TCCA 4J0FA 4JBIA 3LKDA 4MUGA 3RIXA 4XGRA 3VVMA 2WHPA 4ZJUA 3QV1A 3ZIUA 1XDBA 3DTTA 2DOKA 4NY1A 3GDHA 1MCZA 1JHDA 4EVQA 1UOPA 4PE5B 5FPTA 1BDHA 1CUZA 1ZSVA 1AN9A 3A2LA 3C6MA 5J5CA 2PUAA 2JIZA 4FXOA 1P4JA 3DMYA 2CFIA 3DLCA 1HDRA 1VL5A 3A9CA 2WKSA 5BV2P 4A15A 2QVZX 2VPWA 4K1LA 2I03A 4G89A 4W4TA 2ODQA 4C9BA 2H18A 1GG2A 3TAXA 2VDOB 2VJQA 3JVVA 5E1OA 1C29B 1I14A 2PZKA 5FBQB 1GFIA 1SHLA 1T8UA 4K03A 1QS0A 3KHSA 3MTDA 5B1HA 3WC4A 4EJFA 2VH5R 1DPFA 2LWIA 3MPOA 1F2TB 3KTAA 4MQ5A 4BQRA 2RHDA 3QJ5A 3Q9SA 2NAFA 4X1YA 2C1ZA 4BX9A 4MX8A 3SNKA 2PRSA 3ESCA 4GOLD 1ULZA 4IJUA 1R0XA 3RVKA 5ESDA 2Y05A 4G1UC 2GHTA 4AJKA 1KYIA 1GNLA 4QTZA 3SG0A 4NE9A 2HEGA 3JR7A 3U40A 1M6VA 4D4IA 1PFUA 3AFGA 4GPD1 5IKXA 1OU4A 4QNNA 5I3CA 3UMGA 4AQDA 3GZ4A 3CONA 2RAVA 5ALPA 1DG1G 1H3NA 3NWOA 1GGJA 4PR0A 4WUTA 3FVWA 1QK5A 1E0DA 2PVPA 4KFUA 2QM3A 6REQA 3E7PA 1A5SB 1XXHE 3HJNA 3QUSA 1XKXA 4GPTA 4OJNA 3IR7A 4ZOBA 3UY4A 4CR6A 2OUKA 2WTAA 3AR8A 4MUHA 5DJ5A 3WB2A 2OGWA 3C6YA 2HSGA 1KQFA 4EWLA 3D1JA 4PZPA 3W1EA 3JQAD 1Q1EA 1ODCA 2BKXA 2G28A 4P58A 1S3FA 3B1FA 1NUUA 2AK3A 3ICVA 4NNPA 2ZDHA 2IHNA 3QA3E 1J90A 3OQJA 3PDIA 4MDHA 3Q40A 1UKYA 2PJUA 2MU1A 8ABPA 4IV5A 3WDLA 2C5GA 4WY8A 2ZR7A 4M21A 1QGED 1MRNA 1YZUA 1SUPA 3EASA 1NBHA 4KVFA 4XSGA 5K0SA 5M34A 2GAIA 3HLYA 1JKJA 2DPXA 1TAGA 1U8YA 2ODNA 3RS8A 5DMXA 2Z95A 3FIUA 1WRBA 4QTTB 1LNQA 3K6JA 3IT1A 4YCBA 1CB7A 1FLVA 2QRZA 4Q00A 2EIHA 3BIXA 5DHQA 1RMTA 3LF2A 1LV7A 2X9VA 3DBRB 1DCMA 1TUIA 4IGEA 3D3WA 1HLPA 1KZ9A 1ZCBA 2TMKA 3EQ2A 3P9YA 3O4HA 5BYBA 5I7RA 2FWIA 2QL9A 3V4FA 2XDQB 1ILEA 4ER7A 4JK3A 4C3OB 2HCBA 2XA9A 4QFCA 2DPLA 3FHOA 1D1QA 3IP7A 4X97A 4MQMA 4QPJC 2FEPA 5CFPA 2W2KB 4HSEA 5EHGA 1JDBB 1O3YA 1SQ6A 3VJRA 1MDFA 5DRTA 3U0VA 4WLFA 3QE4A 3F6PA 3H4VA 3UXHA 3UXYA 1SXGA 1CXZA 3TEJA 1L5MA 1U7OA 5H4HA 3ANTA 4K40A 2FFJA 2G4CA 4OL0A 5FOSA 5AXAA 5AVQA 5J2UA 1YCFA 1DEHA 1G8HA 5JAIA 3O0TA 4AURA 2VTBB 2QTWB 3ANLA 4B3FX 4EYGA 3S2GA 3KWLA 4PIPA 1Y81A 2WKQA 4AJOA 3LUBA 3IMGA 4AXBA 2L17A 3W5UA 3K0CA 1H2RS 3CBGA 1TZKA 2FETA 3JRNA 3FTPA 1PJTA 3DQPA 3SJUA 5EE3A 1YZYA 4WAUA 2JLQA 4N4AA 2ZANA 1ZICA 2C97A 2H4ZA 3H8VA 3R40A 5K3AA 5TIIA 1NE7A 4QLBA 2Z9CA 3RO7A 2GSWA 3BTOA 3C5HA 4Q7MB 4BEWA 1FXUA 3LL4A 2O8BA 2ZJ6A 1QUFA 4LC0A 5B1DA 5IW8A 3HMKA 4ZHQA 2BIFA 2ZS7A 4UPEA 5EMLA 1ZVKA 5A1TA 4BFXA 2XOKD 1V45E 3ZV4A 3G85A 5EZYF 4DHWA 5FORA 1G21A 2EJWA 1YE3A 3IQIX 5J3JA 4BZPA 4L2IA 3LCUA 1H8HA 3MELA 3OJWA 5TGZA 4KL8S 4X1OA 3TSZA 4JI8B 2P9QA 1O5TA 3ASUA 4I4TA 4E4RA 2D8AA 2XIQA 3CN7A 5TS2A 2J3MA 3KT3A 3I76A 3VV2A 3NRJA 2RHMA 4M88A 3I6QA 2YASA 1P5FA 2W2MA 2VWPA 4P3KA 4N6NA 7REQA 4LHWA 2C54A 3VU3A 1OA0A 4GPBA 3ZZTA 3E9YA 1DKPA 1B0PA 3R41A 4W5JA 3AR5A 3RHZA 3CXUA 4GR9A 4OJYA 3U7QA 1FDTA 2XVXA 4NLLA 3SHQA 5JFGA 1U63A 1GXSA 2QNIA 1Z2CA 3E0XA 1C8VB 2CDCA 2J4FA 1DAKA 3S99A 3IHKA 2J5RA 3QFTA 4Z0NA 2ZAGA 3IAEA 4FIZA 2J4DA 2ZE5A 3U3JA 3L0SA 5TF0A 3B1ZA 5B7NA 2DBVO 4AIRA 3OKAA 4WZAE 1ENZA 1GV0A 1LDEA 1BSVA 3PP8A 2B82A 4M1EA 1ILWA 3T4UA 2R79A 1JDJA 3JYNA 3T1QA 4CZ2A 3ED1A 4J76A 2HSWA 3B20A 2A67A 1C5KA 3KL4A 1XVTA 4ZAYA 1C7EA 2GHRA 1MAUA 4J0EA 1XZMA 1WB6A 4H9GA 3UCFA 4AUMA 4YMVA 1U3FA 1T6ZA 1EBUA 4B4UA 4E6EA 2I99A 2D62A 2HBYA 1OU0A 2XODA 2BE7A 1CZNA 5IKPA 1R2QA 2AV6A 3WZ2A 3DVQX 3WK9A 3PBKA 5JRJA 3CEJA 4JQCA 3VSEA 3SJCA 1A82A 3LLVA 4LRSB 4WLUA 3K9CA 3WFJA 4RFVA 2H5LA 1H22A 3N2IA 4I3FA 5CIYA 4D3YA 1JILA 1QTNA 4R68A 4QKQA 3DPUA 2V0CA 3HKCA 1XLTC 2W90A 2XCLA 5C1PA 5GADl 1Z4NA 4TS3A 4DMUB 1JJFA 1BVUA 1CC1S 5FTJA 1E6CA 1MQAA 1I4TD 1CYDA 2OMKA 2UYGA 2BR4A 1I6KA 1NRWA 5B58T 1KFJB 3FW1A 2JD0A 3KQWA 1ETHA 2RGAA 1EEHA 1K6XA 1X70A 3MZ0A 4FDLA 4ML3A 2P4HX 3UJ8A 4DIOA 2YMLA 4CI0B 2X4IA 2AEEA 4BO5A 4MLPA 2IS1A 1BQEA 1PWZA 1VPVA 2H4YA 3DOUA 1D2EA 1FP4B 3BRWD 1PLLA 1W4BA 2FG7C 4PO1A 4RKEA 3ZEAA 4FUQA 2F1IA 2FN9A 1OH6A 1FJHA 3HHEA 4PGHA 4TRJA 5LZ5A 3BEOA 2A4KA 3EFOB 1M74A 1ZKDA 3AERB 4GF5A 4Z8YA 1QV9A 1Q83A 5KVVA 3B9BA 5IUKC 3FYUA 2A33A 4P34A 3HPRA 1NBAA 2VHTA 4FKZA 3FDXA 4L8VA 1FFEA 5DX0A 5DNAA 3MT7A 4JJ6A 1CR6A 3EIUA 3HFGA 5EJGA 4GX0A 2BEJA 1UFVA 1KRXA 5HSGA 5EP1A 4X7RA 1W2HA 2J3LA 2DHDA 2UYQA 3WGTA 4ZEMA 4W9MC 3K9QO 2OBFA 3DV2A 2PXCA 3F98A 3HM2A 3EDMA 2ZYGA 3LO8A 4BKPA 2Z5GA 3ZK7A 5I5EA 4GVXA 4WUVA 1XAHA 4DCTA 2V3VA 1CQIA 2V8BA 4MI3A 1Q16A 4C88A 4RK0A 3W2HA 1A9OA 5ITZA 2E9SA 1YQDA 2RHBA 2J45A 3KE8A 1AQYA 2JGFA 1MFZA 3Q7TA 2PBFA 1T8TA 1DV2A 5TDHA 2P9GA 1GKUB 5H83A 4IFBA 1SZDA 2GCOB 3T35A 5IKOA 5EIBC 3S2SA 2ZWVA 4WX2B 2W6OA 4TV8B 4GMKA 4H1TA 4S35A 2QI9F 1X7XA 4TLMB 4CT5A 4E46A 1Z2DA 1EX6A 1GZHB 2C4MA 4O5OA 3AI7A 2ZYAA 1RM0A 1M2VA 3GF4A 3ZS8A 1VKNA 5BWBA 4TSRA 2E6UX 2C2WA 2DQYA 1Z34A 4WV3A 4CF7A 3IV6A 5DFAA 2OXRA 4C7BA 1I51A 5BSEA 5HZKA 5IZ4A 2NTYC 1UFQA 4HH0A 4ZGBA 4G65A 1OXKB 1EFVB 1KFCB 4HWRA 4WNYA 1FDIA 3KT8A 3QI2A 5DHSA 4QVKA 3A6EA 1OGJA 4Y1RB 1GNTA 5IVDA 2KW5A 3CVJA 1FPMA 1SG9A 2JJ2D 2MSEB 3NHLA 3PWZA 4P3OA 4WTOA 3KSAC 1K98A 4BVAA 1G7RA 3ABZA 1A4UA 1SOMA 3ZK9A 1T2VA 4CCYB 2UYHA 3BQ9A 4ZAFA 3TQTA 1ZQ1A 2WKPA 4E2XA 2AWNA 1T1EA 2BM8A 4IRMA 3JWIA 1QX3A 5BV7A 1RMYA 1UBFA 2H1FA 2OT3B 3NBUA 1YNOA 4U2CA 2FSPA 3JQEA 5EA2A 2EJTA 3ABOB 5CGZA 4NQRA 3AI3A 1GOTA 2AEJA 1QKIA 1CY0A 5C53B 3UWOA 1BU8A 3U4IA 4IPTA 3PDWA 3SYKA 1FTNA 2WJVA 3QKRA 3R20A 4JYAB 1IEWA 3PGMA 3QZUA 4J90A 5D01A 5LA6F 3UQYS 1TM1E 1A5ZA 3BGWA 3QPAA 3PC8A 1SB8A 2IUYA 3VU9A 1VLZA 4RA6A 1IXSB 1NUHA 1UFKA 1FVHA 2QPLA 2R1TA 3M3DA 4B40A 4F92B 4IG4A 1VKRA 1KDVA 3SBOA 3V34A 2GFIA 3DR5A 3G5TA 3UUEA 4EGAA 2ZWMA 1JHAA 3R24A 1F20A 1UXJA 2DE0X 2OV4A 1II8A 1SGWA 2HA2A 2X1HA 3AERA 2B1RA 2EKDA 1JN0A 2QPTA 3GJRA 1IHUA 4HPJB 5G1PA 3SI7A 1P0IA 2GD0A 3FMOB 2RB5A 1DIAA 2PGXA 5LQSA 5TS3A 1I32A 3TIFA 3VO8A 4IVQA 3BKXA 4NKRA 4TL9A 2V4MA 4GFDA 4GI3A 4TPKA 2RCNA 3G1TA 4AP6A 3ULKA 5B37A 1E1KA 4YCMA 2PLRA 3CUUA 3ED5A 4US0R 4NMHA 5HCUA 1EX7A 5KKNB 2P6RA 1GA4A 1LDYA 2QQFA 3U48A 4NS4A 2G5TA 5A4AA 1UP7A 4C20A 8AT1A 2KLBA 2B1GA 1T10A 2I4NA 3BMOB 4MYCA 4AJIA 4EM6A 2VTBA 2ERYA 1KI1A 4AKHA 4UHHA 1G3IA 1VFNA 4H7PA 1CR1A 1D6NA 3ZGYA 3LDHA 3UJDA 1K68A 4IJ5A 1NMEA 5ALTA 1Z0KA 3TFQA 1QRSA 3BB4A 3ILXA 2AVNA 3ZV6A 1KAOA 4N1AA 4LK2A 5C8YF 3ZI7A 5EINA 1UWLA 3JQ6A 4NX2A 5F1YA 1JEAA 3I83A 5ER6A 3KEMA 3PCTA 5LQUA 4DW8A 3FKSD 2QVXX 1T3TA 1KZGB 3HCAA 4FGSA 4RSMA 2CDAA 4DAEA 4Z53A 3I1IA 3Q10A 1NULA 1WNFA 5B36A 3HH8A 4JB3A 2GVNA 1CE8A 1NP3A 2J5BA 3QY0A 3JWHA 1J8MF 2DPYA 4LNUA 1JPUA 3P0EA 2PLFA 4BQIA 1I33A 2VTVA 2Z6QA 4KXFB 1PTKA 1O95C 1ZVMA 2YJ3A 1Z5OA 1I2ZA 4KQWA 4RIFA 5ANRB 3N9IA 3BL8A 1QYRA 1V5FA 5JMOA 1NJ5A 1W34A 4D56A 1JEJA 4C0KA 4MAMA 5DWQA 4D43A 1AGPA 3MK31 2K5UA 3QVOA 4RIIA 4ZI2A 1H4QA 5FR1A 3K05A 4DZZA 2IDKA 4JP8A 5JZ9A 4FOTA 3UNXA 8OHMA 4AULA 4ZYYA 3NBQA 4KVGA 5DYGA 2C7GA 4YP7A 4DZTA 3ZV3A 4W9NC 4M7OA 1LJUA 1RRKA 1WCYA 5HVNA 3DWEX 4LQ4A 3EMDA 3KR2A 3CGWA 5B3JA 4A36A 3QX3A 4O59O 4GNKA 1OLOA 1F8FA 4FJ2A 4XOUA 3KUKA 3HWSA 1Z7BA 4LNHA 1V1MB 2CLFB 2GK6A 1UQUA 2DEUA 2C2MA 2G88A 2IUUA 1MO5A 1OWNA 4JJ7A 3WJ7A 2AMJA 1N6LA 2HMWA 3BMQB 3GVXA 4IDCA 5C0OE 3C74A 1ZOIA 1XJWA 1U2QA 2P77A 2EWMA 2BGJA 2XRMA 3A28A 3L8DA 5BOVA 3V4PB 4NJMA 4MRSA 2VDMB 3ZV5A 3TR0A 3UIEA 1TM5E 4DM7A 5CDHA 4LY0A 1GT6A 2VSOA 2FZLA 5CHYA 8ATCA 1OLSA 2HJRA 2C5HA 3C4JA 5JMPA 4BO9A 3C16C 1C30B 1U98A 1WX1A 1JT2A 4RPHA 1CNEA 4A6PA 4C1NA 5FNZA 1VMIA 1FYVA 4R1MA 2QGZA 3SQXA 3L0OA 4B3DA 5JSHA 3DAGA 4WESA 1H5UA 1PN3A 5AJVB 2LPMA 1VJTA 4K46A 3FZQA 5DGXA 1CVIA 4CMHA 3QYAA 2JI4A 3TZQA 3UF0A 1PJQA 3QBJA 2OV6A 4A2CA 1K92A 1FFCA 1TGVA 3AHEA 5ENZA 1ZW1A 1C2TA 3PVSA 4NZPA 3OEED 4I1OA 1JWLA 2GB4A 3SF8B 4D4LA 4P82A 5D7NA 4J9UE 1CQZA 2YY7A 3RWOA 3ZKWA 5LYJB 4G37A 2H2FA 1SCKA 1XSEA 4PG8A 3MAGA 4KX3A 1QF7A 1T5SA 4ZT4A 4OIMA 5DCYA 4RSHA 1NNLA 3M6FA 4IIBA 3LZCA 1QGOA 4QUGA 1A8SA 1GSIA 3ZLTA 4A6DA 3ON5A 1ZOLA 3MINB 3HMQA 2Y1KA 3C7AA 4AICA 5JISA 1U3VA 3SYRA 1DKRA 1XZLA 2P1RA 5HKLA 4N5DA 4YGXB 5H9VA 5L3VA 3U44A 3VTAA 3FSGA 5DNEA 1Q11A 3RNOA 3VNAA 1IZZA 1WXDA 2ZBRA 1IQUA 1C7JA 3HNRA 4Q7LA 3W7VA 4XTRA 3EBLA 3RVBA 4IQ8A 3EPKA 3LQKA 1HBJA 3L04A 2HF7A 3VGJA 4CNBA 2PT7A 3WISA 3KLOA 2FPXA 1EWVA 2DFVA 4MPTA 5CUQA 1DC8A 1LV8A 4Z9FA 1DO0A 1Z4IA 2VFAA 2X2PA 5FWAA 3TTWA 4HNSA 4K9PA 3I8SA 2IYVA 1YD7A 3F90A 1WCIB 4Y6RA 1TGYA 3EIXA 3DMRA 4RYDA 4DY6A 3GO4A 3EGWA 2IE8A 2R6ZA 2W8ZA 3NONA 1IXYA 4BUCA 3T5MA 3IOEA 4G4SO 2PWAA 3Q98A 3BAFA 4LMBA 3FSRA 3GLIA 2OHFA 2YV2A 1UJBA 5LZ9A 4COKA 2PHZA 4LV6A 4G67A 2A9VA 3MB8A 2K87A 3KOZA 1XEWY 5FOUA 4YWHA 4B3MB 1QHHB 3A6FA 4RK5A 3BXEA 2HDNB 1I0IA 1AK2A 1UJCA 4FGZA 4U39A 4EKDA 2C4VA 4NRDA 5CB4A 2WWTA 4OREX 4PCLA 1CUFA 2JGDA 4W5RA 2IXBA 2O2IA 1YR6A 4NSNA 4B87A 4LEIA 2AE2A 2OY0A 1JFSA 3SIWA 2OESA 4EKIA 1U0HC 1NWHA 5MDHA 3FRJA 1OTYA 1NAIA 1M1YA 2OD7A 3NEPX 1JW9B 4O6VA 3BB1A 4QTYA 1VL2A 3ONNA 3VSBA 1XR3A 3AJDA 1U3CA 4ND8B 1DEOA 2XYPA 3E2PA 1GIAA 2R8ZA 4QGHA 1QVZA 1JAIA 4YR9A 1GT91 1K8QA 5AM0A 5EGNA 3NW9A 1MOSA 3AIIA 4CUZA 5JJCA 3VU0A 1VFPA 1BWSA 3D9QX 5K2MA 2A9RA 3C3PA 2ZRHA 2P6NA 4LY3A 5DXFA 3DT8A 2NUTA 4QUBA 3O0DA 2FZVA 4I36A 1ZK2A 3TQHA 1CHNA 2G9UA 2KMLA 1RYBA 3DLIA 3KZOA 4WLOA 3Q8KA 3IPYA 3JWJA 1O96B 2WV9A 1BWPA 2Z8XA 4FYVA 3SZGA 5JRZA 4UUNA 4HN2A 3C3JA 1PYGA 1XV5A 3OPVA 4R1SA 4RPGA 3E8SA 4MQ4A 1TADA 2COUA 3W8RA 3A1UA 4IEFB 2X8WA 5CP8A 1D2CA 3H1TA 4BNIA 5CG2A 3L7YA 3PUKA 4URHA 4L07A 5H8WA 5BSGA 3ZGZA 2TS1A 2A92A 2YY6A 4JC0A 3JYQA 4AZSA 4Z4EA 2VKTA 3N76A 2DJ5A 4C4SA 3LNTA 2O0LA 1KR2A 2GZRA 4MYTA 1BU5A 4B7ZA 5K6AC 2GYVA 4UUPA 1N3BA 1N2HA 1NP7A 2BEKA 3D0QA 1VRWA 3AUSA 1RWQA 3BN3A 3DP7A 3M5CA 2PLNA 2QLNA 4DLRA 1AK9A 3E61A 4R84A 2ZIAA 3V48A 4YDHB 1JSXA 3T12A 5HF6A 3ZN2A 4EHLA 5FIUA 3E23A 1O5IA 1Z36A 4GNRA 4I1IA 4WCFB 1X92A 4GP9A 1HL7A 3WOHA 2P8SA 5JAQA 2P5YA 1U2DA 2HREA 4KU4A 1WPQA 5BPFA 1EFAA 2X0KA 4N9QA 3CZ9A 4DABA 4BN0A 1YDGA 1ADJA 1OXBB 3I53A 3PC6A 3OT4A 1OWLA 3RUCA 5TGDA 1ACJA 1UJ2A 2VF2A 2ZZKA 1FTWA 5BW4A 1AHNA 8ADHA 1DO2A 5DM70 3D2BA 1UOOA 3LF1A 2BHNA 1E1QA 2NUPB 2HWWA 2V7TA 3GC6A 4QOIA 4JA0A 3WZLA 1UC5B 2ODPA 2SECE 3H11B 3K6KA 2R6GA 3G0OA 3WLNA 4HDRA 4RA9A 3A4TA 1UBTS 2JFBA 3KR9A 1E6UA 4TMVA 5B57C 3JAKB 3IEIA 3REQB 4OLJA 3G9UA 1QCCA 1HE2A 1II0A 4O63O 1I6LA 3SIPA 1RHUA 3NBFA 3PQDA 2O59A 1JZTA 4W7IA 2O2HA 3QNUA 3G2IA 3ANNA 2JLRA 4DUYB 5JY1A 1UPFA 1IIRA 5DXAA 2ZSUA 5GQSA 4PSDA 1OAOC 1CF2O 2HIGA 2O7VA 4J0HA 3T54A 1RXSA 2HT1A 5LKRA 5LUAA 5AHRA 3GPCA 1QAOA 1Y98A 1DFIA 3NOVA 3QVGB 4JLPA 1ECCA 1PEYA 1KAHA 2C3MA 2AKAB 2UYYA 1ZC3A 3QLUC 1P7PA 2WQZA 1P7CA 4M37A 3VO1A 1V5GA 4ZVMA 4A03A 4D79A 3LUPA 3JZMA 4BVJA 1UPUA 5TMPA 2FE1A 5AKLA 1RYMA 3OAAD 2PIAA 3RANA 4GRDA 3U4AA 1XN4A 3D02A 3VX3A 4A0RA 4D8TA 2IX3A 4J16A 2PH3A 1AF4A 4RW0A 3RK4A 5K9ZA 2ZVDA 1OF1A 2QE7D 1W29A 3N2EA 2Y66A 4RY0A 2BF4A 1EFDN 2B2CA 5A0VA 1O58A 2A7XA 4MR7B 1JR3A 1X77A 4ZV7A 1QVWA 1DJOA 3DZKA 5COBA 3EC2A 1TXGA 2QT9A 4KQMA 2UVDA 3D3JA 4GLLA 5A4DA 1VJ0A 4GXQA 1A2KC 4MVJE 5HZHA 1Z74A 2VNIA 2QJOA 1ML4A 1N6RA 4HV4A 1KI6A 5EJ4A 1FNSA 3WVNA 3R0VA 2XMQA 3VX4A 4YV1A 4LF6B 4C21A 5L3QB 2R3SA 3QE2A 1U9IA 4TXJA 1FVOA 1ZC4A 5CM2Z 4ZYWA 3C6BA 1OFVA 4J91A 5EIEA 5TE9A 4DGQA 1JHYA 3W2GA 4YRQA 5EJ9A 4V0NA 2WJ6A 4CODB 3SWWA 3B6ZA 3E81A 3T9BA 3VPBA 5K0BA 3M49A 1EHYA 1TJ4A 3QTTA 3B1KA 4HGZA 4HTFB 4C2BA 3I1YA 3LPCA 5JD4A 1G21B 2HFKA 3C3WA 3UJAA 5LD2B 1NDUA 5JYCA 1MB0A 1L8XA 2IEBA 4HDMA 1M76A 2IYAA 4FR2A 1QHYA 5F5LA 1Y8QB 3L01A 3L5OA 1ST2A 1ECFA 4NPHA 5K6TA 1FDOA 4J8PA 3TNFA 4AMGA 3CV3A 4O4LB 1IY1A 3A3NA 3MUEA 3E22A 4A5SA 4I1UA 1BWQA 4P4LA 5HDBB 4BNLA 5FLXA 1U1EA 2V7GA 2B8TA 4N54A 5FYQA 5I9NA 4G0PA 2QG9A 1S3IA 3M6WA 3ZWCA 3RBAA 2LGJA 3TTUA 4FVTA 2MOKA 2OORA 3E35A 3VVLA 4BS9A 2YXLA 4LS3A 4ZMRA 2C82A 2FPGA 2J33A 1H5NA 4G5FA 1B16A 2ATEA 2MTBA 4C30A 4MCJA 4K8OA 1WLYA 2ZIVB 4RZXA 5E9WA 1MO3A 4EITA 3ROGA 3S1SA 1LLCA 1LC3A 2XLBA 4TLAA 2VSYA 2I4RA 4PSUA 1ZMRA 1RM5A 2AJ8A 2E5WA 4P6VF 3R9KA 3M8KA 1KVUA 3USES 4JD5A 5IG2A 2JA2A 4F3KA 3O1JC 4MH0R 4N3AA 3TLJA 3U6BA 5DW3A 4F4CA 3L43A 1EX1A 4PG4A 1Q3TA 2HA0A 1TFRA 3DWIA 3HUTA 3ROXA 4D0RA 2C0CA 2XXJA 2ZUSA 4DWJA 4LJ4A 1ACMA 4HLUC 5HUQA 2VQDA 3EDRA 4KBGA 4MIEA 2O05A 4JBXA 4EI9A 1M54A 1WPGA 2I67A 1H2FA 2BT4A 1I01A 2UZIR 3WNBA 4CDRA 2FU5C 4FSHA 4UDNA 3F0TA 3OPYA 2WAYA 3TVDA 3VZRA 3ZUPA 1LPPA 4UXJA 1ZS9A 2DFKB 2CE7A 1GZSA 3CZPA 1NGSA 4Q3LA 1RWNA 3NGLA 4IVRA 4R5HA 2FA9A 4HATA 4HNGA 1VPWA 1OFTA 3WYFA 4NZYA 1V3UA 3KUXA 1KHTA 2H4WA 1XELA 3NV9A 2P4QA 5D5PA 3SM3A 3SYTA 2MCFA 3E18A 1O97D 1DQPA 2H06A 3E5NA 2F00A 4O1HA 2WG2A 3DE7X 4RVHA 3WSVA 4KI7A 3UYKA 3CLTD 4HS9A 3KQMA 5T6MA 3WBKA 3MQ4A 4CKCB 2KSQA 1U81A 1YVRA 1Z07A 1E5XA 2PL1A 4FX2A 4LYJA 5TQ2A 2GAFA 3O84A 1RPAA 2KHZA 2MSKA 3CT6A 5IAEA 3RUIA 1VECA 1TQ4A 4Q4CA 3HQ4O 4ZK2A 2A59A 3FUWA 1HQYE 2A58A 4KRFA 3QLEA 3UMCA 1BRMA 3CUKA 2RHJA 3AGPA 3ZD8A 2OQIA 1BOOA 1CUDA 3GDWA 3RC9A 2I2XB 1UBEA 3H5AA 4WFKA 1DC3A 4ME6A 2CJFA 3IVXA 2JJ1D 1S3GA 2X0RA 4MV7A 4Y2GA 3VR4D 4X66B 1L4NA 3AVQA 3PGKA 3I5XA 5L7YA 3FY4A 3RAGA 1X1BA 3EVFA 2X0FA 4A8TA 1AMUA 4KIUA 4V0MA 2FJPA 3OY7A 2HQBA 5CEEA 3IEKA 1SVMA 2PSHA 4HXEB 5EJ5A 1R5NA 5DE3A 5LBTA 3W1WA 4L5AA 4O2BB 2P9EA 5T8KA 4OLBA 2I2WA 1Z88A 1KKMA 3F9CA 3C39A 4L02A 2PIDA 3C3MA 4U3JB 3MJTA 3L79A 4YS6A 1BMDA 2YHSA 1BQ3A 3DEYX 4A3SA 2G36A 2Q1YA 3DONA 3K70D 2IZZA 1QQ6A 2XTZA 4KO1S 4NPCA 3ZE7A 3NWJA 4RWZA 2WU8A 4O4LA 3QWIA 2EF0A 3LKZA 3OF5A 3QVTA 2WJWA 1UFOA 2DULA 2GCOA 4FUTA 3RBVA 3LRTA 1NJ8A 3MUOA 4PAWA 3FSGD 4LBWA 5AVXA 1BVRA 2ZDGA 3LQ2A 4B32A 3NYIA 3AO0B 3ZH9B 5FUVA 1S5PA 3Q9LA 1F2TA 5TARA 1FJ2A 4FOLA 2PUCA 3U4HA 5DU2A 4KPYA 4JITA 3ELBA 5MN6A 3RS2A 4WN9A 4A0HA 3DXXA 3MJRA 1H4TA 2B94A 1ZPDA 1ADGA 2IEGA 5L4NA 5LSAA 3CLUC 2HGZA 1F2DA 1P0CA 1PJ3A 3NC4A 5J2UB 5LA6A 6GPBA 2I91A 1A7AA 1R6TA 4FQ8A 2ATVA 4GPZA 1ODLA 2IF2A 3VR1A 6AT1A 1U2TA 1IMJA 2O06A 2ZJAA 2WJJA 3QXXA 3QEJA 2DY0A 3T1VA 2R1VB 4N7JA 3AF5A 1XLUA 3DFMA 4GQIA 2FVYA 4Q3KA 2DFTA 3JAWB 4XLTA 1KOFA 4EA9A 4OQMA 5AK6A 5G4KA 2YS7A 1OV4A 1WU7A 3IFSA 2ZZNA 1R4MA 3AFIA 2NM0A 3LQ1A 3B3GA 3FFXA 1AUPA 2BFPA 2H65A 2P7HA 1RP7A 1U02A 2YVQA 5DYTA 3KR1A 3GMTA 4YV2A 1WETA 3PJDA 4RHYA 1HE8B 1SCIA 4OQ4A 1TQ8A 3EZXA 4OEHA 3S4YA 3VZPA 4E1BA 4XI9A 2BFFB 1JI0A 2WR8A 5BQXA 1BMFA 1HT3A 3TDKA 3VMMA 5ABPA 5DHFA 2FV8A 4NMWA 1VIVA 5HF5A 2G1AA 2I6FA 1E1DA 3OEHA 3U39A 5KNDA 2VLIA 4MKRA 2CL0X 3QENA 4BO8A 2V7XA 2XUFA 1TPZA 3WGNA 1PFGA 3ZZMA 3R0JA 4B7AA 3VA7A 2Y6UA 3NNNA 5C8ZA 3GG2A 4WJKB 4GSKA 3FPEA 2OHVA 3A4YA 2NQ8A 3A1TA 3OCZA 1P8JA 4YUZA 3IKVA 4OXNA 4QPCA 3SJZA 1TCBA 2F3UA 2Y9PB 2Y1CA 2ZS9A 2D2VA 4MVJH 1EB9A 2GXUA 2JCXA 3NI2A 3SJ7A 5A02A 1R6VA 1NI3A 4P2GA 3Q6NA 2IEAA 2UDPA 1UPCA 1EVEA 2RI0A 3D2LA 5CVUA 2HZ7A 3GGCA 3GJ6A 5ALSA 4BNGA 1SULA 4EJSB 1QP4A 2M1XA 3LQFA 3LVQE 1GGEA 1DEKA 1JJ7A 3TCXB 3UT6A 2CVHA 1E7WA 1Z8FA 4M0EA 3VJLA 2I80A 5EUBA 3WQRA 2J87A 4XB2A 2D1TA 4ALIA 2O2DA 2IWHA 1PS9A 1UL1X 2EARA 5HUJA 4MVJM 3DMFA 2Q28A 3PQ8A 4OGKA 2HHLA 3HXMA 4ND1A 3R5JA 2HV8A 1D5WA 2J3HA 1O9HA 1CY8A 1CB0A 1X6VA 3GRKA 4G0YA 4UBMA 4AB1A 4B34A 4CEJB 1QYIA 3KDSE 4QJBA 4RVUA 4WI1A 5KDLA 3BORA 2FR0A 4DR3B 3CJQA 4GLFA 3L7AA 3OKFA 5LL6P 3UAGA 2UZAA 4DLTA 4XSHA 1X94A 3W79A 4MEAA 4R31A 3UMJA 2JBAA 1SK8A 3DHYA 2EQ5A 4JT4A 4HNRA 1LI7A 2HSDA 2DTEA 3BH7A 1UCFA 4IH9A 4TRRA 1CRQA 2ZT7A 4F2PA 5KYYA 1ZSNA 1M1NA 1E8MA 3PSAA 2R8EA 2PVSA 2XZPA 2B7CA 3ND5A 4XFJA 5GPBA 3RE1A 1YA4A 1EAYA 4CLOB 4E51A 1W8IA 5T7BA 2RGEA 3OMWA 4M99A 3JXEA 4Q3DA 3PNBA 1RXUA 2OV3A 1NOJA 5AW8A 1A7JA 1T6BY 1U4OA 2GZ3A 2PQ6A 2VR1A 2LV8A 1Q15A 1I7PA 3HUFA 1GD1O 1XOIA 4FHFA 4FFWA 3CF4G 1IPFA 4YFVA 4BVKA 1R0SA 4C04A 3PQEA 2IH2A 1JBEA 3PXUA 4IV0A 3UN1A 2EBFX 1LRJA 4BO7A 3BL5A 5T67A 4EGJA 2DWPA 3E70C 4B85A 3KPJA 4G4SP 1FFHA 5LBIA 2IIVA 4BLRA 2BSQA 1U5CA 3LDGA 2Q3FA 1DT3A 2MJLA 4BOYA 3FLAA 1SAYA 3LNCA 1SA0A 1GRQA 4DLZA 5I7VA 4EKEA 3CH4B 4W8HA 1Q2UA 1KS2A 2C4WA 2RHGB 2VP0A 3L7OA 1QHIA 4OOFA 4TT3D 3ZCXA 5KTRA 1D2NA 2GA9A 3B38A 3MTAA 2O8DB 3SHWA 2R00C 4ZALA 1U9IC 1G8SA 3EAQA 1Z17A 2CCGA 4JSYA 3O2SB 1DDGA 2G80A 4GDMA 1R0BA 3CLKA 1ZMBA 3B51X 3IEVA 2C1EA 4W63A 3PQ4A 2ZWPA 4FC6A 3E15A 2A35A 2Z5FA 3SEQA 2COEA 3GUCA 2LUOA 2V1XA 1NMQA 1JPVA 1UT8A 1UXIA 4HS4A 1X3SA 3W8DA 4D57A 3K4HA 4JI4B 2PU5A 1ZEMA 2XGGA 2B8NA 2ZRLA 4I19A 1J0BA 2Z2XA 5IKMA 2HF2A 1M83A 1TA0A 3HXLA 2R8BA 1DRKA 1P7YA 2UKDA 2YY5A 3I32A 1R15A 4IR7A 4TMFA 4WCFC 4V03A 3RG8A 4QM6A 3PX3A 1FBNA 2VZLA 1IQ0A 5FWXA 3HXPA 2XTMA 4Q18A 3DOFA 4NU5A 3TZKA 2FFBA 1TCVA 1X7DA 4K2AA 3TL6A 1PUXA 4M89A 3QOWA 4BKRA 5CVEA 1E1NA 4K9RA 4BV8A 3OH8A 5AM2A 3W5VA 4LIPD 5JPCA 3AL3A 3F4BA 4M8SA 4LF7B 2PN1A 3QVXA 1KI4A 5JC8A 4L8YA 2HRZA 2QMZA 2CHEA 1P17A 1SM4A 2WWIA 2B34A 1WUKS 2RBGA 3IKLA 4WKBA 5EKSA 2IDZA 3QEMA 1BKSB 4E1AA 1FCJA 1OTXA 3OCYA 1Q22A 2VXCA 4MGIR 1BGWA 2KS6A 1X80B 1GSAA 5IANA 3SYNA 4DT1A 1F4VA 2QYSA 1NQXA 1WZEA 2VAMA 3CO5A 3FR8A 3N7TA 4JJGA 4L5JA 1KK2A 2ZYIA 3B1YA 4NU8X 4F45A 1G3QA 4N0EA 4DCUA 2OHXA 4DM3A 4RDIA 3DUWA 2W4QA 3CRW1 2VO1A 3NDPA 2J0EA 1ND6A 5C2JB 1PJCA 1OXTA 3UV6A 2RK3A 4TLDA 4H7FA 4BEBA 1EB8A 1MNQA 1SRQA 1XFDA 4Q4DA 4OF4A 4FD3A 2X2FA 2V7QD 1JQAA 2O20A 1W9MA 3AK4A 1H8ED 3KEQA 5L7TA 3GJ4A 4HRVA 1LCIA 4RH0A 1B2RA 3A14A 4QAJA 1LS1A 2I55A 2G70A 4H0CA 3L7LA 3HCWA 3UZUA 3KQQA 4KQKA 1LPSA 1A76A 3TLYA 5JSZA 4BNFA 1DTWA 2WSYB 1TZBA 4YDSA 3AWIA 5H68A 2BFWA 4HAYA 4BWFB 5HJ2A 1Y3HA 4CDNA 3X1YA 1KF0A 2DY1A 2QZ4A 3LXXA 5HK9A 4YFYA 2AQ8A 4JCCA 4HDCA 3CIOA 3MAJA 4DE5A 1K9VF 3X0DA 3NKVA 1XVVA 4XVRA 3NBMA 1ECBA 3WO0A 5K8TA 2NQ2C 4LZLA 3BXHA 4OYYA 1QLHA 3QJGA 1A8HA 2Y76A 3WRXC 1U0LA 3LBNA 2Q0HA 5T4HA 1BWRA 2BHTA 3OSUA 4Q4AA 2OHHA 4PZLA 2DMRA 4ZXPA 2ZTSA 4N5HX 5LP6F 4N48A 1C3OB 1LJLA 1YOVA 2ZRFA 3Q9UA 4OH1A 4DANA 3E5RA 4BIMA 2JLBA 4EW6A 1YQEA 3QV2A 3EPJA 4UCXA 1F6WA 3HJTA 1W48A 4G25A 1RI5A 4BLWA 3PFFA 3GHHA 3DCJA 3IQGX 4FFLA 5DW0A 4J0KA 1L4GA 3PWSA 2D8MA 2QJFA 5CBPB 1XPUA 4UM5A 4CUJA 1YCDA 2J0UB 3NAMA 2R1VA 1J5EB 1W4LA 3ZWQA 4ZYTA 3P52A 1EA7A 3A3OA 2JPDA 4V0QA 4CMIB 4MKFA 1H6CA 4HUQA 2IEIA 4QT0A 4DS3A 1XI2A 5K09A 1RHJA 2NQTA 2YHBA 3DHNA 1RPJA 4XRRA 3ITKA 3U7HB 1KVQA 2CXOA 2NUTB 3BE4A 5DHUA 2AOVA 2XYGA